HHsearch alignment of GI: 254780976 and MMDB domain: 1vhx_A_

>1vhx_A (A:) Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis}
Probab=100.00  E-value=2.1e-36  Score=240.55  Aligned_cols=144  Identities=35%  Similarity=0.490  Sum_probs=133.0

Q ss_pred             CCCEEEEECCCCEEEEEEEECCCCEECCCEEEECCC--CCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHH
Q ss_conf             983999986887689996307651101210110477--415689899998651677589972135788888447999999
Q gi|254780976|r   16 NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAF   93 (160)
Q Consensus        16 ~~riLgiD~G~kriGiAisd~~~~~a~Pl~~i~~~~--~~~~~~~l~~ii~e~~i~~iVvGlP~~~~g~~~~~~~~v~~f   93 (160)
                      ++||||||||++|||+|++|+.+.+++|+.++.++.  ....+..|.+++++|+|+.+|||+|++++|++++++..++.|
T Consensus         2 ~mriLgiD~G~~riG~Av~d~~~~~a~~l~~i~~~~~~~~~~~~~L~~ii~~~~~~~iviG~p~~~~g~~~~~~~~~~~~   81 (150)
T 1vhx_A            2 SLRILGLDLGTKTLGVALSDEXGWTAQGIETIKINEAEGDYGLSRLSELIKDYTIDKIVLGFPKNXNGTVGPRGEASQTF   81 (150)
T ss_dssp             CEEEEEEEECSSEEEEEEECTTSSSEEEEEEEECBGGGTBCCHHHHHHHHTTSEEEEEEEECCCCBTTBCCHHHHHHHHH
T ss_pred             CCEEEEEEECCCEEEEEEECCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCHHHHHHHHHH
T ss_conf             84399999279989999973898843560446503456226899999999763436288516423477621788999999


Q ss_pred             HHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9999840489977998367167999999998698644546437899899999999968645662288
Q gi|254780976|r   94 VHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG  160 (160)
Q Consensus        94 ~~~L~~~~~~l~v~~~DEr~TS~~A~~~l~~~g~~~k~~k~~iD~~AA~iILq~~Ld~~~~~~~~~~  160 (160)
                      +..+. +.+++||++|||||||.+|++.+...|.+++++++.+|++||++|||+||++.+...+..|
T Consensus        82 ~~~l~-~~~~i~v~~~dE~~ss~~a~~~l~~~g~~~k~~k~~~D~~aA~~ILq~~L~~~~~~~~~~~  147 (150)
T 1vhx_A           82 AKVLE-TTYNVPVVLWDERLTTXAAEKXLIAADVSRQKRKKVIDKXAAVXILQGYLDSLNEGGSHHH  147 (150)
T ss_dssp             HHHHH-HHHCSCEEEECCSSCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHHTC------
T ss_pred             HHHHC-CCCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             99735-5778327984155579999999997599700034147699999999999987627687665