BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780973|ref|YP_003065386.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Candidatus Liberibacter asiaticus str. psy62] (255 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780973|ref|YP_003065386.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 255 Score = 520 bits (1340), Expect = e-150, Method: Compositional matrix adjust. Identities = 255/255 (100%), Positives = 255/255 (100%) Query: 1 MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60 MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ Sbjct: 1 MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60 Query: 61 LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120 LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF Sbjct: 61 LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120 Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC Sbjct: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180 Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK Sbjct: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240 Query: 241 KNEPALKENLILNRK 255 KNEPALKENLILNRK Sbjct: 241 KNEPALKENLILNRK 255 >gi|254781098|ref|YP_003065511.1| cell division protein FtsW peptidoglycan synthesis [Candidatus Liberibacter asiaticus str. psy62] Length = 385 Score = 24.3 bits (51), Expect = 2.4, Method: Compositional matrix adjust. Identities = 9/17 (52%), Positives = 13/17 (76%) Query: 149 EEMTALSIRINDFMTGL 165 + M ++IRIN FMTG+ Sbjct: 209 QTMPHVAIRINHFMTGV 225 >gi|254781026|ref|YP_003065439.1| hypothetical protein CLIBASIA_04640 [Candidatus Liberibacter asiaticus str. psy62] Length = 186 Score = 22.3 bits (46), Expect = 7.6, Method: Compositional matrix adjust. Identities = 8/14 (57%), Positives = 10/14 (71%) Query: 29 KDDNLLENNPRCAT 42 KD+N+ PRCAT Sbjct: 141 KDENVCIRGPRCAT 154 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.140 0.409 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 162,970 Number of Sequences: 1233 Number of extensions: 6603 Number of successful extensions: 16 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 5 length of query: 255 length of database: 328,796 effective HSP length: 72 effective length of query: 183 effective length of database: 240,020 effective search space: 43923660 effective search space used: 43923660 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 37 (18.9 bits)