HHsearch alignment for GI: 254780975 and conserved domain: PRK10128

>PRK10128 putative aldolase; Provisional.
Probab=97.24  E-value=0.02  Score=35.83  Aligned_cols=181  Identities=14%  Similarity=0.197  Sum_probs=111.8

Q ss_pred             HHHHHHCCCCEEEEEEECCEECCCCCCCHH----HHHHHHHCCCCEEEEEEEEEECC-HHHHHHCCCCCC-EEEEECCCC
Q ss_conf             999996599899997342634584341789----99986412564168567885120-336764047760-799970664
Q gi|254780975|r   23 ISNITKAGAKQIHFDVMDGCFVPNISFGAD----VIRSLRSYSDSVFDCHLMISSID-SHINIIADAGCD-IITFHPESS   96 (224)
Q Consensus        23 i~~l~~~~~d~iHiDImDg~fvpn~~~~~~----~i~~i~~~t~~~~dvHLMv~~P~-~~i~~~~~~g~d-~i~~H~E~~   96 (224)
T Consensus        15 aEi~a~~G~D~v~iD~EHg~~------~~~~~~~~~~a~~~~~~~pi-VR--v~~~~~~~i~r~LD~Ga~GiivP~V~ta   85 (250)
T PRK10128         15 AEIAATSGYDWLLIDGEHAPN------TIQDLYHQLQAVAPYASQPV-IR--PVEGSKALIKQVLDIGAQTLLIPMVDTA   85 (250)
T ss_pred             HHHHHCCCCCEEEEECCCCCC------CHHHHHHHHHHHHHCCCCEE-EE--CCCCCHHHHHHHHHCCCCEEEECCCCCH
T ss_conf             999980898999981778999------99999999999986599719-98--5899988999998378987785474869


Q ss_pred             CCHHHHHHHHHH-----CCCEEE----------------------EEEECCC--CHHHHHHHHH--HCCEEEEE----EE
Q ss_conf             215899986776-----498259----------------------9852333--4478998862--01402899----83
Q gi|254780975|r   97 PHIRRSLRTIHA-----MGKKTG----------------------VAINPET--PVAILEDVID--EIDMILIM----TV  141 (224)
Q Consensus        97 ~~~~~~i~~i~~-----~g~k~G----------------------iai~p~T--~~~~i~~~l~--~~D~vliM----~V  141 (224)
T Consensus        86 e~A~~~V~~~kYpP~G~Rg~g~~~~r~~~~g~~~~y~~~~n~~~~vi~qIEt~~av~nldeI~av~GvD~~fiGp~DLs~  165 (250)
T PRK10128         86 EQARQVVSATRYPPYGERGVGASVARAARWGRIENYMAQVNDSLCLLVQVESKTALDNLDEILDVEGIDGVFIGPADLSA  165 (250)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCEEEEEECCHHHHHHHHHHHCCCCCCEEEECHHHHHH
T ss_conf             99999999851699999988864232244577479999986413665441558999879998588998889988488998


Q ss_pred             ECCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHCCCCEEEECHH--HHCCCCHHHHHHHHHHHH
Q ss_conf             0677653322013577899865431386526981589988999999679989997426--637899899999999999
Q gi|254780975|r  142 NPGFGGQQLIESTIPKIRQAKALIGKRSISLEVDGGVTSRNIKSLVQAGADLLVVGSS--FFNQKGEISYAKRLNDLK  217 (224)
Q Consensus       142 ~PG~~Gq~f~~~~l~kI~~l~~~~~~~~~~I~vDGGvn~~~i~~l~~~Gad~~V~Gsa--if~~~d~~~~~~~l~~l~  217 (224)
T Consensus       166 slG~pg~~~~p~v~~ai~~v~~~~~~~gk~~G~~-~~~~~~a~~~~~~G~~~v~~g~D~~ll~~----a~~~~l~~~r  238 (250)
T PRK10128        166 SLGYPDNAGHPEVQRIIETSIRRIRAAGKAAGFL-AVAPDMAQQCLAWGANFVAVGVDTMLYSD----ALDQRLAMFK  238 (250)
T ss_pred             HCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEE-CCCHHHHHHHHHCCCCEEEEHHHHHHHHH----HHHHHHHHHH
T ss_conf             6599999998699999999999999869976883-79999999999769999986579999999----9999999985