HHSEARCH alignment of GI: 254780976 and SCOP domain: d1q18a1

Alignment
>d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk {Escherichia coli [TaxId: 562]}
Probab=94.46  E-value=0.046  Score=30.34  Aligned_cols=68  Identities=10%  Similarity=0.038  Sum_probs=46.6

Q ss_pred             CCEEEEECCCCEEEEEEEECCCCEECCCEEEECCCCCHHHHHHHHHHHHHC--CCEEEEEECCCCCCCCC
Q ss_conf             839999868876899963076511012101104774156898999986516--77589972135788888
Q gi|254780976|r   17 QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN--IAAFIIGLPLNMNGSEG   84 (160)
Q Consensus        17 ~riLgiD~G~kriGiAisd~~~~~a~Pl~~i~~~~~~~~~~~l~~ii~e~~--i~~iVvGlP~~~~g~~~   84 (160)
                      +.+|++|.|-.++=+|+.|..+....-....+..........+..++++++  +..+.+|.|-..++...
T Consensus         2 ~~~L~~DIGGTn~r~alv~~~~~~l~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~i~~ag~~~~~~~   71 (110)
T d1q18a1           2 KYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGCIAIACPITGDWV   71 (110)
T ss_dssp             CEEEEEEECSSEEEEEEEETTTCCEEEEEEEEGGGCSCHHHHHHHHHHHHTCCCSEEEEEESSCCCSSEE
T ss_pred             CEEEEEEECCHHEEEEEEECCCCEEEEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCEE
T ss_conf             4899999880059999998699808888851354324599999998763366655699822434257377


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Glucokinase
domain: Glucokinase Glk
species: Escherichia coli [TaxId: 562]