HHsearch alignment for GI: 254780976 and conserved domain: COG0816

>COG0816 Predicted endonuclease involved in recombination (possible Holliday junction resolvase in Mycoplasmas and B. subtilis) [DNA replication, recombination, and repair]
Probab=100.00  E-value=5.9e-41  Score=268.46  Aligned_cols=138  Identities=43%  Similarity=0.685  Sum_probs=131.3

Q ss_pred             CCCEEEEECCCCEEEEEEEECCCCEECCCEEEECCCCC-HHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHH
Q ss_conf             98399998688768999630765110121011047741-56898999986516775899721357888884479999999
Q gi|254780976|r   16 NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVT-QTALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFV   94 (160)
Q Consensus        16 ~~riLgiD~G~kriGiAisd~~~~~a~Pl~~i~~~~~~-~~~~~l~~ii~e~~i~~iVvGlP~~~~g~~~~~~~~v~~f~   94 (160)
T Consensus         1 ~~~ilalD~G~KrIGvA~sd~~~~~A~pl~~i~~~~~~~~~~~~l~~li~~~~~~~vVVGlP~~m~g~~~~~~~~~~~f~   80 (141)
T COG0816           1 GMRILALDVGTKRIGVAVSDILGSLASPLETIKRKNGKPQDFNALLKLVKEYQVDTVVVGLPLNMDGTEGPRAELARKFA   80 (141)
T ss_pred             CCEEEEEECCCCEEEEEEECCCCCCCCCHHHEEECCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHHHH
T ss_conf             96499996278748899764777521241430203353756999999999838887999667688887134699999999


Q ss_pred             HHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999840489977998367167999999998698644546437899899999999968645
Q gi|254780976|r   95 HNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISF  154 (160)
Q Consensus        95 ~~L~~~~~~l~v~~~DEr~TS~~A~~~l~~~g~~~k~~k~~iD~~AA~iILq~~Ld~~~~  154 (160)
T Consensus        81 ~~L~-~r~~lpv~l~DERltTv~A~~~L~~~~~~~~~rk~~iD~~AA~~ILq~~ld~~~~  139 (141)
T COG0816          81 ERLK-KRFNLPVVLWDERLSTVEAERMLIEAGVSRKKRKGVIDSLAAVLILESYLDRNHA  139 (141)
T ss_pred             HHHH-HHCCCCEEEECCCCCHHHHHHHHHHCCCCHHHHCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             9998-7649878998186579999999997587344434143899999999999975200