HHSEARCH alignment of GI: 254780976 and SCOP domain: d2ap1a2

Alignment
>d2ap1a2 c.55.1.10 (A:1-117) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]}
Probab=94.73  E-value=0.091  Score=28.57  Aligned_cols=93  Identities=13%  Similarity=0.184  Sum_probs=55.6

Q ss_pred             EEEEECCCCEEEEEEEECCCCEECCCEEE-ECCCCCHHHHHHHHHHHHH-----CCCEEEEEECCCCCCCCCHHH-----
Q ss_conf             99998688768999630765110121011-0477415689899998651-----677589972135788888447-----
Q gi|254780976|r   19 IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-----NIAAFIIGLPLNMNGSEGPRV-----   87 (160)
Q Consensus        19 iLgiD~G~kriGiAisd~~~~~a~Pl~~i-~~~~~~~~~~~l~~ii~e~-----~i~~iVvGlP~~~~g~~~~~~-----   87 (160)
                      +||||.|..+|=+|+.|..+.+-.-..+- +.......+..+.+++++.     .+..+-||.|=..|...+...     
T Consensus         2 yiGiDiGgT~i~~~l~d~~g~i~~~~~~~t~~~~~~~~~~~i~~~i~~~~~~~~~~~~igi~~pG~vd~~~g~i~~~~~~   81 (117)
T d2ap1a2           2 YYGFDIGGTKIALGVFDSTRRLQWEKRVPTPHTSYSAFLDAVCELVEEADQRFGVKGSVGIGIPGMPETEDGTLYAANVP   81 (117)
T ss_dssp             EEEEEECSSEEEEEEEETTCCEEEEEEEECCCSCHHHHHHHHHHHHHHHHHHHTSCCEEEEEESSBSCCTTSCCBCTTCT
T ss_pred             EEEEEECCCEEEEEEEECCCCEEEEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCEEECCCCC
T ss_conf             99999780109999996999999998774024578999999999999988626741269872377543456666046765


Q ss_pred             H-HHHHHHHHHHHHCCCCCEEEECCC
Q ss_conf             9-999999999840489977998367
Q gi|254780976|r   88 H-STRAFVHNMIDRKVYVPFVFWDER  112 (160)
Q Consensus        88 ~-~v~~f~~~L~~~~~~l~v~~~DEr  112 (160)
                      . .-..+.+.| ++.+++||++-+.-
T Consensus        82 ~w~~~~l~~~l-~~~~~~pv~l~NDa  106 (117)
T d2ap1a2          82 AASGKPLRADL-SARLDRDVRLDNDA  106 (117)
T ss_dssp             TTTTSCHHHHH-HHHHTSCEEEEEHH
T ss_pred             CCCCCCHHHHH-HHHHCCCEEEEEHH
T ss_conf             55797589999-88769989997478


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: ROK
domain: Putative regulator protein YcfX
species: Salmonella typhimurium [TaxId: 90371]