HHSEARCH alignment of GI: 254780976 and SCOP domain: d1woqa1

Alignment
>d1woqa1 c.55.1.10 (A:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]}
Probab=90.14  E-value=0.25  Score=25.92  Aligned_cols=102  Identities=13%  Similarity=0.075  Sum_probs=52.7

Q ss_pred             CCCEEEEECCCCEEEEEEEECC-CCEECCCEEEE--CCC-CCHHHHHHHHHHHH----H----CCCEEEEEECCCCCCC-
Q ss_conf             9839999868876899963076-51101210110--477-41568989999865----1----6775899721357888-
Q gi|254780976|r   16 NQPIASIDLGTKRIGLAISDPG-RRFAHPRPFLV--RKK-VTQTALELLSFITT----E----NIAAFIIGLPLNMNGS-   82 (160)
Q Consensus        16 ~~riLgiD~G~kriGiAisd~~-~~~a~Pl~~i~--~~~-~~~~~~~l~~ii~e----~----~i~~iVvGlP~~~~g~-   82 (160)
                      +..+||||+|-.+|=+|+.|.. +.+..-...++  ... .......+..++++    +    .+.++-||.|-..+.. 
T Consensus         1 ~~~vlGiDiGgT~i~~~l~d~~~g~i~~~~~~~~t~~~~~~~~~~~~i~~~~~~l~~~~~~~~~~~gIGi~~pG~vd~~~   80 (129)
T d1woqa1           1 NAPLIGIDIGGTGIKGGIVDLKKGKLLGERFRVPTPQPATPESVAEAVALVVAELSARPEAPAAGSPVGVTFPGIIQHGV   80 (129)
T ss_dssp             CCCEEEEEECSSEEEEEEEETTTTEEEEEEEEEECCSSCCHHHHHHHHHHHHHHHHTSTTCCCTTCCEEEEESSCEETTE
T ss_pred             CCCEEEEEECCCEEEEEEEECCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCEEEEECCE
T ss_conf             99889999883669999998999989999860142467789999999999999987401435531046303210486470


Q ss_pred             ----CCHHHH-HHHHHHHHHHHHCCCCCEEEECCCCCHHHH
Q ss_conf             ----884479-999999999840489977998367167999
Q gi|254780976|r   83 ----EGPRVH-STRAFVHNMIDRKVYVPFVFWDERLTTVSA  118 (160)
Q Consensus        83 ----~~~~~~-~v~~f~~~L~~~~~~l~v~~~DEr~TS~~A  118 (160)
                          .+.... .=..+.+.| ++.+++||++-+.--...-|
T Consensus        81 ~~~~~~~~~~w~~~~l~~~l-~~~~~~pv~i~NDan~aalg  120 (129)
T d1woqa1          81 VHSAANVDKSWLNTDIDALL-TARLGRPVEVINDADAAGLA  120 (129)
T ss_dssp             ECCCTTSCGGGTTCBHHHHH-HHHHTSCEEEEEHHHHHHHH
T ss_pred             EEEECCCCCCCCCCCCHHHH-HHHCCCCEEEEEHHHHHHHH
T ss_conf             89813447874103615668-98629958998769999999


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: ROK
domain: Inorganic polyphosphate/ATP-glucomannokinase PPGMK
species: Arthrobacter sp. KM [TaxId: 184230]