HHSEARCH alignment of GI: 254780976 and SCOP domain: d1iv0a_

Alignment
>d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus [TaxId: 274]}
Probab=99.97  E-value=4.4e-31  Score=205.95  Aligned_cols=98  Identities=32%  Similarity=0.568  Sum_probs=93.5

Q ss_pred             CCEEEEECCCCEEEEEEEECCCCEECCCEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHH
Q ss_conf             83999986887689996307651101210110477415689899998651677589972135788888447999999999
Q gi|254780976|r   17 QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHN   96 (160)
Q Consensus        17 ~riLgiD~G~kriGiAisd~~~~~a~Pl~~i~~~~~~~~~~~l~~ii~e~~i~~iVvGlP~~~~g~~~~~~~~v~~f~~~   96 (160)
                      .|+||||||+||||+|+||+.+.+|+|++++.+++..+++.+|.+++++|+|+.||||+|++|||+++++++.+++|+++
T Consensus         1 MriLglD~G~kriGiAisd~~~~~a~pl~~i~~~~~~~~~~~l~~ii~e~~i~~iVvGlP~~~dG~~~~~~~~v~~f~~~   80 (98)
T d1iv0a_           1 MRVGALDVGEARIGLAVGEEGVPLASGRGYLVRKTLEEDVEALLDFVRREGLGKLVVGLPLRTDLKESAQAGKVLPLVEA   80 (98)
T ss_dssp             CCEEEEEESSSEEEEEEECSCCSSCCCEEEEECCCHHHHHHHHHHHHHHHTCCEEEEECCCCCCSSSCCCSSTTHHHHHH
T ss_pred             CCEEEEECCCCEEEEEEECCCCCEECCEEEEECCCCHHHHHHHHHHHHHHCCCEEECCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             94999980899899999149998494568898778467899999999863301057166322379837889999999999


Q ss_pred             HHHHCCCCCEEEECCCCCHH
Q ss_conf             98404899779983671679
Q gi|254780976|r   97 MIDRKVYVPFVFWDERLTTV  116 (160)
Q Consensus        97 L~~~~~~l~v~~~DEr~TS~  116 (160)
                      |. . .++||++|||||||+
T Consensus        81 L~-~-~~lpv~~~DErlTSk   98 (98)
T d1iv0a_          81 LR-A-RGVEVELWDERFTTK   98 (98)
T ss_dssp             HH-H-TTCEEEEECCSCCCC
T ss_pred             HH-H-CCCCEEEECCCCCCC
T ss_conf             96-4-799999986898888


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: Putative Holliday junction resolvase RuvX
domain: Hypothetical protein, YqgF homologue
species: Thermus thermophilus [TaxId: 274]