RPSBLAST alignment of GI: 254780973 and protein with PDBid: 2gqr

>2gqr_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; PURC, ADE2, ADE1, nucleotide complex, octahedral magnesium coordination; HET: ADP; 2.00A {Escherichia coli} PDB: 2gqs_A* Length = 237
 Score =  176 bits (446), Expect = 6e-45
 Identities = 81/238 (34%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M+ +  +Y  K K +Y    P  L+  F++D    +  R    + KG++NN+ + ++ ++
Sbjct: 1   MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSK 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L + GIP    R ++  E LV+ ++M+P+   VRN AAGSL KRL I EG+ L   L + 
Sbjct: 61  LAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDL 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           +   D+    +V+E +   F W ++  +  M  L+ + ND +  LF    + LVDF+++ 
Sbjct: 121 FLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEF 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G         +VL DE  PD  RLWD    E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 181 GL----YKGEVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRLGV 234