HHsearch results for GI: 254780976 and protein with PDBid: 1vhx_A

>1vhx_A Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} SCOP: c.55.3.8
Probab=100.00  E-value=1.3e-43  Score=283.19  Aligned_cols=142  Identities=36%  Similarity=0.532  Sum_probs=132.6

Q ss_pred             CCCEEEEECCCCEEEEEEEECCCCEECCCEEEECCCCCH--HHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHH
Q ss_conf             983999986887689996307651101210110477415--689899998651677589972135788888447999999
Q gi|254780976|r   16 NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQ--TALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAF   93 (160)
Q Consensus        16 ~~riLgiD~G~kriGiAisd~~~~~a~Pl~~i~~~~~~~--~~~~l~~ii~e~~i~~iVvGlP~~~~g~~~~~~~~v~~f   93 (160)
                      +.|+||||||+||||+|+||+.+.+|+|++++.+++...  .+.+|.+++++|+|+.||||+|+++||+++++++.++.|
T Consensus         2 ~MriLgiD~G~kriGvAisD~~~~~a~pl~~i~~~~~~~~~~~~~i~~ii~e~~i~~iViGlP~~~dg~~~~~~~~v~~f   81 (150)
T 1vhx_A            2 SLRILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLSRLSELIKDYTIDKIVLGFPKNMNGTVGPRGEASQTF   81 (150)
T ss_dssp             CEEEEEEEECSSEEEEEEECTTSSSEEEEEEEECBGGGTBCCHHHHHHHHTTSEEEEEEEECCCCBTTBCCHHHHHHHHH
T ss_pred             CCEEEEEECCCCEEEEEEECCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHH
T ss_conf             86099995289979999956998833560113322345247999999999983999699857846688754889999999


Q ss_pred             HHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             99998404899779983671679999999986986445464378998999999999686456622
Q gi|254780976|r   94 VHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS  158 (160)
Q Consensus        94 ~~~L~~~~~~l~v~~~DEr~TS~~A~~~l~~~g~~~k~~k~~iD~~AA~iILq~~Ld~~~~~~~~  158 (160)
                      ++.|. +.+++||++|||||||++|++.+++.|++++++|+.+|++||++|||+|||+.+...|-
T Consensus        82 ~~~l~-~~~~l~V~~~DEr~TS~~A~~~l~~~~~~~~k~k~~iD~~AA~iILq~~Ld~~n~g~~~  145 (150)
T 1vhx_A           82 AKVLE-TTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKKVIDKMAAVMILQGYLDSLNEGGSH  145 (150)
T ss_dssp             HHHHH-HHHCSCEEEECCSSCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHHTC----
T ss_pred             HHHHC-CCCCCCEEEECCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             99626-58897568867886599999999976997000441476999999999999876376875