HHsearch alignment of GI: 254780976 and MMDB domain: 1iv0_A_

>1iv0_A (A:) Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus}
Probab=99.96  E-value=4.3e-29  Score=196.33  Aligned_cols=98  Identities=32%  Similarity=0.569  Sum_probs=94.0

Q ss_pred             CCEEEEECCCCEEEEEEEECCCCEECCCEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHH
Q ss_conf             83999986887689996307651101210110477415689899998651677589972135788888447999999999
Q gi|254780976|r   17 QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHN   96 (160)
Q Consensus        17 ~riLgiD~G~kriGiAisd~~~~~a~Pl~~i~~~~~~~~~~~l~~ii~e~~i~~iVvGlP~~~~g~~~~~~~~v~~f~~~   96 (160)
                      .|+||||||+||||+|+||+.+.+|+|++++.+++..+.+..|.+++++|+++.||||+|++++|+++++++.++.|+++
T Consensus         1 MrilgiD~G~kriGvAi~d~~~~~a~pl~~i~~~~~~~~~~~l~~li~~~~v~~iVvGlP~~~~g~~~~~~~~i~~f~~~   80 (98)
T 1iv0_A            1 MRVGALDVGEARIGLAVGEEGVPLASGRGYLVRKTLEEDVEALLDFVRREGLGKLVVGLPLRTDLKESAQAGKVLPLVEA   80 (98)
T ss_dssp             CCEEEEEESSSEEEEEEECSCCSSCCCEEEEECCCHHHHHHHHHHHHHHHTCCEEEEECCCCCCSSSCCCSSTTHHHHHH
T ss_pred             CCEEEEEECCCEEEEEEECCCCCEEECEEEEECCCCHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             92999980899899999259998781678898678658999999999873625078168977899918899999999999


Q ss_pred             HHHHCCCCCEEEECCCCCHH
Q ss_conf             98404899779983671679
Q gi|254780976|r   97 MIDRKVYVPFVFWDERLTTV  116 (160)
Q Consensus        97 L~~~~~~l~v~~~DEr~TS~  116 (160)
                      |.  .+++||++|||||||+
T Consensus        81 l~--~~~i~v~~~DEr~SSk   98 (98)
T 1iv0_A           81 LR--ARGVEVELWDERFTTK   98 (98)
T ss_dssp             HH--HTTCEEEEECCSCCCC
T ss_pred             HH--HCCCCEEEECCCCCCC
T ss_conf             86--4799899987898888