HHsearch alignment for GI: 254780975 and conserved domain: cd02803

>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.
Probab=93.12  E-value=0.76  Score=25.71  Aligned_cols=123  Identities=15%  Similarity=0.269  Sum_probs=75.8

Q ss_pred             HHCCCCCCEEEEECCCC--------------------------CCHHHHHHHHHHC---CCEEEEEEECCCC------HH
Q ss_conf             64047760799970664--------------------------2158999867764---9825998523334------47
Q gi|254780975|r   80 IIADAGCDIITFHPESS--------------------------PHIRRSLRTIHAM---GKKTGVAINPETP------VA  124 (224)
Q Consensus        80 ~~~~~g~d~i~~H~E~~--------------------------~~~~~~i~~i~~~---g~k~Giai~p~T~------~~  124 (224)
T Consensus       149 ~A~~AGfDgVEIh~ahGyLl~qFlSp~~N~RtD~YGGs~eNR~Rf~~eii~air~~vg~df~vgvRls~~d~~~~g~~~~  228 (327)
T cd02803         149 RAKEAGFDGVEIHGAHGYLLSQFLSPYTNKRTDEYGGSLENRARFLLEIVAAVREAVGPDFPVGVRLSADDFVPGGLTLE  228 (327)
T ss_pred             HHHHCCCCEEEECCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEECHHHCCCCCCCHH
T ss_conf             99984999899835766188872175469877778889899989999999999997398876179977021268999989


Q ss_pred             HH---HHHHHH--CCEEEEEEEE---C------CCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC-CHHHHHHHHHC
Q ss_conf             89---988620--1402899830---6------77653322013577899865431386526981589-98899999967
Q gi|254780975|r  125 IL---EDVIDE--IDMILIMTVN---P------GFGGQQLIESTIPKIRQAKALIGKRSISLEVDGGV-TSRNIKSLVQA  189 (224)
Q Consensus       125 ~i---~~~l~~--~D~vliM~V~---P------G~~Gq~f~~~~l~kI~~l~~~~~~~~~~I~vDGGv-n~~~i~~l~~~  189 (224)
T Consensus       229 e~~~~~~~l~~~gvd~i~vs~g~~~~~~~~~~~~~~~~~~~---~~~~~~ik~~---~~~pvi~~G~i~~~~~a~~~l~~  302 (327)
T cd02803         229 EAIEIAKALEEAGVDALHVSGGSYESPPPIIPPPYVPEGYF---LELAEKIKKA---VKIPVIAVGGIRDPEVAEEILAE  302 (327)
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCC---HHHHHHHHHH---CCCCEEEECCCCCHHHHHHHHHC
T ss_conf             99999999985599989977784566754467877775223---8999999997---69819998998999999999988


Q ss_pred             C-CCEEEECHHHHCCCCHHH
Q ss_conf             9-989997426637899899
Q gi|254780975|r  190 G-ADLLVVGSSFFNQKGEIS  208 (224)
Q Consensus       190 G-ad~~V~Gsaif~~~d~~~  208 (224)
T Consensus       303 g~~D~V~~gR~~iadPd~~~  322 (327)
T cd02803         303 GKADLVALGRALLADPDLPN  322 (327)
T ss_pred             CCCCHHHHHHHHHHCCCHHH
T ss_conf             99312586699997914999