BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780976|ref|YP_003065389.1| Holliday junction resolvase
YqgF [Candidatus Liberibacter asiaticus str. psy62]
         (160 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780976|ref|YP_003065389.1| Holliday junction resolvase YqgF [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040653|gb|ACT57449.1| Holliday junction resolvase YqgF [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 160

 Score =  323 bits (829), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL
Sbjct: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ
Sbjct: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG
Sbjct: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160


>gi|315122522|ref|YP_004063011.1| Holliday junction resolvase YqgF [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495924|gb|ADR52523.1| Holliday junction resolvase YqgF [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 167

 Score =  288 bits (737), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 152/159 (95%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           MSILLIEDLVKSLKPNQPIASIDLGTK+IG+AISD GRRFAHPRPFL+RKK+TQTALELL
Sbjct: 1   MSILLIEDLVKSLKPNQPIASIDLGTKKIGIAISDLGRRFAHPRPFLIRKKITQTALELL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           SF TTENIAAF+IGLPLNMNGSEGPRV STRAFV NMIDR++ VPF+FWDERLTTVSAQQ
Sbjct: 61  SFATTENIAAFVIGLPLNMNGSEGPRVQSTRAFVQNMIDREINVPFIFWDERLTTVSAQQ 120

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           ILIDM+VSRKKR QKVDSIAA+LILQEVLDRIS L+SS+
Sbjct: 121 ILIDMDVSRKKRAQKVDSIAASLILQEVLDRISSLKSSE 159


>gi|209549118|ref|YP_002281035.1| Holliday junction resolvase-like protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|226731643|sp|B5ZMI7|RUVX_RHILW RecName: Full=Putative Holliday junction resolvase
 gi|209534874|gb|ACI54809.1| Holliday junction resolvase YqgF [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 163

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 89/160 (55%), Positives = 121/160 (75%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L IE++ ++L P Q IA +DLGTK IGL++SD GRRFA PRP + R K T  A  L+
Sbjct: 1   MTVLTIEEMAETLAPRQAIAGLDLGTKTIGLSMSDLGRRFATPRPVIRRVKFTIDAQALM 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F T E +A F+IGLP+NM+GS GPRV +TRAFV NM ++K  +PFV+WDERL+TV+A++
Sbjct: 61  DFATAEKVAGFVIGLPMNMDGSAGPRVQATRAFVRNM-EQKTALPFVYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L  S G
Sbjct: 120 TLLEMDVSRAKRAERIDSAAASFILQGALDRLSLLARSDG 159


>gi|218661529|ref|ZP_03517459.1| holliday junction resolvase protein [Rhizobium etli IE4771]
          Length = 166

 Score =  191 bits (486), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 89/160 (55%), Positives = 120/160 (75%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L IE++  +L P + IA +DLGTK IGL++SD GRRFA PRP + R K T  A  LL
Sbjct: 3   MTVLTIEEMAATLAPGKAIAGLDLGTKTIGLSMSDLGRRFATPRPVIRRVKFTIDAQALL 62

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F  TE +A F+IGLP+NM+GS GPRV +TRAFV NM ++K  +PFV+WDERL+TV+A++
Sbjct: 63  DFAATEKVAGFVIGLPMNMDGSAGPRVQATRAFVRNM-EQKTALPFVYWDERLSTVAAER 121

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L  S G
Sbjct: 122 TLLEMDVSRAKRAERIDSAAASFILQGALDRLSLLARSAG 161


>gi|327192100|gb|EGE59078.1| holliday junction resolvase protein [Rhizobium etli CNPAF512]
          Length = 164

 Score =  191 bits (486), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 89/160 (55%), Positives = 119/160 (74%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L IE++  +L P Q IA +DLGTK IGL++SD GRRFA PRP + R K T  A  LL
Sbjct: 1   MTVLTIEEMAATLAPGQAIAGLDLGTKTIGLSMSDLGRRFATPRPVIRRAKFTIDAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F   E +A F+IGLP+NM+GS GPRV +TRAFV NM ++K  +PFV+WDERL+TV+A++
Sbjct: 61  DFAAKEKVAGFVIGLPMNMDGSAGPRVQATRAFVRNM-EQKTALPFVYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L  S G
Sbjct: 120 TLLEMDVSRAKRAERIDSAAASFILQGALDRLSLLARSDG 159


>gi|86357479|ref|YP_469371.1| holliday junction resolvase protein [Rhizobium etli CFN 42]
 gi|146325597|sp|Q2K942|RUVX_RHIEC RecName: Full=Putative Holliday junction resolvase
 gi|86281581|gb|ABC90644.1| probable holliday junction resolvase protein [Rhizobium etli CFN
           42]
          Length = 164

 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 121/160 (75%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L IE++ + L P Q IA +DLGTK IGL+ISD GRRFA PRP + R K T  A  LL
Sbjct: 1   MTVLTIEEIAEILPPGQAIAGLDLGTKTIGLSISDLGRRFATPRPVIRRIKFTIDAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F + E +A F+IGLP+NM+GS GPRV +TRAFV NM ++K  +PF++WDERL+TV+A++
Sbjct: 61  DFASAEKVAGFVIGLPMNMDGSAGPRVQATRAFVRNM-EQKTALPFIYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           +LI+M+VSR KR +++DS AA+ ILQ  LDR+S L  S G
Sbjct: 120 VLIEMDVSRAKRAERIDSAAASFILQGALDRLSLLARSAG 159


>gi|190891542|ref|YP_001978084.1| holliday junction resolvase [Rhizobium etli CIAT 652]
 gi|226731642|sp|B3PXX0|RUVX_RHIE6 RecName: Full=Putative Holliday junction resolvase
 gi|190696821|gb|ACE90906.1| holliday junction resolvase protein [Rhizobium etli CIAT 652]
          Length = 164

 Score =  191 bits (484), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 89/160 (55%), Positives = 118/160 (73%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L IE++  +L P Q IA +DLGTK IGL++SD GRRFA PRP + R K T  A  LL
Sbjct: 1   MTVLTIEEMAATLAPGQAIAGLDLGTKTIGLSMSDLGRRFATPRPVIRRAKFTIDAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F   E +A F+IGLP+NM+GS GPRV +TRAFV NM + K  +PFV+WDERL+TV+A++
Sbjct: 61  DFAAKERVAGFVIGLPMNMDGSAGPRVQATRAFVRNM-EEKTALPFVYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L  S G
Sbjct: 120 TLLEMDVSRAKRAERIDSAAASFILQGALDRLSLLARSDG 159


>gi|222085624|ref|YP_002544154.1| holliday junction resolvase protein [Agrobacterium radiobacter K84]
 gi|254767490|sp|B9JDM7|RUVX_AGRRK RecName: Full=Putative Holliday junction resolvase
 gi|221723072|gb|ACM26228.1| holliday junction resolvase protein [Agrobacterium radiobacter K84]
          Length = 164

 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 117/155 (75%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+ L IEDL   L P Q IA +DLGTK IGLA+SD GRRFA PRP + R K TQ A  LL
Sbjct: 1   MTTLTIEDLAVMLLPGQAIAGLDLGTKTIGLAMSDLGRRFATPRPVIKRVKFTQDAQTLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +F   E +AAF+IGLP+NM+GS GPRV +TRAFV +M D K  +PFV+WDERL+TV+A++
Sbjct: 61  AFAEKEKVAAFVIGLPMNMDGSTGPRVQATRAFVRSMAD-KTALPFVYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L
Sbjct: 120 ALLEMDVSRAKRAERIDSAAASFILQGALDRLSAL 154


>gi|222148317|ref|YP_002549274.1| Holliday junction resolvase-like protein [Agrobacterium vitis S4]
 gi|254767491|sp|B9JVI8|RUVX_AGRVS RecName: Full=Putative Holliday junction resolvase
 gi|221735305|gb|ACM36268.1| holliday junction resolvase protein [Agrobacterium vitis S4]
          Length = 158

 Score =  187 bits (474), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 119/158 (75%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+ L IE+L +SL+P Q +A +DLGTK IGLA+SD GRRFA PR  + R K T+ A  LL
Sbjct: 1   MATLEIEELAQSLQPGQAVAGLDLGTKTIGLAMSDLGRRFASPRTVIKRTKFTKDAEVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +F   E +AAF+IGLP+NM+GS GPRV +TRAFV  M + K  +PFV+WDERL+TV+A +
Sbjct: 61  AFAAKEKVAAFVIGLPINMDGSSGPRVQATRAFVRAMAE-KTDIPFVYWDERLSTVAATR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L S+
Sbjct: 120 ALLEMDVSRAKRAERIDSAAASFILQGALDRLSGLAST 157


>gi|241204443|ref|YP_002975539.1| Holliday junction resolvase-like protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240858333|gb|ACS56000.1| Holliday junction resolvase YqgF [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 164

 Score =  187 bits (474), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 120/160 (75%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L IE++ ++L P Q IA +DLGTK IGL++SD GRRFA PR  + R K T  A  LL
Sbjct: 1   MTVLTIEEMAETLVPRQAIAGLDLGTKTIGLSMSDLGRRFATPRTVIRRVKFTIDAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F  +E +A F+IGLP+NM+GS GPRV +TRAFV NM ++K  +PFV+WDERL+TV+A++
Sbjct: 61  DFAQSEKVAGFVIGLPMNMDGSAGPRVQATRAFVRNM-EQKTALPFVYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L  S G
Sbjct: 120 TLLEMDVSRAKRAERIDSAAASFILQGALDRLSLLARSDG 159


>gi|325292676|ref|YP_004278540.1| Holliday junction resolvase [Agrobacterium sp. H13-3]
 gi|325060529|gb|ADY64220.1| putative Holliday junction resolvase [Agrobacterium sp. H13-3]
          Length = 159

 Score =  186 bits (473), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 89/160 (55%), Positives = 120/160 (75%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+IL IE+L ++L+P Q IA +DLGTK IGLA+SD  RRFA PRP + R K T+ A  LL
Sbjct: 1   MAILTIEELAETLQPAQAIAGLDLGTKTIGLAMSDLSRRFATPRPVIKRVKFTRDAEVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +F   E ++AFIIGLP+NM+GS GPR  +TRAFV  M   K  +PF+FWDERL+TV+A++
Sbjct: 61  AFAEKEKVSAFIIGLPINMDGSAGPRAQATRAFVRTM-GEKTALPFIFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           +L++M+VSR KR +++DS AA+ ILQ  LDR+S L  + G
Sbjct: 120 VLLEMDVSRAKRAERIDSAAASFILQGALDRLSALARATG 159


>gi|116251833|ref|YP_767671.1| Holliday junction resolvase-like protein [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|146325598|sp|Q1MHJ8|RUVX_RHIL3 RecName: Full=Putative Holliday junction resolvase
 gi|115256481|emb|CAK07565.1| putative Holliday junction resolvase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 164

 Score =  186 bits (472), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 119/160 (74%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L IE++ ++L P Q IA +DLGTK IGL++SD GRRFA PR  + R K    A  LL
Sbjct: 1   MTVLTIEEMAETLAPRQAIAGLDLGTKTIGLSMSDLGRRFATPRTVIRRVKFAIDAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F  +E +A F+IGLP+NM+GS GPRV +TRAFV NM ++K  +PFV+WDERL+TV+A++
Sbjct: 61  DFAQSEKVAGFVIGLPMNMDGSAGPRVQATRAFVRNM-EQKTALPFVYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L  S G
Sbjct: 120 TLLEMDVSRAKRAERIDSAAASFILQGALDRLSLLARSDG 159


>gi|15888641|ref|NP_354322.1| hypothetical protein Atu1316 [Agrobacterium tumefaciens str. C58]
 gi|32130043|sp|Q8UFT1|RUVX_AGRT5 RecName: Full=Putative Holliday junction resolvase
 gi|15156369|gb|AAK87107.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 159

 Score =  184 bits (467), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 116/155 (74%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+ L IE+L ++L+P Q IA +DLGTK IGLA+SD  RRFA PRP + R K TQ A  LL
Sbjct: 1   MATLTIEELAQTLQPAQAIAGLDLGTKTIGLAMSDLSRRFATPRPVIKRVKFTQDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +F   E +AAF+IGLP+NM+GS GPR  +TRAFV  M   K  +PF++WDERL+TV+A++
Sbjct: 61  AFAEKEKVAAFVIGLPINMDGSAGPRAQATRAFVRTM-GEKTALPFIYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L
Sbjct: 120 ALLEMDVSRAKRAERIDSAAASFILQGALDRLSAL 154


>gi|15965062|ref|NP_385415.1| hypothetical protein SMc01355 [Sinorhizobium meliloti 1021]
 gi|307301133|ref|ZP_07580902.1| Holliday junction resolvase YqgF [Sinorhizobium meliloti BL225C]
 gi|32130055|sp|Q92QL0|RUVX_RHIME RecName: Full=Putative Holliday junction resolvase
 gi|15074241|emb|CAC45888.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306904088|gb|EFN34674.1| Holliday junction resolvase YqgF [Sinorhizobium meliloti BL225C]
          Length = 165

 Score =  184 bits (466), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 117/155 (75%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+IL +E+L + L P Q +A +DLGTK IG+++SD GRRFA PR  + R K    A  LL
Sbjct: 1   MAILTMEELAERLPPYQSVAGLDLGTKTIGISVSDLGRRFATPREVIRRVKFGADAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           SF   E IAAFIIGLP+NM+GSEGPR  +TRAFV NM + K  +PFV WDERL+TV+A++
Sbjct: 61  SFAEKEKIAAFIIGLPVNMDGSEGPRCQATRAFVRNMGE-KTDIPFVLWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           +LI+M+VSRKKR +++DS AA+ ILQ  LDR++ L
Sbjct: 120 VLIEMDVSRKKRAERIDSAAASFILQGALDRLASL 154


>gi|163759344|ref|ZP_02166430.1| hypothetical protein HPDFL43_06250 [Hoeflea phototrophica DFL-43]
 gi|162283748|gb|EDQ34033.1| hypothetical protein HPDFL43_06250 [Hoeflea phototrophica DFL-43]
          Length = 162

 Score =  181 bits (460), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 119/158 (75%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ +EDL   L P Q IA +DLGTK IGLA+SD  R  A PRP + R+K T  A++LL
Sbjct: 1   MAVMEVEDLEAFLTPGQTIAGLDLGTKTIGLAVSDLSRSLASPRPVIKRRKFTLDAIDLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  + + A +IGLP+NM+GSEGPRV +TRAFV NMI+ K  +PFVFWDERL+TV+A++
Sbjct: 61  TALKRDQVGAVVIGLPVNMDGSEGPRVQATRAFVRNMIE-KTDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            LI+M+VSRKKR +++DS AA+ ILQ  LDR+  L ++
Sbjct: 120 ALIEMDVSRKKRAERIDSAAASFILQGALDRLQGLRAA 157


>gi|307317866|ref|ZP_07597304.1| Holliday junction resolvase YqgF [Sinorhizobium meliloti AK83]
 gi|306896628|gb|EFN27376.1| Holliday junction resolvase YqgF [Sinorhizobium meliloti AK83]
          Length = 165

 Score =  181 bits (460), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 88/155 (56%), Positives = 116/155 (74%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+IL +E+L + L P Q +A +DLGTK IG+++SD GRRFA PR  + R K    A  LL
Sbjct: 1   MAILTMEELAERLPPYQSVAGLDLGTKTIGISVSDLGRRFATPREVIRRVKFGADAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           SF   E IAAFIIGLP+NM+GSEGPR  +TRAFV  M + K  +PFV WDERL+TV+A++
Sbjct: 61  SFAEKEKIAAFIIGLPVNMDGSEGPRCQATRAFVRTMGE-KTDIPFVLWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           +LI+M+VSRKKR +++DS AA+ ILQ  LDR++ L
Sbjct: 120 VLIEMDVSRKKRAERIDSAAASFILQGALDRLASL 154


>gi|218680912|ref|ZP_03528809.1| Holliday junction resolvase YqgF [Rhizobium etli CIAT 894]
          Length = 144

 Score =  175 bits (444), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 82/145 (56%), Positives = 110/145 (75%), Gaps = 1/145 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L IE++  +L P Q IA +DLGTK IGL++SD GRRFA PRP + R K T  A  LL
Sbjct: 1   MTVLTIEEMAGTLAPRQAIAGLDLGTKTIGLSMSDLGRRFATPRPVIRRVKFTIDAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F   E +A FIIGLP+NM+GS GPRV +TRAFV NM ++K  +PFV+WDERL+TV+A++
Sbjct: 61  DFAAAEKVAGFIIGLPMNMDGSAGPRVQATRAFVRNM-EQKTALPFVYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALIL 145
            L++M+VSR KR +++DS AA+ IL
Sbjct: 120 TLLEMDVSRAKRAERIDSAAASFIL 144


>gi|150396164|ref|YP_001326631.1| Holliday junction resolvase-like protein [Sinorhizobium medicae
           WSM419]
 gi|167013052|sp|A6U816|RUVX_SINMW RecName: Full=Putative Holliday junction resolvase
 gi|150027679|gb|ABR59796.1| Holliday junction resolvase YqgF [Sinorhizobium medicae WSM419]
          Length = 165

 Score =  174 bits (442), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 113/155 (72%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+IL IE+L + L P Q +A +DLGTK IGL++SD GRRFA PR  + R K    A  LL
Sbjct: 1   MAILTIEELAERLPPYQAVAGLDLGTKTIGLSVSDLGRRFATPRDVIRRVKFGIDAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F   E +AAF+IGLP+NM+GSEGPR  +TRAFV  M +R   +P V WDERL+TV+A++
Sbjct: 61  FFAEKEKVAAFVIGLPVNMDGSEGPRCQATRAFVRTMGER-TDIPSVLWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           +LI+M+VSRKKR  ++DS AA+ ILQ  LDR++ L
Sbjct: 120 VLIEMDVSRKKRADRIDSAAASFILQGALDRLALL 154


>gi|110633714|ref|YP_673922.1| Holliday junction resolvase YqgF [Mesorhizobium sp. BNC1]
 gi|118597215|sp|Q11IL8|RUVX_MESSB RecName: Full=Putative Holliday junction resolvase
 gi|110284698|gb|ABG62757.1| Holliday junction resolvase YqgF [Chelativorans sp. BNC1]
          Length = 160

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 112/160 (70%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           MS++ IE+L K+    +P+A +DLGTK IG+AISD G  FA PR +L RKK  + A  LL
Sbjct: 1   MSVVSIEELEKARAYGRPLAGLDLGTKTIGVAISDLGLSFATPRAYLPRKKFQEDAKALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             ++ EN    I+GLP+NM+GSEGPR  STRAFV N+      +PF FWDERL+TV+A++
Sbjct: 61  HLLSRENAGGVIVGLPINMDGSEGPRAQSTRAFVRNL-QPLTKLPFAFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            LI+M+VSR KR Q++DS AAA ILQ  LDR+  L +  G
Sbjct: 120 ALIEMDVSRAKRAQRIDSAAAAFILQGALDRLQALRADPG 159


>gi|319407285|emb|CBI80926.1| putative resolvase [Bartonella sp. 1-1C]
          Length = 163

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 112/158 (70%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+I+ I ++   L   Q IAS+DLGTK IG+AISD    F++PRP + RKK T  AL L+
Sbjct: 1   MTIISINEVKTHLSLGQTIASLDLGTKTIGIAISDISLTFSNPRPVIYRKKFTLDALTLI 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+ A IIGLPLNMNGS GPRV +T+ FV NM      +PFVFWDERL+T++A++
Sbjct: 61  QIFNNENVGAIIIGLPLNMNGSNGPRVQATKTFVSNMATY-TEIPFVFWDERLSTIAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           +L++M++SR KR  ++DS AAA ILQ  LDRI  L+S+
Sbjct: 120 LLLEMDMSRSKRKSRIDSAAAAFILQGALDRIKTLQSN 157


>gi|319404280|emb|CBI77873.1| putative resolvase [Bartonella rochalimae ATCC BAA-1498]
          Length = 163

 Score =  169 bits (429), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 112/158 (70%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+I+ I +++  L   Q IAS+DLGTK IG+AISD    F++PRP + RKK T  AL L+
Sbjct: 1   MAIISINEVMTHLSLGQTIASLDLGTKTIGIAISDISLTFSNPRPVIYRKKFTLDALTLI 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+ A IIGLPLNMNGS GPRV +T+ FV NM      +PFVFWDERL+T++A++
Sbjct: 61  QIFNNENVGAIIIGLPLNMNGSNGPRVQATKTFVSNMAT-YTEIPFVFWDERLSTIAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           +L++M++SR KR  ++DS AAA ILQ  LDRI  L S+
Sbjct: 120 LLLEMDMSRSKRKSRIDSAAAAFILQGALDRIKTLPSN 157


>gi|163868299|ref|YP_001609508.1| putative resolvase [Bartonella tribocorum CIP 105476]
 gi|189046086|sp|A9IU51|RUVX_BART1 RecName: Full=Putative Holliday junction resolvase
 gi|161017955|emb|CAK01513.1| putative resolvase [Bartonella tribocorum CIP 105476]
          Length = 156

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 112/159 (70%), Gaps = 5/159 (3%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ I +++  L P Q IA +DLGTK IG+AISD G   ++PRP L RKK T+ A  L+
Sbjct: 1   MTVININEIMTHLLPGQTIAGLDLGTKTIGIAISDMGLTVSNPRPVLQRKKFTEDAHRLI 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVY--VPFVFWDERLTTVSA 118
                EN+   +IGLPLNMNGS G RV +TRAFV NM   K Y  +PFVFWDERL+T++A
Sbjct: 61  KIFDHENVGVIVIGLPLNMNGSSGSRVQATRAFVSNM---KAYTKIPFVFWDERLSTIAA 117

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
           ++ L++MNVSR KR +++DS AAA ILQ  L+RI  L S
Sbjct: 118 ERSLLEMNVSRIKRARRIDSAAAAFILQGALNRIENLHS 156


>gi|240850656|ref|YP_002972056.1| putative Holliday junction resolvase [Bartonella grahamii as4aup]
 gi|240267779|gb|ACS51367.1| putative Holliday junction resolvase [Bartonella grahamii as4aup]
          Length = 159

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 110/162 (67%), Gaps = 5/162 (3%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M ++ I +++  L P Q IA +DLGTK IG+AISD G   ++PRP L RKK T+ A  L+
Sbjct: 1   MIVININEVMTHLLPGQTIAGLDLGTKTIGIAISDMGLTVSNPRPVLQRKKFTEDAYTLI 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVY--VPFVFWDERLTTVSA 118
                EN+   IIGLPLNMNGS G RV +TRAFV NM   K Y  +PFVFWDERL+T++A
Sbjct: 61  KIFDRENVGVIIIGLPLNMNGSSGSRVQATRAFVSNM---KAYTKIPFVFWDERLSTIAA 117

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           ++ L++MNVSR KR  ++DS AAA ILQ  L+RI      +G
Sbjct: 118 ERSLLEMNVSRAKRASRIDSAAAAFILQGALNRIQNFHHMEG 159


>gi|319405723|emb|CBI79346.1| putative resolvase [Bartonella sp. AR 15-3]
          Length = 163

 Score =  167 bits (422), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 110/158 (69%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+I+ I ++   L   Q IAS+DLGTK IG+AISD    F++PRP + RKK T  AL L+
Sbjct: 1   MAIISINEVTIHLLFGQTIASLDLGTKTIGIAISDISLTFSNPRPVIYRKKFTLDALTLI 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+ A I+GLP+NMNGS GPRV +T+ FV NM      +PF+FWDERL+T++A++
Sbjct: 61  EIFNNENVGAIIVGLPINMNGSNGPRVQATKTFVSNMAT-YTKIPFIFWDERLSTIAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
             ++MN+SR KR  ++DS AAA ILQ  LDRI  L+S+
Sbjct: 120 YFLEMNMSRSKRKSRIDSAAAAFILQGALDRIKTLQSN 157


>gi|49474241|ref|YP_032283.1| hypothetical protein BQ06360 [Bartonella quintana str. Toulouse]
 gi|62900974|sp|Q6FZS7|RUVX_BARQU RecName: Full=Putative Holliday junction resolvase
 gi|49239745|emb|CAF26127.1| hypothetical protein BQ06360 [Bartonella quintana str. Toulouse]
          Length = 159

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 110/160 (68%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ I +++  L P Q IA +DLG K IG+A+SD G  F++PR  L RKK+T  A  L+
Sbjct: 1   MAVININEVITHLLPGQTIAGLDLGKKTIGIAVSDRGLTFSNPRSVLQRKKLTVDARTLI 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+   IIGLPLNMNGS GPR  +TR FV+NM +    +PFVFWDERL+T++A++
Sbjct: 61  QIFDRENVGVVIIGLPLNMNGSSGPRAQATRTFVNNM-EAYTEIPFVFWDERLSTIAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR  ++DS AAA ILQ  L+RI  L   +G
Sbjct: 120 SLLEMDVSRAKRATRIDSAAAAFILQGALNRIQNLHYMEG 159


>gi|306841755|ref|ZP_07474441.1| conserved hypothetical protein [Brucella sp. BO2]
 gi|306288160|gb|EFM59547.1| conserved hypothetical protein [Brucella sp. BO2]
          Length = 162

 Score =  162 bits (410), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 107/155 (69%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+   IE++   LKP Q +A +DLGTK IGLA+SD G  FAHPRP + R K T  A  LL
Sbjct: 1   MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAHPRPVIKRVKFTIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + T+ +   +IGLP+NM+G+ GPRV +TRAFV  M      +PFVFWDERL+TV+A++
Sbjct: 61  KALETDKVGVIVIGLPMNMDGTAGPRVQATRAFVRTM-QPLTDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            LI M+VSR KR +++DS AAA ILQ  LDR+  +
Sbjct: 120 ALIGMDVSRGKRAERIDSAAAAFILQGALDRLHMM 154


>gi|254720416|ref|ZP_05182227.1| Holliday junction resolvase-like protein [Brucella sp. 83/13]
 gi|265985435|ref|ZP_06098170.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306839007|ref|ZP_07471828.1| conserved hypothetical protein [Brucella sp. NF 2653]
 gi|264664027|gb|EEZ34288.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306405913|gb|EFM62171.1| conserved hypothetical protein [Brucella sp. NF 2653]
          Length = 162

 Score =  162 bits (410), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 107/155 (69%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+   IE++   LKP Q +A +DLGTK IGLA+SD G  FAHPRP + R K T  A  LL
Sbjct: 1   MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAHPRPVIKRVKFTIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + T+ +   +IGLP+NM+G+ GPRV +TRAFV  M      +PFVFWDERL+TV+A++
Sbjct: 61  KALETDKVGVIVIGLPMNMDGTAGPRVQATRAFVRTM-QPLTDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            LI M+VSR KR +++DS AAA ILQ  LDR+  +
Sbjct: 120 ALIGMDVSRGKRAERIDSAAAAFILQGALDRLHMM 154


>gi|23500341|ref|NP_699781.1| Holliday junction resolvase-like protein [Brucella suis 1330]
 gi|161620659|ref|YP_001594545.1| hypothetical protein BCAN_B0598 [Brucella canis ATCC 23365]
 gi|163844749|ref|YP_001622404.1| hypothetical protein BSUIS_B0594 [Brucella suis ATCC 23445]
 gi|225629090|ref|ZP_03787123.1| conserved hypothetical protein [Brucella ceti str. Cudo]
 gi|225686383|ref|YP_002734355.1| Holliday junction resolvase-like protein [Brucella melitensis ATCC
           23457]
 gi|254699833|ref|ZP_05161661.1| Holliday junction resolvase-like protein [Brucella suis bv. 5 str.
           513]
 gi|254702971|ref|ZP_05164799.1| Holliday junction resolvase-like protein [Brucella suis bv. 3 str.
           686]
 gi|254705907|ref|ZP_05167735.1| Holliday junction resolvase-like protein [Brucella pinnipedialis
           M163/99/10]
 gi|254711134|ref|ZP_05172945.1| Holliday junction resolvase-like protein [Brucella pinnipedialis
           B2/94]
 gi|256015374|ref|YP_003105383.1| putative Holliday junction resolvase [Brucella microti CCM 4915]
 gi|256029515|ref|ZP_05443129.1| Holliday junction resolvase-like protein [Brucella pinnipedialis
           M292/94/1]
 gi|256059210|ref|ZP_05449416.1| Holliday junction resolvase-like protein [Brucella neotomae 5K33]
 gi|256111486|ref|ZP_05452500.1| Holliday junction resolvase-like protein [Brucella melitensis bv. 3
           str. Ether]
 gi|256157710|ref|ZP_05455628.1| Holliday junction resolvase-like protein [Brucella ceti M490/95/1]
 gi|256253318|ref|ZP_05458854.1| Holliday junction resolvase-like protein [Brucella ceti B1/94]
 gi|256262476|ref|ZP_05465008.1| ribonuclease RNase H [Brucella melitensis bv. 2 str. 63/9]
 gi|260167394|ref|ZP_05754205.1| Holliday junction resolvase-like protein [Brucella sp. F5/99]
 gi|260568115|ref|ZP_05838584.1| ribonuclease RNase H fold containing protein [Brucella suis bv. 4
           str. 40]
 gi|261220434|ref|ZP_05934715.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261313336|ref|ZP_05952533.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261318725|ref|ZP_05957922.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261323159|ref|ZP_05962356.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261750307|ref|ZP_05994016.1| holliday junction resolvase YqgF [Brucella suis bv. 5 str. 513]
 gi|261753580|ref|ZP_05997289.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261756804|ref|ZP_06000513.1| ribonuclease RNase H fold containing protein [Brucella sp. F5/99]
 gi|265986523|ref|ZP_06099080.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265992983|ref|ZP_06105540.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265996215|ref|ZP_06108772.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|306845931|ref|ZP_07478498.1| conserved hypothetical protein [Brucella sp. BO1]
 gi|32130035|sp|Q8FW65|RUVX_BRUSU RecName: Full=Putative Holliday junction resolvase
 gi|189046087|sp|A9MBN7|RUVX_BRUC2 RecName: Full=Putative Holliday junction resolvase
 gi|189046088|sp|A9WYR6|RUVX_BRUSI RecName: Full=Putative Holliday junction resolvase
 gi|254767499|sp|C0RLB8|RUVX_BRUMB RecName: Full=Putative Holliday junction resolvase
 gi|23463956|gb|AAN33786.1| conserved hypothetical protein TIGR00250 [Brucella suis 1330]
 gi|161337470|gb|ABX63774.1| conserved hypothetical protein [Brucella canis ATCC 23365]
 gi|163675472|gb|ABY39582.1| conserved hypothetical protein [Brucella suis ATCC 23445]
 gi|225615586|gb|EEH12635.1| conserved hypothetical protein [Brucella ceti str. Cudo]
 gi|225642488|gb|ACO02401.1| conserved hypothetical protein [Brucella melitensis ATCC 23457]
 gi|255998034|gb|ACU49721.1| putative Holliday junction resolvase [Brucella microti CCM 4915]
 gi|260154780|gb|EEW89861.1| ribonuclease RNase H fold containing protein [Brucella suis bv. 4
           str. 40]
 gi|260919018|gb|EEX85671.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261297948|gb|EEY01445.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261299139|gb|EEY02636.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261302362|gb|EEY05859.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261736788|gb|EEY24784.1| ribonuclease RNase H fold containing protein [Brucella sp. F5/99]
 gi|261740060|gb|EEY27986.1| holliday junction resolvase YqgF [Brucella suis bv. 5 str. 513]
 gi|261743333|gb|EEY31259.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262550512|gb|EEZ06673.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262763853|gb|EEZ09885.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263092212|gb|EEZ16509.1| ribonuclease RNase H [Brucella melitensis bv. 2 str. 63/9]
 gi|264658720|gb|EEZ28981.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|306273566|gb|EFM55411.1| conserved hypothetical protein [Brucella sp. BO1]
 gi|326410755|gb|ADZ67819.1| Holliday junction resolvase-like protein [Brucella melitensis M28]
 gi|326554047|gb|ADZ88686.1| Holliday junction resolvase-like protein [Brucella melitensis
           M5-90]
          Length = 162

 Score =  161 bits (407), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 106/155 (68%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+   IE++   LKP Q +A +DLGTK IGLA+SD G  FAHPRP + R K T  A  LL
Sbjct: 1   MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAHPRPVIKRVKFTIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + T+ +   +IGLP+NM+G+ GPRV +TRAFV  M      +PFVFWDERL+TV+A++
Sbjct: 61  KALETDKVGVIVIGLPMNMDGTAGPRVQATRAFVRTM-QPLTDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            LI M+VSR KR  ++DS AAA ILQ  LDR+  +
Sbjct: 120 ALIGMDVSRGKRADRIDSAAAAFILQGALDRLHMM 154


>gi|62317546|ref|YP_223399.1| Holliday junction resolvase-like protein [Brucella abortus bv. 1
           str. 9-941]
 gi|83269527|ref|YP_418818.1| Holliday junction resolvase-like protein [Brucella melitensis
           biovar Abortus 2308]
 gi|189022801|ref|YP_001932542.1| Ribonuclease RNase H fold containing [Brucella abortus S19]
 gi|237817094|ref|ZP_04596086.1| conserved hypothetical protein [Brucella abortus str. 2308 A]
 gi|254691043|ref|ZP_05154297.1| Holliday junction resolvase-like protein [Brucella abortus bv. 6
           str. 870]
 gi|254695650|ref|ZP_05157478.1| Holliday junction resolvase-like protein [Brucella abortus bv. 3
           str. Tulya]
 gi|254698827|ref|ZP_05160655.1| Holliday junction resolvase-like protein [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254732274|ref|ZP_05190852.1| Holliday junction resolvase-like protein [Brucella abortus bv. 4
           str. 292]
 gi|256256228|ref|ZP_05461764.1| Holliday junction resolvase-like protein [Brucella abortus bv. 9
           str. C68]
 gi|260544782|ref|ZP_05820603.1| ribonuclease RNase H fold containing protein [Brucella abortus NCTC
           8038]
 gi|260756639|ref|ZP_05868987.1| holliday junction resolvase YqgF [Brucella abortus bv. 6 str. 870]
 gi|260760069|ref|ZP_05872417.1| holliday junction resolvase YqgF [Brucella abortus bv. 4 str. 292]
 gi|260763308|ref|ZP_05875640.1| holliday junction resolvase YqgF [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882456|ref|ZP_05894070.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261216050|ref|ZP_05930331.1| holliday junction resolvase YqgF [Brucella abortus bv. 3 str.
           Tulya]
 gi|297249585|ref|ZP_06933286.1| hypothetical protein BAYG_02344 [Brucella abortus bv. 5 str. B3196]
 gi|81309292|sp|Q577Z6|RUVX_BRUAB RecName: Full=Putative Holliday junction resolvase
 gi|146325555|sp|Q2YKL6|RUVX_BRUA2 RecName: Full=Putative Holliday junction resolvase
 gi|226725492|sp|B2SB59|RUVX_BRUA1 RecName: Full=Putative Holliday junction resolvase
 gi|62197739|gb|AAX76038.1| conserved hypothetical protein TIGR00250 [Brucella abortus bv. 1
           str. 9-941]
 gi|82939801|emb|CAJ12809.1| Conserved hypothetical protein 250:Ribonuclease RNase H fold
           containing [Brucella melitensis biovar Abortus 2308]
 gi|189021375|gb|ACD74096.1| Ribonuclease RNase H fold containing [Brucella abortus S19]
 gi|237787907|gb|EEP62123.1| conserved hypothetical protein [Brucella abortus str. 2308 A]
 gi|260098053|gb|EEW81927.1| ribonuclease RNase H fold containing protein [Brucella abortus NCTC
           8038]
 gi|260670387|gb|EEX57327.1| holliday junction resolvase YqgF [Brucella abortus bv. 4 str. 292]
 gi|260673729|gb|EEX60550.1| holliday junction resolvase YqgF [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676747|gb|EEX63568.1| holliday junction resolvase YqgF [Brucella abortus bv. 6 str. 870]
 gi|260871984|gb|EEX79053.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260917657|gb|EEX84518.1| holliday junction resolvase YqgF [Brucella abortus bv. 3 str.
           Tulya]
 gi|297173454|gb|EFH32818.1| hypothetical protein BAYG_02344 [Brucella abortus bv. 5 str. B3196]
          Length = 162

 Score =  160 bits (406), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 106/155 (68%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+   IE++   LKP Q +A +DLGTK IGLA+SD G  FAHPRP + R K T  A  LL
Sbjct: 1   MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAHPRPVIKRVKFTIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + T+ +   +IGLP+NM+G+ GPRV +TRAFV  M      +PFVFWDERL+TV+A++
Sbjct: 61  KALETDKVGVIMIGLPMNMDGTAGPRVQATRAFVRTM-QPLTDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            LI M+VSR KR  ++DS AAA ILQ  LDR+  +
Sbjct: 120 ALIGMDVSRGKRADRIDSAAAAFILQGALDRLHMM 154


>gi|114707193|ref|ZP_01440091.1| hypothetical protein FP2506_04781 [Fulvimarina pelagi HTCC2506]
 gi|114537389|gb|EAU40515.1| hypothetical protein FP2506_04781 [Fulvimarina pelagi HTCC2506]
          Length = 165

 Score =  160 bits (404), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 116/162 (71%), Gaps = 5/162 (3%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           MS++ IE+  ++LK  +P+A +DLGTK IG+A+SD   RFA+PR  L RKK TQ A  L 
Sbjct: 1   MSVVEIEEFAETLKLGKPLAGLDLGTKTIGVAVSDRSFRFANPRSVLKRKKFTQDAQALK 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNM--IDRKVYVPFVFWDERLTTVSA 118
           + +  + ++A ++GLPLNM+GS GPR  +T+AF  N   +D +   P + WDERL+TV+A
Sbjct: 61  AMLDADEVSAIVLGLPLNMDGSSGPRAQATKAFSRNYAALDER---PILLWDERLSTVAA 117

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           ++ L+D+++SRKKR +++DS AAA+ILQ VLDR++ L    G
Sbjct: 118 ERNLLDIDMSRKKRGERIDSAAAAIILQGVLDRLANLTRCPG 159


>gi|260459185|ref|ZP_05807440.1| Holliday junction resolvase YqgF [Mesorhizobium opportunistum
           WSM2075]
 gi|259034739|gb|EEW35995.1| Holliday junction resolvase YqgF [Mesorhizobium opportunistum
           WSM2075]
          Length = 168

 Score =  159 bits (403), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 82/158 (51%), Positives = 111/158 (70%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ IE L   L   + +A +DLG K IG+A+SD G  FAHPRP ++R+K +  A  LL
Sbjct: 1   MAVITIEQLPARLADGRTLAGLDLGDKTIGVAVSDRGFSFAHPRPVIIRRKFSLDAAVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  EN  A +IGLP+NM+GSEGPR   +RAFV NM  +   +PFVFWDERL+TV+A++
Sbjct: 61  ALLKKENAGAVVIGLPINMDGSEGPRAQKSRAFVRNMA-QLSDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            LI+M+ SR KR  K+DS AAA ILQ VLDR+  L +S
Sbjct: 120 TLIEMDFSRAKRAGKIDSAAAAFILQGVLDRLQSLAAS 157


>gi|49475587|ref|YP_033628.1| hypothetical protein BH08220 [Bartonella henselae str. Houston-1]
 gi|62900975|sp|Q6G3F1|RUVX_BARHE RecName: Full=Putative Holliday junction resolvase
 gi|49238394|emb|CAF27621.1| hypothetical protein BH08220 [Bartonella henselae str. Houston-1]
          Length = 159

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 81/160 (50%), Positives = 109/160 (68%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+I+ I +++  L P Q IA +DLGTK IG+A+SD G  F++PR  L R+K T  A  L+
Sbjct: 1   MAIININEVMIHLLPGQIIAGLDLGTKTIGIAVSDRGLIFSNPRSVLQRQKFTVDAQTLI 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+   IIGLPLNMNGS GPR  +TR FV NM +    +PFVFWDERL+T++A++
Sbjct: 61  KIFDHENVGVIIIGLPLNMNGSSGPRAQATRTFVRNM-EAYTEIPFVFWDERLSTIAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR  ++DS AAA ILQ  L+RI  L   +G
Sbjct: 120 SLLEMDVSRAKRATRIDSAAAAFILQGALNRIHNLHHIEG 159


>gi|17989017|ref|NP_541650.1| Holliday junction resolvase-like protein [Brucella melitensis bv. 1
           str. 16M]
 gi|148558591|ref|YP_001257584.1| Holliday junction resolvase-like protein [Brucella ovis ATCC 25840]
 gi|256043494|ref|ZP_05446421.1| Holliday junction resolvase-like protein [Brucella melitensis bv. 1
           str. Rev.1]
 gi|260564689|ref|ZP_05835174.1| ribonuclease RNase [Brucella melitensis bv. 1 str. 16M]
 gi|265989912|ref|ZP_06102469.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|32130048|sp|Q8YC60|RUVX_BRUME RecName: Full=Putative Holliday junction resolvase
 gi|167012699|sp|A5VUS9|RUVX_BRUO2 RecName: Full=Putative Holliday junction resolvase
 gi|17984856|gb|AAL53914.1| DNA integration/recombination/invertion protein [Brucella
           melitensis bv. 1 str. 16M]
 gi|148369876|gb|ABQ62748.1| conserved hypothetical protein TIGR00250 [Brucella ovis ATCC 25840]
 gi|260152332|gb|EEW87425.1| ribonuclease RNase [Brucella melitensis bv. 1 str. 16M]
 gi|263000581|gb|EEZ13271.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 162

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 80/155 (51%), Positives = 105/155 (67%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+   IE++   LKP Q +A +DLGTK IGLA+SD G  FAHPRP + R K T  A  LL
Sbjct: 1   MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAHPRPVIKRVKFTIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + T+ +   +IGLP+NM+G+ GPRV +TRAFV  M      +PFVFWDERL+TV+ ++
Sbjct: 61  KALETDKVGVIVIGLPMNMDGTAGPRVQATRAFVRTM-QPLTDLPFVFWDERLSTVAVER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            LI M+VSR KR  ++DS AAA ILQ  LDR+  +
Sbjct: 120 ALIGMDVSRGKRADRIDSAAAAFILQGALDRLHMM 154


>gi|254712407|ref|ZP_05174218.1| Holliday junction resolvase-like protein [Brucella ceti M644/93/1]
 gi|254715479|ref|ZP_05177290.1| Holliday junction resolvase-like protein [Brucella ceti M13/05/1]
 gi|261217214|ref|ZP_05931495.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261320085|ref|ZP_05959282.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260922303|gb|EEX88871.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292775|gb|EEX96271.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 162

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 80/155 (51%), Positives = 106/155 (68%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+   IE++   LKP Q +A +DLGTK IGLA+SD G  FA+PRP + R K T  A  LL
Sbjct: 1   MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAYPRPVIKRVKFTIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + T+ +   +IGLP+NM+G+ GPRV +TRAFV  M      +PFVFWDERL+TV+A++
Sbjct: 61  KALETDKVGVIVIGLPMNMDGTAGPRVQATRAFVRTM-QPLTDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            LI M+VSR KR  ++DS AAA ILQ  LDR+  +
Sbjct: 120 ALIGMDVSRGKRADRIDSAAAAFILQGALDRLHMM 154


>gi|319898952|ref|YP_004159045.1| resolvase [Bartonella clarridgeiae 73]
 gi|319402916|emb|CBI76467.1| putative resolvase [Bartonella clarridgeiae 73]
          Length = 164

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 80/158 (50%), Positives = 109/158 (68%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+I+ I ++   L   Q IAS+DLGTK IG+AISD    F++PRP + RKK T  AL L+
Sbjct: 1   MAIININEVTTHLLLGQTIASLDLGTKTIGIAISDISLTFSNPRPVIHRKKFTLDALTLV 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+ A +IGLP+NM+GS GPRV +T+ FV NM      +PFVFWDERL+T +A++
Sbjct: 61  KVFNNENVGAIVIGLPINMDGSNGPRVQATKTFVSNMA-MYTKIPFVFWDERLSTTAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L+++++SR KR  ++DS AAA ILQ  LDRI  L S+
Sbjct: 120 YLLEIDMSRSKRKSRIDSAAAAFILQGALDRIQTLPSN 157


>gi|239833964|ref|ZP_04682292.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301]
 gi|239822027|gb|EEQ93596.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301]
          Length = 165

 Score =  158 bits (400), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 109/158 (68%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ IE++   L+P + IA +DLGTK IGLA+SD G  FAHPRP + R K +  A  LL
Sbjct: 1   MAVVEIEEIPALLQPGKTIAGLDLGTKTIGLAVSDLGLSFAHPRPVIKRVKFSIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +  + +   +IGLP+NM+G+ GPRV +TRAFV  M      +PFVFWDERL+TV+A++
Sbjct: 61  KALDADKVGVIVIGLPMNMDGTSGPRVQATRAFVRTM-QPLTDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            LI M+VSR KR +++DS AAA ILQ  LDR+  +  S
Sbjct: 120 ALIGMDVSRGKRAERIDSAAAAFILQGALDRLHSIRRS 157


>gi|121602720|ref|YP_989125.1| hypothetical protein BARBAKC583_0838 [Bartonella bacilliformis
           KC583]
 gi|167012695|sp|A1UT22|RUVX_BARBK RecName: Full=Putative Holliday junction resolvase
 gi|120614897|gb|ABM45498.1| conserved hypothetical protein TIGR00250 [Bartonella bacilliformis
           KC583]
          Length = 161

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 80/158 (50%), Positives = 109/158 (68%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+I+ I+ ++  L   Q IA +DLGTK IG+AISD    F++PRP + RKK T  AL+L+
Sbjct: 1   MAIITIDRVISHLLSKQTIAGLDLGTKTIGIAISDISLTFSNPRPVIQRKKFTLDALKLI 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+   IIGLP+NM+GS GPRV +TR FV N I     +PF+FWDERL+T++AQ+
Sbjct: 61  KIFDHENVGVAIIGLPINMDGSNGPRVQATRTFVSN-IAMYTKIPFIFWDERLSTIAAQR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++++VSR KR  ++DS AAA ILQ  LDRI  L  +
Sbjct: 120 HLLEIDVSRIKRENRIDSAAAAFILQGALDRIQILRQN 157


>gi|90417721|ref|ZP_01225633.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337393|gb|EAS51044.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 156

 Score =  157 bits (396), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 78/157 (49%), Positives = 109/157 (69%), Gaps = 1/157 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+I+ +E+   ++   + IA +DLGTK IGLA+SD G+RFA PR  L R K T  A  L+
Sbjct: 1   MAIVSLEEFADAVPSGKTIAGLDLGTKTIGLAVSDRGQRFATPRKVLRRTKFTADANALV 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  +NI   +IGLPLNM+GSEGPR  +TRAF+ N   R    P + WDERL+TV+A++
Sbjct: 61  AALNEDNIVGIVIGLPLNMDGSEGPRAQATRAFLRNY-SRFDERPVLLWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
            L++ +VSRKKR +++DS AA+ ILQ  LDR+S L S
Sbjct: 120 GLLEADVSRKKRAERIDSAAASFILQGALDRLSSLRS 156


>gi|319783699|ref|YP_004143175.1| Holliday junction resolvase YqgF [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169587|gb|ADV13125.1| Holliday junction resolvase YqgF [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 168

 Score =  156 bits (394), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 110/158 (69%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I+ IE+L   L   + +A +DLG K IG+A+SD    FAHPRP ++R+K +  A  LL
Sbjct: 1   MGIITIEELPARLAGGKTLAGLDLGDKTIGVAVSDQRFSFAHPRPVIMRRKFSLDAAVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  EN  A +IGLP+NM+GSEGPR   +RAFV NM  +   +PFV WDERL+TV+A++
Sbjct: 61  ALLQKENAGAVVIGLPINMDGSEGPRAQKSRAFVRNMA-QMSDLPFVLWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            LI+M+ SR+KR  K+DS AAA ILQ VLDR+  L +S
Sbjct: 120 TLIEMDFSRRKRAGKIDSAAAAFILQGVLDRLQSLHAS 157


>gi|319408539|emb|CBI82192.1| putative resolvase [Bartonella schoenbuchensis R1]
          Length = 159

 Score =  155 bits (393), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 83/160 (51%), Positives = 111/160 (69%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ I ++   L P Q IA +DLGTK IG+AISD    F++PRP + RKK T  AL L+
Sbjct: 1   MAVINIHEITTHLLPKQTIAGLDLGTKTIGIAISDISLTFSNPRPVIQRKKFTLDALTLV 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+   +IGLP+NM+GS GPRV +TR FV NM      +PFVFWDERL+T++AQ+
Sbjct: 61  QIFNNENVGVAVIGLPVNMDGSNGPRVQATRTFVSNM-GAYTKIPFVFWDERLSTIAAQR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR  ++DS AAA ILQ VLDRI  L  ++G
Sbjct: 120 SLLEMDVSRAKRAARIDSAAAAFILQGVLDRIQNLNHTEG 159


>gi|294853606|ref|ZP_06794278.1| Holliday junction resolvase [Brucella sp. NVSL 07-0026]
 gi|294819261|gb|EFG36261.1| Holliday junction resolvase [Brucella sp. NVSL 07-0026]
          Length = 162

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/155 (50%), Positives = 104/155 (67%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+   IE++   LKP Q +A +DLGTK IGLA+SD G  FAHPRP + R K T  A  LL
Sbjct: 1   MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAHPRPVIKRVKFTIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + T+ +   +IGLP+N +G+ GPRV +TRAFV  M      + FVFWDERL+TV+A++
Sbjct: 61  KALETDKVGVIVIGLPMNTDGTAGPRVQATRAFVRTM-QPLTDLSFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            LI M+VSR KR  ++DS AAA ILQ  LDR+  +
Sbjct: 120 ALIGMDVSRGKRADRIDSAAAAFILQGALDRLHMM 154


>gi|153010985|ref|YP_001372199.1| Holliday junction resolvase YqgF [Ochrobactrum anthropi ATCC 49188]
 gi|167012742|sp|A6X566|RUVX_OCHA4 RecName: Full=Putative Holliday junction resolvase
 gi|151562873|gb|ABS16370.1| Holliday junction resolvase YqgF [Ochrobactrum anthropi ATCC 49188]
          Length = 165

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 107/158 (67%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ IE++   L+  Q IA +DLGTK IGLA+SD G  FAHPRP + R K +  A  LL
Sbjct: 1   MAVVEIEEIPALLQSGQTIAGLDLGTKTIGLAVSDLGLSFAHPRPVIKRVKFSIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +  + +   +IGLP+NM+G+ GPRV +TRAFV  M      +PFVFWDERL+TV+A++
Sbjct: 61  KALDADKVGVIVIGLPMNMDGTSGPRVQATRAFVRTM-QPLTDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            LI M+VSR KR  ++DS AA+ ILQ  LDR+  +  S
Sbjct: 120 ALIGMDVSRGKRADRIDSAAASFILQGALDRLHSIRRS 157


>gi|13470868|ref|NP_102437.1| hypothetical protein mlr0681 [Mesorhizobium loti MAFF303099]
 gi|32130057|sp|Q98M90|RUVX_RHILO RecName: Full=Putative Holliday junction resolvase
 gi|14021611|dbj|BAB48223.1| mlr0681 [Mesorhizobium loti MAFF303099]
          Length = 166

 Score =  153 bits (386), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 105/146 (71%), Gaps = 1/146 (0%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           L   + +A +DLG K IG+A+SD G  FAHPRP ++R+K +  A  LL+ +  EN+ A  
Sbjct: 5   LADGRTLAGLDLGDKTIGVAVSDRGFAFAHPRPVIMRRKFSLDAAVLLALLKKENVGAVA 64

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           IGLP+NM+GSEGPR   +RAFV NM  +   +PFVFWDERL+TV+A++ LI+M+ SR KR
Sbjct: 65  IGLPINMDGSEGPRAQKSRAFVRNMA-QLSDLPFVFWDERLSTVAAERTLIEMDFSRAKR 123

Query: 133 IQKVDSIAAALILQEVLDRISFLESS 158
             K+DS AAA ILQ VLDR+  L+S+
Sbjct: 124 AGKIDSAAAAFILQGVLDRLQSLDSA 149


>gi|218672210|ref|ZP_03521879.1| Holliday junction resolvase YqgF [Rhizobium etli GR56]
          Length = 121

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 69/122 (56%), Positives = 92/122 (75%), Gaps = 1/122 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L IE++ + L P Q IA +DLGTK IGL++SD GRRFA PRP + R K T  A  L+
Sbjct: 1   MTVLTIEEMARILAPGQAIAGLDLGTKTIGLSMSDLGRRFATPRPVIRRVKFTIDAQALM 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F  TE +A F+IGLP+NM+GS GPRV +TRAFV NM ++K  +PFV+WDERL+TV+A++
Sbjct: 61  DFAATEKVAGFVIGLPINMDGSAGPRVQATRAFVRNM-EQKTALPFVYWDERLSTVAAER 119

Query: 121 IL 122
            L
Sbjct: 120 TL 121


>gi|307946447|ref|ZP_07661782.1| putative Holliday junction resolvase [Roseibium sp. TrichSKD4]
 gi|307770111|gb|EFO29337.1| putative Holliday junction resolvase [Roseibium sp. TrichSKD4]
          Length = 160

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 100/155 (64%), Gaps = 1/155 (0%)

Query: 4   LLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI 63
           L ++D +  L PN  +  +DLGTK IGLA+SD GR  A P   + RKK TQ A +LL   
Sbjct: 7   LSLDDFLSVLPPNSRLIGLDLGTKTIGLALSDLGRGIATPMETIRRKKFTQDAEKLLDIC 66

Query: 64  TTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI 123
             + ++  ++GLPLNM+GSEGPR  +TRAF  N+  +K  +P  +WDERL+T +  + L+
Sbjct: 67  AKQEVSGLVLGLPLNMDGSEGPRAQATRAFCRNL-SQKTELPITYWDERLSTAAVTRTLL 125

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           + + SR KR + VD +AAA ILQ  LDR+  + +S
Sbjct: 126 EADSSRAKRAEVVDKMAAAFILQGFLDRLGHMGAS 160


>gi|328543472|ref|YP_004303581.1| endonuclease involved in recombination [polymorphum gilvum
           SL003B-26A1]
 gi|326413216|gb|ADZ70279.1| Predicted endonuclease involved in recombination [Polymorphum
           gilvum SL003B-26A1]
          Length = 166

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 70/156 (44%), Positives = 99/156 (63%), Gaps = 1/156 (0%)

Query: 4   LLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI 63
           L +ED V +L P   +  +DLGT+ IGLA+SD GR  A P   + R+K T  A +LL   
Sbjct: 7   LSLEDFVAALAPGTRLIGLDLGTRTIGLALSDLGRGIASPLETIRRRKFTLDAEQLLKIC 66

Query: 64  TTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI 123
               +   ++GLPLNM+GSEGPRV +TRAF  N+ + K  +P  +WDERL+T +  + LI
Sbjct: 67  AEHRVGGLVLGLPLNMDGSEGPRVQATRAFARNLAE-KTDLPITYWDERLSTAAVTRTLI 125

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           + + SR +R + VD +AAA ILQ  LDR+ +L  S+
Sbjct: 126 EADRSRARRAELVDKMAAAYILQGFLDRLGYLSRSR 161


>gi|217976928|ref|YP_002361075.1| Holliday junction resolvase-like protein [Methylocella silvestris
           BL2]
 gi|254767519|sp|B8EPC5|RUVX_METSB RecName: Full=Putative Holliday junction resolvase
 gi|217502304|gb|ACK49713.1| Holliday junction resolvase YqgF [Methylocella silvestris BL2]
          Length = 161

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/155 (49%), Positives = 102/155 (65%), Gaps = 1/155 (0%)

Query: 3   ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSF 62
           IL + DL   + P Q +  IDLGTK IGLA+SD  RR A P   + R K ++ A+ L+  
Sbjct: 5   ILEVADLPARVGPRQRLIGIDLGTKTIGLALSDVERRIATPLETIQRIKFSKDAVRLIEL 64

Query: 63  ITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL 122
               +  A IIGLPLNM+GS+GPRV +TRAFV ++    V  PFV+WDERL+T +  + L
Sbjct: 65  AEKFDAGALIIGLPLNMDGSQGPRVQATRAFVRSL-SALVSKPFVYWDERLSTAAVTRSL 123

Query: 123 IDMNVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
           ID +VSR KR + VD +AAA ILQ VLDR+  +E+
Sbjct: 124 IDQDVSRLKRAEVVDKMAAAYILQGVLDRLRRIEA 158


>gi|310816166|ref|YP_003964130.1| Putative Holliday junction resolvase [Ketogulonicigenium vulgare
           Y25]
 gi|308754901|gb|ADO42830.1| Putative Holliday junction resolvase [Ketogulonicigenium vulgare
           Y25]
          Length = 156

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 70/150 (46%), Positives = 97/150 (64%), Gaps = 1/150 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           +ED   +L P + +  +DLGT  IG+A+SD     A P   + RKK +  A  LL  I  
Sbjct: 6   VEDFAAALPPMRAVCGLDLGTVTIGVAVSDLMLSVASPLETIKRKKFSLDAEALLKIIAA 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
            NIA  ++GLPLNM+GSEGPR  STRAF  N+  R   +P V+WDERL+TV+A++ L++ 
Sbjct: 66  RNIAGIVLGLPLNMDGSEGPRAQSTRAFARNL-SRLTDLPIVYWDERLSTVAAERALLEA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           + SRK+R + +D +AA  ILQ VLDR+  L
Sbjct: 125 DTSRKRRDEVIDHVAAGFILQGVLDRLRHL 154


>gi|254474193|ref|ZP_05087584.1| conserved hypothetical protein TIGR00250 [Pseudovibrio sp. JE062]
 gi|211956723|gb|EEA91932.1| conserved hypothetical protein TIGR00250 [Pseudovibrio sp. JE062]
          Length = 165

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 68/155 (43%), Positives = 97/155 (62%), Gaps = 1/155 (0%)

Query: 4   LLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI 63
           L +ED   +L  +  +  IDLGTK IGLA++D GR+ A P   + RKK TQ    LL   
Sbjct: 7   LSLEDFCDALYDDDRLIGIDLGTKTIGLALTDSGRQIASPLETIKRKKFTQDVERLLDLC 66

Query: 64  TTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI 123
               +   +IGLPLNM+G+EGPR  +TRAFV N+  +K  +P  +WDERL+T +  + LI
Sbjct: 67  HEHGVFGLVIGLPLNMDGTEGPRCQATRAFVRNLA-QKTEIPITYWDERLSTAAVTRTLI 125

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           + + SR +R + VD +AA  ILQ  LDR+++  +S
Sbjct: 126 EADRSRARRAELVDKMAATYILQGFLDRVNYGGTS 160


>gi|118590189|ref|ZP_01547592.1| Putative Holliday junction resolvase [Stappia aggregata IAM 12614]
 gi|118437161|gb|EAV43799.1| Putative Holliday junction resolvase [Stappia aggregata IAM 12614]
          Length = 162

 Score =  139 bits (349), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 97/157 (61%), Gaps = 1/157 (0%)

Query: 4   LLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI 63
           L +ED V ++     +  +DLGTK IGLA+SD G   A P   + RKK T  A +LL+  
Sbjct: 7   LSLEDFVAAVPARTRLIGLDLGTKTIGLALSDLGLGIASPMETIRRKKFTLDAEQLLTIC 66

Query: 64  TTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI 123
             + +   ++GLPLNM+GSEGPR  +TRAFV N+  +K  +P  +WDERL+T +  + L+
Sbjct: 67  AKQGVGGIVLGLPLNMDGSEGPRAQATRAFVRNL-SQKTDLPITYWDERLSTAAVTRTLL 125

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           + + SR KR   VD +AAA ILQ  LDR+ F+    G
Sbjct: 126 EADTSRAKRADVVDKMAAAYILQGFLDRLGFMGLDNG 162


>gi|254504549|ref|ZP_05116700.1| conserved hypothetical protein TIGR00250 [Labrenzia alexandrii
           DFL-11]
 gi|222440620|gb|EEE47299.1| conserved hypothetical protein TIGR00250 [Labrenzia alexandrii
           DFL-11]
          Length = 161

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 68/152 (44%), Positives = 96/152 (63%), Gaps = 1/152 (0%)

Query: 4   LLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI 63
           L +ED + ++     +  +DLGTK IGLA+SD GR  A P   + RKK T  A +LL   
Sbjct: 7   LSLEDFIAAVPDRTRLIGLDLGTKTIGLALSDLGRGIASPMETIRRKKFTLDAEQLLKIC 66

Query: 64  TTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI 123
             + +   ++GLPLNM+G+EGPRV +TRAF  N+   K  +P  FWDERL+T +  + L+
Sbjct: 67  NEQGVGGLVLGLPLNMDGTEGPRVQATRAFTRNLAP-KTDLPMTFWDERLSTAAVTRTLL 125

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           + + SR KR + VD +AAA ILQ  LDR+ F+
Sbjct: 126 EADSSRAKRAEVVDKMAAAYILQGFLDRLGFM 157


>gi|254439741|ref|ZP_05053235.1| conserved hypothetical protein TIGR00250 [Octadecabacter
           antarcticus 307]
 gi|198255187|gb|EDY79501.1| conserved hypothetical protein TIGR00250 [Octadecabacter
           antarcticus 307]
          Length = 162

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 95/145 (65%), Gaps = 1/145 (0%)

Query: 8   DLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN 67
           D   +L P  P+A +DLGTK IG+A+SD G   A P   + R K    AL L    +   
Sbjct: 8   DFAAALPPYAPLAGLDLGTKTIGVAVSDGGLTIASPLETIKRSKFQADALRLFEITSHRA 67

Query: 68  IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV 127
           IA  ++GLP NM+GSEGPR  STRAF  N+  R   +P  +WDERL+TV+A++ L++ + 
Sbjct: 68  IAGIVLGLPRNMDGSEGPRAQSTRAFARNL-SRLTDLPITYWDERLSTVAAERALLEADT 126

Query: 128 SRKKRIQKVDSIAAALILQEVLDRI 152
           SRK+R + +D++AA++ILQ +LDR+
Sbjct: 127 SRKRRAEVIDNVAASIILQGMLDRL 151


>gi|77463236|ref|YP_352740.1| putative endonuclease involved in recombination [Rhodobacter
           sphaeroides 2.4.1]
 gi|126462110|ref|YP_001043224.1| Holliday junction resolvase-like protein [Rhodobacter sphaeroides
           ATCC 17029]
 gi|332558114|ref|ZP_08412436.1| Holliday junction resolvase-like protein [Rhodobacter sphaeroides
           WS8N]
 gi|146325603|sp|Q3J2Z5|RUVX_RHOS4 RecName: Full=Putative Holliday junction resolvase
 gi|167012752|sp|A3PJD6|RUVX_RHOS1 RecName: Full=Putative Holliday junction resolvase
 gi|77387654|gb|ABA78839.1| putative endonuclease involved in recombination [Rhodobacter
           sphaeroides 2.4.1]
 gi|126103774|gb|ABN76452.1| Holliday junction resolvase YqgF [Rhodobacter sphaeroides ATCC
           17029]
 gi|332275826|gb|EGJ21141.1| Holliday junction resolvase-like protein [Rhodobacter sphaeroides
           WS8N]
          Length = 160

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 68/155 (43%), Positives = 100/155 (64%), Gaps = 1/155 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           IED + SL     +A +DLGTK +G+A+SD  RR A P   + R K T+ A +L +    
Sbjct: 6   IEDFLASLPRTGALAGLDLGTKTVGVAVSDGLRRIATPLLTVRRTKFTEDAAKLKAIAAE 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             +   ++GLP NM+GSEGPR  STRAF  N++ + + +P  FWDERL+TV+A++ L++ 
Sbjct: 66  RRLVGIVLGLPRNMDGSEGPRAQSTRAFARNLV-QVLPLPVGFWDERLSTVAAERALLEA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           + SRK+R + +D +AA  ILQ VLDR+ +L    G
Sbjct: 125 DTSRKRRAEVIDHVAAGYILQGVLDRLDWLGREGG 159


>gi|221639098|ref|YP_002525360.1| Holliday junction resolvase-like protein [Rhodobacter sphaeroides
           KD131]
 gi|254767523|sp|B9KRR7|RUVX_RHOSK RecName: Full=Putative Holliday junction resolvase
 gi|221159879|gb|ACM00859.1| Holliday junction resolvase [Rhodobacter sphaeroides KD131]
          Length = 160

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 68/155 (43%), Positives = 100/155 (64%), Gaps = 1/155 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           IED + SL     +A +DLGTK +G+A+SD  RR A P   + R K T+ A +L +    
Sbjct: 6   IEDFLASLPRTGALAGLDLGTKTVGVAVSDGLRRIATPLLTVRRTKFTEDAAKLKAIADE 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             +   ++GLP NM+GSEGPR  STRAF  N++ + + +P  FWDERL+TV+A++ L++ 
Sbjct: 66  RRLVGIVLGLPRNMDGSEGPRAQSTRAFARNLV-QVLPLPVGFWDERLSTVAAERALLEA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           + SRK+R + +D +AA  ILQ VLDR+ +L    G
Sbjct: 125 DTSRKRRAEVIDHVAAGYILQGVLDRLDWLGREGG 159


>gi|6226491|sp|Q52673|RUVX_RHOCA RecName: Full=Putative Holliday junction resolvase
 gi|1353874|gb|AAB01816.1| unknown [Rhodobacter capsulatus]
          Length = 159

 Score =  136 bits (343), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 66/155 (42%), Positives = 101/155 (65%), Gaps = 1/155 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           ++D   +L     +A +DLGTK IG+A+SD  R  A P   + R+K T    +L+  +  
Sbjct: 6   MDDFAAALPRVGALAGLDLGTKTIGVAVSDTLRGIATPLRTIRREKFTLDVADLMKTVAE 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             IA F++GLP+NM+GSEGPR  STRAF  N+ ++   +P  FWDERL+TV+A++ +++ 
Sbjct: 66  RQIAGFVLGLPVNMDGSEGPRAQSTRAFARNL-EKLTPLPITFWDERLSTVAAERAMLEA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           ++SRK+R + VD +AA  ILQ  LDR++ L  + G
Sbjct: 125 DLSRKRRAELVDHVAAGFILQGALDRLAHLGRAHG 159


>gi|84517362|ref|ZP_01004716.1| hypothetical protein SKA53_06000 [Loktanella vestfoldensis SKA53]
 gi|84508842|gb|EAQ05305.1| hypothetical protein SKA53_06000 [Loktanella vestfoldensis SKA53]
          Length = 158

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/151 (43%), Positives = 99/151 (65%), Gaps = 1/151 (0%)

Query: 7   EDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE 66
           ED    L  +  +A +DLGT  IG+A+SD  R  A P   + R+K T  A  L    T  
Sbjct: 7   EDFAAQLPRHGAVAGLDLGTVTIGVAVSDLMRSVATPLETIKRRKFTLDAARLFEITTHR 66

Query: 67  NIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMN 126
            IA  ++GLP NM+GSEGPR  +TRAF  N +++   +P  FWDERL+TV+A++ +++ +
Sbjct: 67  MIAGLVLGLPRNMDGSEGPRCQATRAFARN-LEKLTPLPITFWDERLSTVAAERAMLEAD 125

Query: 127 VSRKKRIQKVDSIAAALILQEVLDRISFLES 157
           +SRK+R +++D+IAA+ ILQ +LDR+  LE+
Sbjct: 126 MSRKRRAERIDNIAASYILQGMLDRLRHLEA 156


>gi|119383262|ref|YP_914318.1| Holliday junction resolvase YqgF [Paracoccus denitrificans PD1222]
 gi|167012745|sp|A1AZC8|RUVX_PARDP RecName: Full=Putative Holliday junction resolvase
 gi|119373029|gb|ABL68622.1| Holliday junction resolvase YqgF [Paracoccus denitrificans PD1222]
          Length = 158

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 94/150 (62%), Gaps = 1/150 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           +E   ++L     +A +DLGTK IG+A+SD  R  A P   + R K T  A  LL  +  
Sbjct: 6   VETFAEALPRTGAVAGLDLGTKTIGVAVSDGLRGVASPLTVIRRTKFTADAQALLKIVQD 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             +   ++GLP NM+GSEGPR  STRAF  N+ +R   +P  FWDERL+TV+A++ L++ 
Sbjct: 66  RALVGLVLGLPRNMDGSEGPRAQSTRAFARNL-ERLTPLPITFWDERLSTVAAERALLEG 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           + SRK+R + +D +AA  ILQ  LDR+ FL
Sbjct: 125 DTSRKRRAEVIDQVAAGYILQGALDRLRFL 154


>gi|149913939|ref|ZP_01902471.1| hypothetical protein RAZWK3B_18088 [Roseobacter sp. AzwK-3b]
 gi|149812223|gb|EDM72054.1| hypothetical protein RAZWK3B_18088 [Roseobacter sp. AzwK-3b]
          Length = 158

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 66/148 (44%), Positives = 97/148 (65%), Gaps = 1/148 (0%)

Query: 12  SLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAF 71
           +L    PI  +DLGTK IG+AISD     A P   + RKK +  A  LL   T   +A  
Sbjct: 12  TLPKGHPIMGLDLGTKTIGVAISDRLLSVATPTETIKRKKFSVDAARLLEIATQREVAGL 71

Query: 72  IIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           ++GLP NM+GSEGPR  STRAF  N+ +    +P  FWDERL+TV+A++ L++ + SRK+
Sbjct: 72  VLGLPRNMDGSEGPRCQSTRAFARNL-EPLTELPITFWDERLSTVAAERALLEADTSRKR 130

Query: 132 RIQKVDSIAAALILQEVLDRISFLESSK 159
           R + +D++AA+ ILQ VLDR++ + +++
Sbjct: 131 RAEVIDNVAASYILQGVLDRLTHMRAAQ 158


>gi|260575164|ref|ZP_05843165.1| Holliday junction resolvase YqgF [Rhodobacter sp. SW2]
 gi|259022786|gb|EEW26081.1| Holliday junction resolvase YqgF [Rhodobacter sp. SW2]
          Length = 160

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 98/161 (60%), Gaps = 2/161 (1%)

Query: 1   MSIL-LIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALEL 59
           MS+L  IE+   +L   + +A +D G K IG+A+SD  R  A P   + R K T  A  L
Sbjct: 1   MSVLETIEEFAATLPARRAVAGLDFGEKTIGVAVSDLSRSVATPLLTIRRVKFTDDAAAL 60

Query: 60  LSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQ 119
              IT   IA  I+GLP NM+GSEGPR  +TRAF  N+  R   +P  FWDERL+TV+A 
Sbjct: 61  AKIITERQIAGLILGLPRNMDGSEGPRAQATRAFARNL-SRLTPLPIGFWDERLSTVAAT 119

Query: 120 QILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           + L++ + SRK+R + +D +AA  ILQ VLDR++ +    G
Sbjct: 120 RALLEADTSRKRRAEVIDHVAAGYILQGVLDRMAHMTREAG 160


>gi|312115158|ref|YP_004012754.1| Holliday junction resolvase YqgF [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220287|gb|ADP71655.1| Holliday junction resolvase YqgF [Rhodomicrobium vannielii ATCC
           17100]
          Length = 156

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 101/149 (67%), Gaps = 1/149 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           + DL+  LK ++ +  +D+GTK +GLA+SD  R+ A P   + R K T  A++LL+    
Sbjct: 8   LPDLISRLKRDERLMGLDVGTKTVGLALSDVMRQIATPFDTIRRTKFTADAVKLLAHCKA 67

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
           + +   ++GLP+N++G+EGPR  STRAFV ++      +P  FWDERL+T +A+++L++ 
Sbjct: 68  QGVGGLVVGLPVNLDGTEGPRAQSTRAFVRSL-GALTDMPMAFWDERLSTAAAERVLLEA 126

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISF 154
           + SRK+R + +D +AAA ILQ  LDR+++
Sbjct: 127 DASRKRRAEVIDKMAAAYILQGALDRVNY 155


>gi|294677840|ref|YP_003578455.1| holliday junction resolvase YqgF [Rhodobacter capsulatus SB 1003]
 gi|294476660|gb|ADE86048.1| holliday junction resolvase YqgF [Rhodobacter capsulatus SB 1003]
          Length = 159

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 65/155 (41%), Positives = 101/155 (65%), Gaps = 1/155 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           ++D   +L     +A +DLGTK IG+A+SD  R  A P   + R+K +    +L+  +  
Sbjct: 6   MDDFAAALPRVGALAGLDLGTKTIGVAVSDTLRGIATPLRTIRREKFSLDLADLMKTVAE 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             IA F++GLP+NM+GSEGPR  STRAF  N+ ++   +P  FWDERL+TV+A++ +++ 
Sbjct: 66  RQIAGFVLGLPVNMDGSEGPRAQSTRAFARNL-EKLTPLPITFWDERLSTVAAERAMLEA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           ++SRK+R + VD +AA  ILQ  LDR++ L  + G
Sbjct: 125 DLSRKRRAELVDHVAAGFILQGALDRLAHLGRAHG 159


>gi|254485728|ref|ZP_05098933.1| conserved hypothetical protein TIGR00250 [Roseobacter sp. GAI101]
 gi|214042597|gb|EEB83235.1| conserved hypothetical protein TIGR00250 [Roseobacter sp. GAI101]
          Length = 161

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 95/155 (61%), Gaps = 1/155 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           I D   +L P Q +  +DLG K IG+A++D     A P   + RKK    A  L   I  
Sbjct: 6   ITDFAAALPPMQALIGLDLGEKTIGVAVTDSFLSVATPLETVRRKKFGLDAALLTQIIAD 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             I   I+GLP NM+GSEGPR  STRAF  N  D+ V +P  FWDERL+TV+A++ L++ 
Sbjct: 66  RRIGGVILGLPRNMDGSEGPRCQSTRAFARNF-DKLVDLPIGFWDERLSTVAAEKALLEA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           + SRK+R + +D +AA+ ILQ VLDR+S L +  G
Sbjct: 125 DTSRKRRAEVIDHVAASYILQGVLDRLSVLRAKGG 159


>gi|254512444|ref|ZP_05124511.1| conserved hypothetical protein TIGR00250 [Rhodobacteraceae
           bacterium KLH11]
 gi|221536155|gb|EEE39143.1| conserved hypothetical protein TIGR00250 [Rhodobacteraceae
           bacterium KLH11]
          Length = 154

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 93/151 (61%), Gaps = 1/151 (0%)

Query: 5   LIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFIT 64
           + ED   +L P   +  +DLG K IG+A+SD  R  A P   + RKK T  +  L+  +T
Sbjct: 5   VFEDFAAALPPMSALMGLDLGEKTIGVAVSDRMRGVATPLETVRRKKFTLDSARLIEIVT 64

Query: 65  TENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID 124
              I   ++GLP NM+GSEGPR  STRAF  N+  R   V   FWDERL+TV+A++ L++
Sbjct: 65  DREIGGIVLGLPRNMDGSEGPRCQSTRAFARNLT-RLTEVQIGFWDERLSTVAAEKALLE 123

Query: 125 MNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            + +RK+R Q +D +AA  ILQ  LDR+ FL
Sbjct: 124 ADTTRKRRGQVIDHVAAGYILQGALDRLRFL 154


>gi|85707211|ref|ZP_01038297.1| hypothetical protein ROS217_23800 [Roseovarius sp. 217]
 gi|85668265|gb|EAQ23140.1| hypothetical protein ROS217_23800 [Roseovarius sp. 217]
          Length = 160

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 96/152 (63%), Gaps = 1/152 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           I     +L   + I  +DLGTK IG+A+SD     A P   + R K T+ A  L   +T 
Sbjct: 6   IAGFAGALPRGRAIMGLDLGTKTIGVALSDRLWSVASPHETVKRVKFTEDAARLFDIMTG 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
            ++   I+GLP NM+GSEGPR  STRAF  N+  R    P  +WDERL+TV+A++ L++ 
Sbjct: 66  RDVGGIILGLPRNMDGSEGPRAQSTRAFARNL-SRLTDAPIGYWDERLSTVAAERALLEA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
           + +RK+R+Q +D+IAAA ILQ VLDR+S + +
Sbjct: 125 DATRKRRMQVIDNIAAAYILQGVLDRMSHMRA 156


>gi|260428035|ref|ZP_05782014.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260422527|gb|EEX15778.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 157

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 70/153 (45%), Positives = 97/153 (63%), Gaps = 1/153 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           IE+    L P + +A +DLGTK IG+A+SD     A P   + RKK TQ A  L+  +  
Sbjct: 6   IEEFAAILPPMRALAGLDLGTKTIGVALSDRLLTVATPLETVKRKKFTQDAARLVEILRQ 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             IA  ++GLP NM+GSEGPR  STRAF  N   +    P  FWDERL+TV+A++ L++ 
Sbjct: 66  REIAGVVLGLPRNMDGSEGPRCQSTRAFARNF-SQLWDGPITFWDERLSTVAAERALLEA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           + SR+KR + +D +AA+ ILQ VLDR+  L S+
Sbjct: 125 DTSRRKRAELIDHVAASYILQGVLDRLRNLRSA 157


>gi|56697209|ref|YP_167573.1| Holliday junction resolvase-like protein [Ruegeria pomeroyi DSS-3]
 gi|62900907|sp|Q5LQY2|RUVX_SILPO RecName: Full=Putative Holliday junction resolvase
 gi|56678946|gb|AAV95612.1| conserved hypothetical protein TIGR00250 [Ruegeria pomeroyi DSS-3]
          Length = 154

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 94/150 (62%), Gaps = 1/150 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           +E+   +L P   +A +DLG K IG+A+SD  R  A P   + RKK    A  LL+ +  
Sbjct: 6   VEEFAAALPPFSALAGLDLGDKTIGVAVSDRMRGVATPLETIRRKKFGLDASALLAIVEQ 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             IA  ++GLP NM+GSEGPR  STRAF  N+  R   V   FWDERL+TV+A++ L++ 
Sbjct: 66  REIAGIVLGLPRNMDGSEGPRCQSTRAFARNL-SRLTEVAITFWDERLSTVAAEKALLEA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           + +RK+R + +D +AAA ILQ  LDR+  L
Sbjct: 125 DTTRKRRSEVIDHVAAAYILQGALDRLRNL 154


>gi|149202250|ref|ZP_01879223.1| Holliday junction resolvase YqgF [Roseovarius sp. TM1035]
 gi|149144348|gb|EDM32379.1| Holliday junction resolvase YqgF [Roseovarius sp. TM1035]
          Length = 160

 Score =  132 bits (332), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 94/152 (61%), Gaps = 1/152 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           I     +L   + I  +DLGTK IG+A+SD     A P   + R K T  A  LL  +  
Sbjct: 6   IAAFAAALPQGRAIMGLDLGTKTIGVALSDRLWSVASPHETVKRVKFTDDAARLLQIVAG 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             +   I+GLP NM+GSEGPR  STRAF  N+  R   VP  +WDERL+TV+A++ L++ 
Sbjct: 66  REVGGIILGLPRNMDGSEGPRAQSTRAFARNL-SRLTEVPIGYWDERLSTVAAERALLEA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
           + +RK+R+Q +D+IAAA ILQ VLDR+  + +
Sbjct: 125 DATRKRRMQVIDNIAAAYILQGVLDRMGHMRA 156


>gi|260433278|ref|ZP_05787249.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417106|gb|EEX10365.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 154

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 92/149 (61%), Gaps = 1/149 (0%)

Query: 7   EDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE 66
           E+   +L P Q +  +DLG K IG+A+SD  R  A P   + RKK    +  LL   T  
Sbjct: 7   EEFAAALPPMQALMGLDLGEKTIGVAVSDRMRGVASPLETVRRKKFKLDSARLLEIATDR 66

Query: 67  NIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMN 126
            I   ++GLP NM+GSEGPR  STRAF  N+  +   +P  FWDERL+TV+A++ L++ +
Sbjct: 67  EIGGIVLGLPRNMDGSEGPRCQSTRAFARNL-SQLTDIPIGFWDERLSTVAAKKALLEAD 125

Query: 127 VSRKKRIQKVDSIAAALILQEVLDRISFL 155
            +RK+R Q +D +AA  ILQ  LDR+ FL
Sbjct: 126 TTRKRRGQVIDHVAAGYILQGALDRLRFL 154


>gi|182678862|ref|YP_001833008.1| Holliday junction resolvase-like protein [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|226725489|sp|B2IEC1|RUVX_BEII9 RecName: Full=Putative Holliday junction resolvase
 gi|182634745|gb|ACB95519.1| Holliday junction resolvase YqgF [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 165

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 93/146 (63%), Gaps = 1/146 (0%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           L P Q +  IDLGTK IGL++SD  RR A P   + R K T+ A  LL+     ++AAF+
Sbjct: 15  LGPRQRLIGIDLGTKTIGLSLSDVERRIATPLETIRRTKFTKDAERLLALADQFDVAAFV 74

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           IGLPLNM+GS GPRV +T AFV ++       PF +WDERL+T +  + LI  + SR KR
Sbjct: 75  IGLPLNMDGSAGPRVQATEAFVRSL-SGLTSRPFCYWDERLSTAAVTRDLIAQDASRAKR 133

Query: 133 IQKVDSIAAALILQEVLDRISFLESS 158
              VD +AAA ILQ  LDR++++  +
Sbjct: 134 AAVVDKLAAAFILQGALDRLAWVHET 159


>gi|288958770|ref|YP_003449111.1| holliday junction resolvase [Azospirillum sp. B510]
 gi|288911078|dbj|BAI72567.1| holliday junction resolvase [Azospirillum sp. B510]
          Length = 178

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 98/156 (62%), Gaps = 5/156 (3%)

Query: 3   ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSF 62
           I  +EDL   L  NQ +  +D+GTK +GLA++DPG   A P   L R K TQ A EL   
Sbjct: 2   IHTLEDLAARLGRNQRLLGLDVGTKTVGLAVADPGLIVASPIGTLKRTKFTQDARELGKT 61

Query: 63  ITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPF----VFWDERLTTVSA 118
           I    I   ++GLPLNM+GSEGPR  S RAF +N+++R   + +     FWDERL+T + 
Sbjct: 62  IRDYGIGGLVVGLPLNMDGSEGPRAESVRAFANNLLERSDLLGWEAEIAFWDERLSTSAV 121

Query: 119 QQILI-DMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
           ++ +I + +++RK+R + VD +AAA ILQ  LD ++
Sbjct: 122 ERFMIGEADMTRKRRDEVVDKMAAAYILQGALDMLA 157


>gi|254465560|ref|ZP_05078971.1| conserved hypothetical protein TIGR00250 [Rhodobacterales bacterium
           Y4I]
 gi|206686468|gb|EDZ46950.1| conserved hypothetical protein TIGR00250 [Rhodobacterales bacterium
           Y4I]
          Length = 157

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 64/154 (41%), Positives = 98/154 (63%), Gaps = 1/154 (0%)

Query: 5   LIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFIT 64
           + ED   +L P   +  +DLGTK IG+A+SD     A P   + RKK +  A  LL  I 
Sbjct: 5   VFEDFAAALPPMSALMGLDLGTKTIGVAVSDRIGAVATPLETVKRKKFSTDAARLLEIIQ 64

Query: 65  TENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID 124
             +I+  ++GLP NM+G+EGPR  STRAF  N++ +   +P  FWDERL+TV+A++ L++
Sbjct: 65  ARDISGILLGLPRNMDGTEGPRCQSTRAFARNLM-QLTDLPISFWDERLSTVAAEKALLE 123

Query: 125 MNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            + +RK+R + +D +AA+ ILQ  LDR+  L++ 
Sbjct: 124 ADTTRKRRAEVIDHVAASYILQGALDRMRHLKNG 157


>gi|114765456|ref|ZP_01444566.1| hypothetical protein 1100011001321_R2601_10219 [Pelagibaca
           bermudensis HTCC2601]
 gi|114542166|gb|EAU45197.1| hypothetical protein R2601_10219 [Roseovarius sp. HTCC2601]
          Length = 158

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 94/153 (61%), Gaps = 1/153 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           IED   +L  ++ +A +DLGTK IG+A+SD     A P   + RKK T  A  LL  +  
Sbjct: 6   IEDFAAALPRDRALAGLDLGTKTIGVAVSDRLLTVATPLETVKRKKFTLDAERLLEILVK 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             I   ++GLP NM+GSEGPR  STRAF  N   R    P  FWDERL+TV+A++ L++ 
Sbjct: 66  REIGGVVLGLPRNMDGSEGPRCQSTRAFARNF-SRLWDGPVTFWDERLSTVAAERALLEA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           + SR KR + +D +AA+ ILQ  LDR+  L ++
Sbjct: 125 DTSRAKRAELIDHVAASYILQGALDRLRHLRAN 157


>gi|323136211|ref|ZP_08071293.1| Holliday junction resolvase YqgF [Methylocystis sp. ATCC 49242]
 gi|322398285|gb|EFY00805.1| Holliday junction resolvase YqgF [Methylocystis sp. ATCC 49242]
          Length = 157

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 96/151 (63%), Gaps = 3/151 (1%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           IE++ + L     +  +DLGTK IGLA+SD  RR A P   + R K +Q A  LL     
Sbjct: 8   IEEVARVLPAKGRLMGLDLGTKTIGLALSDVERRLASPLDTIKRVKFSQDAGALLQRAQD 67

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVY-VPFVFWDERLTTVSAQQILID 124
            ++ A + GLPLNM+G+ GPR  +TRAF+ N+  RK+  +PFVFWDERL+T +  + LI 
Sbjct: 68  FDVQALVFGLPLNMDGTAGPRAQATRAFMRNL--RKLTPIPFVFWDERLSTAAVTRELIA 125

Query: 125 MNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            + SR KR + VD +AAA ILQ  LDR+S L
Sbjct: 126 QDASRAKRAEVVDRMAAAYILQGALDRLSRL 156


>gi|146277916|ref|YP_001168075.1| Holliday junction resolvase-like protein [Rhodobacter sphaeroides
           ATCC 17025]
 gi|167012753|sp|A4WTQ6|RUVX_RHOS5 RecName: Full=Putative Holliday junction resolvase
 gi|145556157|gb|ABP70770.1| Holliday junction resolvase YqgF [Rhodobacter sphaeroides ATCC
           17025]
          Length = 160

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 64/150 (42%), Positives = 97/150 (64%), Gaps = 1/150 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           IE+ + +L  +  +  +DLGTK IG+A++D  RR A P   + R K T+ A  L +    
Sbjct: 6   IEEFLAALPRSGALIGLDLGTKTIGVAVTDGLRRIATPLLTIRRTKFTEDAARLRAITAE 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             +   ++GLP NM+GSEGPR  STRAF  N+  + + +P  +WDERL+TV+A++ LI+ 
Sbjct: 66  RGLVGIVLGLPRNMDGSEGPRAQSTRAFARNL-SQVLPLPIGYWDERLSTVAAERALIEA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           + SRK+R + +D +AA  ILQ VLDR+ +L
Sbjct: 125 DTSRKRRAEVIDHVAAGYILQGVLDRLDWL 154


>gi|254454337|ref|ZP_05067774.1| conserved hypothetical protein TIGR00250 [Octadecabacter
           antarcticus 238]
 gi|198268743|gb|EDY93013.1| conserved hypothetical protein TIGR00250 [Octadecabacter
           antarcticus 238]
          Length = 158

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 63/151 (41%), Positives = 95/151 (62%), Gaps = 1/151 (0%)

Query: 8   DLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN 67
           D   +L    P+A +DLGTK IG+A+ D G   A P   + R K    A  L        
Sbjct: 8   DFAAALPRYAPLAGLDLGTKTIGVAVCDGGLIIASPLETIKRSKFQADATRLFEITAHRE 67

Query: 68  IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV 127
           +A  ++GLP NM+GSEGPR  STRAF  N+  R   +P  +WDERL+TV+A++ L++ + 
Sbjct: 68  VAGIVLGLPRNMDGSEGPRAQSTRAFARNL-SRLSDLPITYWDERLSTVAAERALLEADT 126

Query: 128 SRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           SRK+R + +D+IAA++ILQ +LDR+  ++++
Sbjct: 127 SRKRRAEVIDNIAASIILQGLLDRLRNIKAA 157


>gi|126729458|ref|ZP_01745272.1| hypothetical protein SSE37_24699 [Sagittula stellata E-37]
 gi|126710448|gb|EBA09500.1| hypothetical protein SSE37_24699 [Sagittula stellata E-37]
          Length = 156

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/151 (43%), Positives = 93/151 (61%), Gaps = 3/151 (1%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           IE    +L P Q +  +DLGTK IG+A+SD  R  A P   + RKK    A  L + I  
Sbjct: 6   IEGFAAALPPMQALMGLDLGTKTIGVAVSDGLRSVATPLETVKRKKFGVDAERLQALIAG 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVY-VPFVFWDERLTTVSAQQILID 124
             I   I+GLP NM+G+EGPR  STRAF  N     ++  P  +WDERL+TV+A++ L++
Sbjct: 66  RRIGGLILGLPRNMDGTEGPRCQSTRAFARNFA--ALWDGPIGYWDERLSTVAAEKALLE 123

Query: 125 MNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            + +RK+R + +D +AA+ ILQ  LDR+ FL
Sbjct: 124 ADTTRKRRAEVIDHVAASYILQGALDRLRFL 154


>gi|296445897|ref|ZP_06887848.1| Holliday junction resolvase YqgF [Methylosinus trichosporium OB3b]
 gi|296256565|gb|EFH03641.1| Holliday junction resolvase YqgF [Methylosinus trichosporium OB3b]
          Length = 160

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 93/152 (61%), Gaps = 1/152 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           +E+L   L     +  +D+GTK IGLA+SD  RR A P   + R K T  A  L + +  
Sbjct: 8   VEELAALLPAKGRLMGLDVGTKTIGLALSDVERRLASPLETIRRGKFTSDAERLGALVAQ 67

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
            +IAA I+GLPLNM+GSEGPR  +TRAF+ N+  R   + + FWDERL+T +  + L+  
Sbjct: 68  FDIAALIVGLPLNMDGSEGPRAQATRAFMRNLGAR-FALRYAFWDERLSTAAVTRELLAQ 126

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
           + SR KR   VD +AAA ILQ  LDR+  L S
Sbjct: 127 DASRAKRAAVVDRMAAAYILQGALDRLRRLAS 158


>gi|92117802|ref|YP_577531.1| Holliday junction resolvase YqgF [Nitrobacter hamburgensis X14]
 gi|91800696|gb|ABE63071.1| Holliday junction resolvase YqgF [Nitrobacter hamburgensis X14]
          Length = 168

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 87/137 (63%), Gaps = 1/137 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +DLGTK IG+A+SDP RR A     L RK  T  A  LL+     N A F++GLP+N
Sbjct: 26  LVGLDLGTKTIGVAVSDPDRRLATGVETLQRKTFTADAARLLAIAGERNAAGFVLGLPIN 85

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+GSEGPR  STRAF  N+  R   +    WDERL+TV+ ++ LI M++SR KR + +D 
Sbjct: 86  MDGSEGPRAQSTRAFARNLA-RLTDLAIGLWDERLSTVAVERELIGMDMSRAKRAKVIDE 144

Query: 139 IAAALILQEVLDRISFL 155
            AA  ILQ  LDR++ L
Sbjct: 145 HAAIFILQGALDRLAVL 161


>gi|89068321|ref|ZP_01155731.1| hypothetical protein OG2516_02629 [Oceanicola granulosus HTCC2516]
 gi|89046238|gb|EAR52296.1| hypothetical protein OG2516_02629 [Oceanicola granulosus HTCC2516]
          Length = 157

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 93/149 (62%), Gaps = 1/149 (0%)

Query: 7   EDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE 66
           ED   +L  +  +  +DLGT+ IG+A+SD  R  A P   + RKK    A  LL+     
Sbjct: 7   EDFAAALPDHGALVGLDLGTRTIGVAVSDGLRAVATPLQTIARKKFGVDAAALLAICEHR 66

Query: 67  NIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMN 126
            I   ++GLP NM+GSEGPR  STR F  N+ +R   +P  FWDERL+TV+A++ L++ +
Sbjct: 67  AITGIVLGLPRNMDGSEGPRCQSTRGFARNL-ERLTPLPIAFWDERLSTVAAERALLEAD 125

Query: 127 VSRKKRIQKVDSIAAALILQEVLDRISFL 155
            SR++R + +D +AA +ILQ +LDR+  L
Sbjct: 126 TSRRRRGEVIDHVAAGVILQGMLDRLRHL 154


>gi|118597217|sp|Q1QL26|RUVX_NITHX RecName: Full=Putative Holliday junction resolvase
          Length = 163

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 87/137 (63%), Gaps = 1/137 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +DLGTK IG+A+SDP RR A     L RK  T  A  LL+     N A F++GLP+N
Sbjct: 21  LVGLDLGTKTIGVAVSDPDRRLATGVETLQRKTFTADAARLLAIAGERNAAGFVLGLPIN 80

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+GSEGPR  STRAF  N+  R   +    WDERL+TV+ ++ LI M++SR KR + +D 
Sbjct: 81  MDGSEGPRAQSTRAFARNLA-RLTDLAIGLWDERLSTVAVERELIGMDMSRAKRAKVIDE 139

Query: 139 IAAALILQEVLDRISFL 155
            AA  ILQ  LDR++ L
Sbjct: 140 HAAIFILQGALDRLAVL 156


>gi|163746885|ref|ZP_02154242.1| hypothetical protein OIHEL45_15819 [Oceanibulbus indolifex HEL-45]
 gi|161379999|gb|EDQ04411.1| hypothetical protein OIHEL45_15819 [Oceanibulbus indolifex HEL-45]
          Length = 157

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 91/148 (61%), Gaps = 1/148 (0%)

Query: 8   DLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN 67
           D + +L P Q +  +DLG K IG+A+SD  +  A P   + RKK    A  L   I    
Sbjct: 8   DFLAALPPMQALIGLDLGEKTIGVAVSDSFQSVATPLETVRRKKFGLDAARLAEIIAKRR 67

Query: 68  IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV 127
           I   ++GLP NM+GSEGPR  STRAF  N  DR   +P  +WDERL+TV+A++ L++ + 
Sbjct: 68  IGGLVLGLPRNMDGSEGPRCQSTRAFARN-FDRLTPLPITYWDERLSTVAAERALLEADT 126

Query: 128 SRKKRIQKVDSIAAALILQEVLDRISFL 155
           +RK+R + +D +AA  ILQ +LDR+  +
Sbjct: 127 TRKRRAEVIDHVAAGYILQGLLDRLQVM 154


>gi|126725473|ref|ZP_01741315.1| hypothetical protein RB2150_04693 [Rhodobacterales bacterium
           HTCC2150]
 gi|126704677|gb|EBA03768.1| hypothetical protein RB2150_04693 [Rhodobacterales bacterium
           HTCC2150]
          Length = 156

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 69/154 (44%), Positives = 92/154 (59%), Gaps = 4/154 (2%)

Query: 5   LIEDLVK---SLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS 61
           +IED V+   SLK   PI ++D G K IG+A SD  R  A P   + R K T  A  LL 
Sbjct: 3   IIEDFVEFGSSLKEMSPIFALDFGDKTIGIATSDIFRNIATPLETIRRTKFTADAERLLE 62

Query: 62  FITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQI 121
                 +  F++GLP NM+GSEG R   TRAF  N+ +R   +   FWDERL+TV+A++ 
Sbjct: 63  LAKQRQVTGFVLGLPRNMDGSEGVRCQKTRAFARNL-ERLTEINIAFWDERLSTVAAERA 121

Query: 122 LIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           LI+ + SR KR Q +D +AA  ILQ  LDR++ L
Sbjct: 122 LIEADTSRAKRAQIIDHVAAGYILQGALDRLAHL 155


>gi|126736029|ref|ZP_01751773.1| hypothetical protein RCCS2_02303 [Roseobacter sp. CCS2]
 gi|126714586|gb|EBA11453.1| hypothetical protein RCCS2_02303 [Roseobacter sp. CCS2]
          Length = 158

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 97/152 (63%), Gaps = 1/152 (0%)

Query: 7   EDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE 66
           E  V ++     +A +DLGT  IG+A+SD  R  A P   + RKK    A +LL   T  
Sbjct: 7   ETFVAAIPDRGALAGLDLGTVTIGVAVSDVLRSVATPLETIKRKKFGVDAAKLLELTTHR 66

Query: 67  NIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMN 126
            +   ++GLP NM+GSEGPR  +TRAF  N+ ++   +P  FWDERL+TV+A++ L++ +
Sbjct: 67  LVTGLVLGLPRNMDGSEGPRCQATRAFARNL-EKLTPLPITFWDERLSTVAAERALLEAD 125

Query: 127 VSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            SRK+R + +D +AA  ILQ +LDR++ L+++
Sbjct: 126 TSRKRRAEVIDHVAAGYILQGMLDRMAHLKAT 157


>gi|27380205|ref|NP_771734.1| Holliday junction resolvase-like protein [Bradyrhizobium japonicum
           USDA 110]
 gi|27353359|dbj|BAC50359.1| blr5094 [Bradyrhizobium japonicum USDA 110]
          Length = 167

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 66/158 (41%), Positives = 92/158 (58%), Gaps = 1/158 (0%)

Query: 3   ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSF 62
           IL + D          +  +DLGTK IG+A+S+P RR A     + RK   Q A  LL+ 
Sbjct: 11  ILPLVDAATHWPERGGLVGLDLGTKTIGVAVSNPDRRLATGVETIQRKAFKQDAARLLAI 70

Query: 63  ITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL 122
                +  F++GLP+NM+GSEGPR  STRAF  N+ +    +P   WDERL+T + ++ L
Sbjct: 71  AAERKVVGFVLGLPINMDGSEGPRAQSTRAFARNLAN-LTTLPIGLWDERLSTAAVEREL 129

Query: 123 IDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           I M+VSR KR + +D  AA  ILQ  LDR++ L +  G
Sbjct: 130 IGMDVSRAKRAEVIDEHAAIFILQGALDRLANLRTGNG 167


>gi|83943004|ref|ZP_00955464.1| hypothetical protein EE36_12523 [Sulfitobacter sp. EE-36]
 gi|83846012|gb|EAP83889.1| hypothetical protein EE36_12523 [Sulfitobacter sp. EE-36]
          Length = 161

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 91/152 (59%), Gaps = 1/152 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           I D   +L P Q +  +DLG K IG+A+SD     A P   + RKK    A  L   I  
Sbjct: 6   ITDFAAALPPMQALIGLDLGEKTIGVAVSDSFLSIATPLETVRRKKFGVDAARLSEIIAA 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             I   ++GLP NM+GSEG R  STRAF  N  DR   +P  FWDERL+TV+A++ L++ 
Sbjct: 66  RGIGGVVLGLPRNMDGSEGARCQSTRAFARNF-DRLGDIPIGFWDERLSTVAAERALLEA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
           + SR++R + +D +AA  ILQ VLDR+  +++
Sbjct: 125 DTSRRRRAEVIDHVAAGYILQGVLDRLRVIKA 156


>gi|32130021|sp|Q89K24|RUVX_BRAJA RecName: Full=Putative Holliday junction resolvase
          Length = 161

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 66/158 (41%), Positives = 92/158 (58%), Gaps = 1/158 (0%)

Query: 3   ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSF 62
           IL + D          +  +DLGTK IG+A+S+P RR A     + RK   Q A  LL+ 
Sbjct: 5   ILPLVDAATHWPERGGLVGLDLGTKTIGVAVSNPDRRLATGVETIQRKAFKQDAARLLAI 64

Query: 63  ITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL 122
                +  F++GLP+NM+GSEGPR  STRAF  N+ +    +P   WDERL+T + ++ L
Sbjct: 65  AAERKVVGFVLGLPINMDGSEGPRAQSTRAFARNLAN-LTTLPIGLWDERLSTAAVEREL 123

Query: 123 IDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           I M+VSR KR + +D  AA  ILQ  LDR++ L +  G
Sbjct: 124 IGMDVSRAKRAEVIDEHAAIFILQGALDRLANLRTGNG 161


>gi|83954179|ref|ZP_00962899.1| hypothetical protein NAS141_17774 [Sulfitobacter sp. NAS-14.1]
 gi|83841216|gb|EAP80386.1| hypothetical protein NAS141_17774 [Sulfitobacter sp. NAS-14.1]
          Length = 161

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 91/152 (59%), Gaps = 1/152 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           I D   +L P Q +  +DLG K IG+A+SD     A P   + RKK    A  L   I  
Sbjct: 6   ITDFAAALPPMQALIGLDLGEKTIGVAVSDSFLSIATPLETVRRKKFGVDATRLSEIIAA 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             I   ++GLP NM+GSEG R  STRAF  N  DR   +P  FWDERL+TV+A++ L++ 
Sbjct: 66  RGIGGVVLGLPRNMDGSEGARCQSTRAFARNF-DRLGDIPIGFWDERLSTVAAERALLEA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
           + SR++R + +D +AA  ILQ VLDR+  +++
Sbjct: 125 DTSRRRRAEVIDHVAAGYILQGVLDRLRVIKA 156


>gi|86749549|ref|YP_486045.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris HaA2]
 gi|146325600|sp|Q2IXC6|RUVX_RHOP2 RecName: Full=Putative Holliday junction resolvase
 gi|86572577|gb|ABD07134.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris HaA2]
          Length = 160

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 66/135 (48%), Positives = 84/135 (62%), Gaps = 1/135 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLGTK IG+A+SDP RR A     + RK  T  A  LL+     N   F++GLPLNM+
Sbjct: 23  GLDLGTKTIGVAVSDPDRRLATGIETVARKAFTADAQRLLALAAGRNACGFVLGLPLNMD 82

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSEGPRV STRAF  N   R   +P   WDERL+T + ++ LI  +VSR KR + +D  A
Sbjct: 83  GSEGPRVQSTRAFARNFA-RLTELPIGLWDERLSTAAVERELIANDVSRAKRAKIIDEHA 141

Query: 141 AALILQEVLDRISFL 155
           A  ILQ  LDR++ L
Sbjct: 142 AIYILQGALDRLATL 156


>gi|115525369|ref|YP_782280.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris
           BisA53]
 gi|122295574|sp|Q07L84|RUVX_RHOP5 RecName: Full=Putative Holliday junction resolvase
 gi|115519316|gb|ABJ07300.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris
           BisA53]
          Length = 163

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 65/146 (44%), Positives = 87/146 (59%), Gaps = 1/146 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P   +  +DLGTK IG+A+SDP RR A     ++RK  T  A  LL+  T       ++G
Sbjct: 17  PTGALIGLDLGTKTIGVAVSDPARRLATGVETILRKTFTTDAARLLALATERKAVGLVLG 76

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP+NM+ SEGPR  STRAF  N+  R   +P   WDERL+T + ++ LI  +VSR KR +
Sbjct: 77  LPINMDASEGPRAQSTRAFARNLA-RLTELPIGLWDERLSTAAVERELIANDVSRAKRAK 135

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            +D  AA  ILQ  LDR++ L  S G
Sbjct: 136 VIDEHAAIFILQGALDRLAVLNRSTG 161


>gi|254420883|ref|ZP_05034607.1| conserved hypothetical protein TIGR00250 [Brevundimonas sp. BAL3]
 gi|196187060|gb|EDX82036.1| conserved hypothetical protein TIGR00250 [Brevundimonas sp. BAL3]
          Length = 159

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 94/153 (61%), Gaps = 2/153 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +L + DL  +  P+ P   +DLG K IG+A+SD  R  A P   + + K T  A +L 
Sbjct: 1   MPVLDLLDLPAACPPDTPWMGLDLGEKTIGVAVSDATRLIASPLELIRKSKFTLEADQLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +    ++A +IGLP NM+G+EGPR  S RAF  N+ +R   V   FWDERL+T + ++
Sbjct: 61  KLMAHRKVSALVIGLPANMDGTEGPRAQSCRAFARNL-ERLRPVNIAFWDERLSTSAVER 119

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLDRI 152
            LI D++++RK+R Q VD  AAA ILQ  LDR+
Sbjct: 120 FLIEDLDLNRKRRAQVVDRTAAAWILQGALDRV 152


>gi|84499203|ref|ZP_00997491.1| hypothetical protein OB2597_04730 [Oceanicola batsensis HTCC2597]
 gi|84392347|gb|EAQ04558.1| hypothetical protein OB2597_04730 [Oceanicola batsensis HTCC2597]
          Length = 161

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 95/155 (61%), Gaps = 2/155 (1%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           +E+   +L P + IA +D G K IG+A+SD     A P   + R+K  Q A  L + +  
Sbjct: 6   VEEFAAALPPMRAIAGLDFGDKTIGVAVSDTFLSVATPLETIRRRKFGQDADALSALLAA 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVY--VPFVFWDERLTTVSAQQILI 123
             I   ++GLP NM+GSEGPR  STRAF  N+  R  +  +P  FWDERL+TV+A++ L+
Sbjct: 66  RTIGGLVLGLPRNMDGSEGPRCQSTRAFARNLARRPDFADLPLTFWDERLSTVAAERALL 125

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           + + SR++R + +D +AA  ILQ  LDR+  L+ +
Sbjct: 126 EADTSRRRRAEVIDHVAAGYILQGALDRLRHLKGA 160


>gi|259418877|ref|ZP_05742794.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259345099|gb|EEW56953.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 157

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 93/152 (61%), Gaps = 1/152 (0%)

Query: 7   EDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE 66
           ED   +L     +  +D G K IG+A+SD     A P   + RKK T  +  LL  I+  
Sbjct: 7   EDFAATLPQMTALVGLDFGEKTIGVAVSDRIGAVATPLETIRRKKFTLDSNRLLEIISGR 66

Query: 67  NIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMN 126
           +I   I+GLP NM+GSEGPR  STRAF  N+  R   +P  FWDERL+TV+A++ L++ +
Sbjct: 67  DINGIILGLPRNMDGSEGPRCQSTRAFARNL-SRVTDLPIGFWDERLSTVAAERALLEAD 125

Query: 127 VSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            SRK+R + +D +AA+ ILQ  LDR+  ++S 
Sbjct: 126 TSRKRRAEVIDHVAASYILQGALDRLRHIKSG 157


>gi|163734012|ref|ZP_02141453.1| hypothetical protein RLO149_03699 [Roseobacter litoralis Och 149]
 gi|161392548|gb|EDQ16876.1| hypothetical protein RLO149_03699 [Roseobacter litoralis Och 149]
          Length = 163

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/154 (39%), Positives = 96/154 (62%), Gaps = 3/154 (1%)

Query: 8   DLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN 67
           D + +L P + +  +DLGT+ IG+A+SD     A P   + R+K T  A  L+   +   
Sbjct: 8   DFLAALAPMRSLMGLDLGTQTIGVAVSDTFLSVATPLETIKRRKFTLDAARLVEIASERR 67

Query: 68  IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVY--VPFVFWDERLTTVSAQQILIDM 125
           +   ++GLP NM+GSEGPR  STRAF  N+ ++ +   +P  FWDERL+TV+A++ L++ 
Sbjct: 68  LGGLVLGLPRNMDGSEGPRCQSTRAFARNL-EKTIGSDLPITFWDERLSTVAAERALLEA 126

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           + SRK+R + +D +AA  ILQ  LDRI  + + +
Sbjct: 127 DTSRKRRAEVIDHVAAGYILQGALDRIRVIRAEQ 160


>gi|146341407|ref|YP_001206455.1| Holliday junction resolvase-like protein [Bradyrhizobium sp.
           ORS278]
 gi|167012698|sp|A4YWF9|RUVX_BRASO RecName: Full=Putative Holliday junction resolvase
 gi|146194213|emb|CAL78235.1| putative Holliday junction resolvase [Bradyrhizobium sp. ORS278]
          Length = 161

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 86/140 (61%), Gaps = 1/140 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +DLGTK IG+A+SDP RR A     + RK     A  LL+      +  F++GLP+N
Sbjct: 21  LVGLDLGTKTIGVAVSDPDRRLATGVETIQRKAFKADAARLLAICAERKVVGFVLGLPIN 80

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+GSEGPR  STRAF  N+      +P   WDERL+T + ++ LI M+VSR KR + +D+
Sbjct: 81  MDGSEGPRAQSTRAFARNLAG-LTDLPIGLWDERLSTAAVERELIGMDVSRAKRAEVIDT 139

Query: 139 IAAALILQEVLDRISFLESS 158
            AA  ILQ  LDR++ L  S
Sbjct: 140 HAAIFILQGALDRLTTLRRS 159


>gi|99080808|ref|YP_612962.1| Holliday junction resolvase YqgF [Ruegeria sp. TM1040]
 gi|124107444|sp|Q1GI16|RUVX_SILST RecName: Full=Putative Holliday junction resolvase
 gi|99037088|gb|ABF63700.1| Holliday junction resolvase YqgF [Ruegeria sp. TM1040]
          Length = 157

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 92/152 (60%), Gaps = 1/152 (0%)

Query: 7   EDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE 66
           ED   +L     +  +D G K IG+A+SD     A P   + RKK T  +  LL  I   
Sbjct: 7   EDFAAALPQMTALVGLDFGEKTIGVAVSDRIGAVATPLETIRRKKFTLDSNRLLEIIAGR 66

Query: 67  NIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMN 126
           +I   ++GLP NM+GSEGPR  STRAF  N+  R   +P  FWDERL+TV+A++ L++ +
Sbjct: 67  DINGILLGLPRNMDGSEGPRCQSTRAFARNL-SRVTDLPIGFWDERLSTVAAERALLEAD 125

Query: 127 VSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            SRK+R + +D +AA+ ILQ  LDR+  + SS
Sbjct: 126 TSRKRRAEVIDHVAASYILQGALDRMRHIRSS 157


>gi|209964820|ref|YP_002297735.1| hypothetical protein RC1_1518 [Rhodospirillum centenum SW]
 gi|226731644|sp|B6IN25|RUVX_RHOCS RecName: Full=Putative Holliday junction resolvase
 gi|209958286|gb|ACI98922.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 188

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 99/164 (60%), Gaps = 4/164 (2%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+I  + +L  SL  N  +  +DLG K IGLA+SDPG   A P   + R K TQ A EL 
Sbjct: 1   MAIRNLMELKASLPRNGRLMGLDLGEKTIGLAVSDPGLSVASPVGTIRRTKFTQDAQELA 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPF----VFWDERLTTV 116
             +   ++ A ++GLP+NM+G+EGPR  S R F   ++ R     F     FWDERL+T 
Sbjct: 61  RAMRDRDVRALVVGLPVNMDGTEGPRCQSVREFSRLLLQRPQLFGFEPEIAFWDERLSTS 120

Query: 117 SAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           + ++++I  +++RK+R + VD +AAA ILQ  LDR+   +++ G
Sbjct: 121 AVERMMIGWDMTRKRRDEVVDKMAAAYILQGALDRLRQGDAAPG 164


>gi|86138500|ref|ZP_01057074.1| hypothetical protein MED193_05331 [Roseobacter sp. MED193]
 gi|85825025|gb|EAQ45226.1| hypothetical protein MED193_05331 [Roseobacter sp. MED193]
          Length = 157

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 90/153 (58%), Gaps = 1/153 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
            ED   +L     +A +D G K +G+AISD     A P   + RKK T  A  L   +  
Sbjct: 6   FEDFAAALPGFTALAGLDFGDKTVGVAISDRMGTVATPLETIRRKKFTLDADHLFEIVKK 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             I   ++GLP NM+GSEGPR   TRAF  N+  R   +P  FWDERL+TV+A++ L++ 
Sbjct: 66  REIGGLVLGLPRNMDGSEGPRCQKTRAFARNL-SRLTELPIGFWDERLSTVAAERALLEA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           + SRK+R + +D +AA+ ILQ  LDR+  L++ 
Sbjct: 125 DTSRKRRAELIDHVAASYILQGALDRMRHLKND 157


>gi|110679064|ref|YP_682071.1| hypothetical protein RD1_1766 [Roseobacter denitrificans OCh 114]
 gi|118597221|sp|Q169F8|RUVX_ROSDO RecName: Full=Putative Holliday junction resolvase
 gi|109455180|gb|ABG31385.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 163

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 95/154 (61%), Gaps = 3/154 (1%)

Query: 8   DLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN 67
           D + +L   + +  +DLGT+ IG+A+SD     A P   + R+K T  A  L   +    
Sbjct: 8   DFLAALPSMRSLMGLDLGTQTIGVAVSDTFLSVATPLETVKRRKFTLDAARLSDIVAQRR 67

Query: 68  IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVY--VPFVFWDERLTTVSAQQILIDM 125
           +   ++GLP NM+GSEGPR  STRAF  N+ D+ +   +P  FWDERL+TV+A++ L++ 
Sbjct: 68  LGGLVLGLPRNMDGSEGPRCQSTRAFARNL-DKSIGSDLPITFWDERLSTVAAERALLEA 126

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           + SRK+R + +D +AAA ILQ  LDRI  + + +
Sbjct: 127 DTSRKRRAEVIDHVAAAYILQGALDRIRVIRAEQ 160


>gi|154253281|ref|YP_001414105.1| Holliday junction resolvase YqgF [Parvibaculum lavamentivorans
           DS-1]
 gi|154157231|gb|ABS64448.1| Holliday junction resolvase YqgF [Parvibaculum lavamentivorans
           DS-1]
          Length = 182

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 91/147 (61%), Gaps = 1/147 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           + +L   L  N+ +  +DLG+K IGLA+SD     A P   + R K T  A  L++    
Sbjct: 34  LAELKVGLGRNRRLIGVDLGSKTIGLALSDVSLSIASPLETIRRTKFTADAERLIALAKE 93

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
            +  A + GLPLNM+G+EGPR  STRAF+ N+ ++   +P  FWDERL+T++  + L+D 
Sbjct: 94  HDAGALVFGLPLNMDGTEGPRCQSTRAFIRNL-EKLTDLPIAFWDERLSTMAVTRTLLDA 152

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRI 152
           + SR +R + VD +AAA ILQ  LDR+
Sbjct: 153 DASRARRAELVDKMAAAYILQGALDRL 179


>gi|158424464|ref|YP_001525756.1| holliday junction resolvase [Azorhizobium caulinodans ORS 571]
 gi|158331353|dbj|BAF88838.1| holliday junction resolvase [Azorhizobium caulinodans ORS 571]
          Length = 185

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 87/145 (60%), Gaps = 1/145 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           + ++  +L     +  +DLGTK IG+A  DP RR A     + R K TQ A  L+   + 
Sbjct: 35  LAEIAAALPERGSLLGLDLGTKTIGVATCDPDRRLATVVETVKRTKFTQDAERLMVLASE 94

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
               AF++GLPLNM+GSEGPRV ++RAF  N   R   +P  FWDERL+TV+ ++ LI  
Sbjct: 95  RKAVAFVLGLPLNMDGSEGPRVQASRAFARNFA-RLSGLPIAFWDERLSTVAVERALISA 153

Query: 126 NVSRKKRIQKVDSIAAALILQEVLD 150
           +VSR KR   +D  AAA ILQ  +D
Sbjct: 154 DVSRAKRANVIDQHAAAFILQGAID 178


>gi|148256069|ref|YP_001240654.1| Holliday junction resolvase-like protein [Bradyrhizobium sp. BTAi1]
 gi|167012697|sp|A5EKQ4|RUVX_BRASB RecName: Full=Putative Holliday junction resolvase
 gi|146408242|gb|ABQ36748.1| putative Holliday junction resolvase [Bradyrhizobium sp. BTAi1]
          Length = 161

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 88/140 (62%), Gaps = 1/140 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +DLGTK IG+A+SDP RR A     + RK     A  LL+  +   +  F++GLP+N
Sbjct: 21  LVGLDLGTKTIGVAVSDPDRRLATGVETIQRKAFKADAARLLAISSERKVVGFVLGLPIN 80

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+GSEGPR  STRAF  N+ +    +P   WDERL+T + ++ LI M+VSR +R + +D+
Sbjct: 81  MDGSEGPRAQSTRAFARNLAN-LTDLPIGLWDERLSTAAVERELIGMDVSRARRAEVIDT 139

Query: 139 IAAALILQEVLDRISFLESS 158
            AA  ILQ  LDR++ L  S
Sbjct: 140 HAAIFILQGALDRLATLRRS 159


>gi|255261332|ref|ZP_05340674.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255103667|gb|EET46341.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 158

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 93/153 (60%), Gaps = 1/153 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           I +   ++     +A +DLGT  IG+A+SD     A P   + RKK +  A  LL     
Sbjct: 6   ITEFAAAVPQMSALAGLDLGTVTIGVAVSDRFLSVATPLETIRRKKFSLDAARLLEIAKD 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             +   ++GLP NM+GSEGPR  STRAF  N+ ++   +P  FWDERL+TV+A++ L++ 
Sbjct: 66  RELGGLVLGLPYNMDGSEGPRCQSTRAFARNL-EKLTDLPISFWDERLSTVAAERALLEA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           + +RK+R + +D +AA  ILQ VLDR + L +S
Sbjct: 125 DTTRKRRAEVIDHVAAGYILQGVLDRFAHLRAS 157


>gi|83952340|ref|ZP_00961071.1| putative endonuclease involved in recombination [Roseovarius
           nubinhibens ISM]
 gi|83836013|gb|EAP75311.1| putative endonuclease involved in recombination [Roseovarius
           nubinhibens ISM]
          Length = 158

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 94/158 (59%), Gaps = 5/158 (3%)

Query: 5   LIEDLVKSLKPNQP----IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           +I D  +S     P    +  +DLGTK +G+A+SD  R  A P   + R+K T  A  L 
Sbjct: 1   MIHDAFESFAEGLPAMGALMGLDLGTKTVGVAVSDGMRGVATPLETVKRQKFTLDAARLQ 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             I   ++   ++GLP NM+GSEGPR  STRAF  N   +   +P  FWDERL+TV+A++
Sbjct: 61  ELIAARSVVGVVLGLPRNMDGSEGPRCQSTRAFARNFA-QLTDLPIGFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++ + SRK+R + +D +AA+ ILQ  LDR+  +  S
Sbjct: 120 ALLEADTSRKRRAEVIDHVAASYILQGALDRLRHIGRS 157


>gi|254477517|ref|ZP_05090903.1| conserved hypothetical protein TIGR00250 [Ruegeria sp. R11]
 gi|214031760|gb|EEB72595.1| conserved hypothetical protein TIGR00250 [Ruegeria sp. R11]
          Length = 157

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 89/141 (63%), Gaps = 1/141 (0%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPL 77
           PIA +D G K +G+AISD     A P   + RKK T  A +L   +    I A ++GLP 
Sbjct: 18  PIAGLDFGDKTVGVAISDRMGTVATPLETIRRKKFTLDAEKLFEIVKAREIGALLLGLPR 77

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NM+G+EGPR   TRAF  N+  +   +P  FWDERL+TV+A++ L++ + SRK+R + +D
Sbjct: 78  NMDGTEGPRCQKTRAFARNL-SQLTDLPIGFWDERLSTVAAERALLEADTSRKRRSEVID 136

Query: 138 SIAAALILQEVLDRISFLESS 158
            +AA+ ILQ  LDR+  L++ 
Sbjct: 137 HVAASYILQGALDRMRHLKTG 157


>gi|114771780|ref|ZP_01449173.1| hypothetical protein OM2255_12592 [alpha proteobacterium HTCC2255]
 gi|114547596|gb|EAU50487.1| hypothetical protein OM2255_12592 [alpha proteobacterium HTCC2255]
          Length = 156

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 88/146 (60%), Gaps = 1/146 (0%)

Query: 8   DLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN 67
           +    L   + +  +DLGTK IG+A+SD     A PR  + RKK       L +   + +
Sbjct: 9   EFASELTKFKSLIGLDLGTKTIGIAVSDTLWTVATPRETIKRKKFGIDCDALQTVFNSTD 68

Query: 68  IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV 127
               I+GLP+NM+GSEGPR  +TRAF  N+  R   +P  FWDERL++V+A++ +++ ++
Sbjct: 69  TGGIILGLPMNMDGSEGPRCQATRAFARNLSSR-CDIPITFWDERLSSVAAERAMLEADM 127

Query: 128 SRKKRIQKVDSIAAALILQEVLDRIS 153
           SR KR   +D +AA+ ILQ  LDRI 
Sbjct: 128 SRAKRADNIDHVAASFILQGALDRIG 153


>gi|126739041|ref|ZP_01754735.1| hypothetical protein RSK20926_21614 [Roseobacter sp. SK209-2-6]
 gi|126719658|gb|EBA16366.1| hypothetical protein RSK20926_21614 [Roseobacter sp. SK209-2-6]
          Length = 157

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/153 (39%), Positives = 91/153 (59%), Gaps = 1/153 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           IE+  +++     +A +D G K IG+AISD     A P   + RKK T  A  L      
Sbjct: 6   IEEFAQAVPGFTALAGLDFGEKTIGIAISDRIGAVATPLETIRRKKFTLDAERLFEITKA 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             I   ++GLP NM+GSEGPR   TRAF  N+ ++   +P  FWDERL+TV+A++ L++ 
Sbjct: 66  REIGGLVLGLPRNMDGSEGPRCQKTRAFARNL-EKLTELPITFWDERLSTVAAERALLEA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           + SRK+R + +D +AA+ ILQ  LDR+  ++  
Sbjct: 125 DTSRKRRAEVIDHVAASYILQGALDRMRHMKDG 157


>gi|163739973|ref|ZP_02147378.1| Holliday junction resolvase YqgF [Phaeobacter gallaeciensis BS107]
 gi|163743191|ref|ZP_02150573.1| hypothetical protein RG210_14860 [Phaeobacter gallaeciensis 2.10]
 gi|161383608|gb|EDQ07995.1| hypothetical protein RG210_14860 [Phaeobacter gallaeciensis 2.10]
 gi|161386718|gb|EDQ11082.1| Holliday junction resolvase YqgF [Phaeobacter gallaeciensis BS107]
          Length = 157

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 90/145 (62%), Gaps = 2/145 (1%)

Query: 15  PN-QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
           PN  PIA +D G K +G+AISD     A P   + RKK T  A  L   +    + A ++
Sbjct: 14  PNFTPIAGLDFGDKTVGVAISDRMGTVATPLETIRRKKFTLDAARLFEIVKDREVGALLL 73

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NM+G+EGPR   TRAF  N+  +   +P  FWDERL+TV+A++ L++ + SRK+R 
Sbjct: 74  GLPRNMDGTEGPRCQKTRAFARNLA-KLTELPIGFWDERLSTVAAERALLEADTSRKRRA 132

Query: 134 QKVDSIAAALILQEVLDRISFLESS 158
           + +D +AA+ ILQ  LDR+  +++ 
Sbjct: 133 EVIDHVAASYILQGALDRMRHIKAG 157


>gi|298291510|ref|YP_003693449.1| Holliday junction resolvase YqgF [Starkeya novella DSM 506]
 gi|296928021|gb|ADH88830.1| Holliday junction resolvase YqgF [Starkeya novella DSM 506]
          Length = 160

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 91/157 (57%), Gaps = 1/157 (0%)

Query: 3   ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSF 62
           IL + +    L     +  +DLGTK IG+A SDP RR A     + RK+ T  A  +LS 
Sbjct: 5   ILPVAEAAGILPARGSLIGLDLGTKTIGVASSDPDRRIAAGVETIARKQFTPDAGRVLSL 64

Query: 63  ITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL 122
                    ++GLP+NM+GSEGPR  ++RAF  N+  R   +P + WDERL+T + ++ +
Sbjct: 65  AAARGAVGLVLGLPVNMDGSEGPRAQASRAFARNL-SRLTELPIMLWDERLSTAAVERDM 123

Query: 123 IDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           I  ++SR +R + VD  AAA ILQ  LDR+ F+   +
Sbjct: 124 IATDMSRARRAEVVDQQAAAFILQGALDRLRFIAEGR 160


>gi|329889392|ref|ZP_08267735.1| conserved hypothetical UPF0081 family protein [Brevundimonas
           diminuta ATCC 11568]
 gi|328844693|gb|EGF94257.1| conserved hypothetical UPF0081 family protein [Brevundimonas
           diminuta ATCC 11568]
          Length = 154

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/153 (41%), Positives = 94/153 (61%), Gaps = 2/153 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +L + +L  +  PN P   +DLG   IG+++SD GR  A P   + + K +Q A +L 
Sbjct: 1   MPVLDLSELPAACPPNTPWLGLDLGENTIGVSVSDTGRIIASPLELIRKTKFSQDAEQLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +    ++A +IGLPLNM+G+EGPR  S RAF  N+ +R   V   F DERL+T + ++
Sbjct: 61  RIMDGRKVSALVIGLPLNMDGTEGPRAQSCRAFARNL-ERFRPVNVAFQDERLSTTAVER 119

Query: 121 ILID-MNVSRKKRIQKVDSIAAALILQEVLDRI 152
            LID ++++RK+R   VD  AAA ILQ  LDR+
Sbjct: 120 FLIDELDLTRKRRADVVDRTAAAWILQGALDRL 152


>gi|118597214|sp|Q2W6Y3|RUVX_MAGMM RecName: Full=Putative Holliday junction resolvase
          Length = 155

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 93/150 (62%), Gaps = 1/150 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M IL   +L+ SL  +Q +  +DLG+K IGLA+SD  R  A P   + R K TQ A  LL
Sbjct: 1   MPILAPAELLASLSRDQRLLGLDLGSKTIGLALSDVSRTIATPFDTIRRTKFTQDAELLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  + +   ++GLP+ M+G EGPR  S R+F  N+  R   +P  +WDERL+T +  +
Sbjct: 61  AVVDKQGVGGLVLGLPVEMDGFEGPRCQSVRSFAANLA-RLRDMPIAYWDERLSTSAVTR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLD 150
            L++ + SRK+R + VD +AAA ILQ +LD
Sbjct: 120 TLLEADSSRKRRAEVVDKMAAAYILQGLLD 149


>gi|83310687|ref|YP_420951.1| putative Holliday junction resolvase [Magnetospirillum magneticum
           AMB-1]
 gi|82945528|dbj|BAE50392.1| Putative Holliday junction resolvase [Magnetospirillum magneticum
           AMB-1]
          Length = 159

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 93/150 (62%), Gaps = 1/150 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M IL   +L+ SL  +Q +  +DLG+K IGLA+SD  R  A P   + R K TQ A  LL
Sbjct: 5   MPILAPAELLASLSRDQRLLGLDLGSKTIGLALSDVSRTIATPFDTIRRTKFTQDAELLL 64

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  + +   ++GLP+ M+G EGPR  S R+F  N+  R   +P  +WDERL+T +  +
Sbjct: 65  AVVDKQGVGGLVLGLPVEMDGFEGPRCQSVRSFAANLA-RLRDMPIAYWDERLSTSAVTR 123

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLD 150
            L++ + SRK+R + VD +AAA ILQ +LD
Sbjct: 124 TLLEADSSRKRRAEVVDKMAAAYILQGLLD 153


>gi|209884927|ref|YP_002288784.1| holliday junction resolvase YqgF [Oligotropha carboxidovorans OM5]
 gi|209873123|gb|ACI92919.1| holliday junction resolvase YqgF [Oligotropha carboxidovorans OM5]
          Length = 204

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 89/153 (58%), Gaps = 1/153 (0%)

Query: 3   ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSF 62
           IL + D      P   +  +DLGTK IG+A+SDP RR A     + RK  T+ A ELL  
Sbjct: 47  ILPLIDAAALWAPRGALIGLDLGTKTIGVAVSDPDRRLATGVTTIQRKNFTKDAAELLKI 106

Query: 63  ITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL 122
                 A F++GLP+NM+GSEGPR  STRAF  N   +   +    WDERL+T + ++ L
Sbjct: 107 SGERACAGFVLGLPINMDGSEGPRAQSTRAFARNFA-KLTELAIGLWDERLSTAAVEREL 165

Query: 123 IDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           +  +VSR +R + +D  AA  ILQ  LDR++ L
Sbjct: 166 LANDVSRARRAEVIDEHAAIFILQGALDRLTAL 198


>gi|326386640|ref|ZP_08208262.1| Holliday junction resolvase YqgF [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208955|gb|EGD59750.1| Holliday junction resolvase YqgF [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 155

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 59/148 (39%), Positives = 90/148 (60%), Gaps = 2/148 (1%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           I +   +L     +  +D GTK IG+A+ D G RFA P   L R+K  Q   E++  I  
Sbjct: 6   IGEFRAALSEGGVLMGLDPGTKTIGIALCDAGWRFASPSHTLNRRKFAQDKAEIVGIIAQ 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
            ++   +IGLPLNM+GSE PR  + RA   N+ D  + +P + WDER TT +A++ +I  
Sbjct: 66  RSVRGIVIGLPLNMDGSESPRSQAARAMARNLAD--LALPTLLWDERWTTQAAERAMIAQ 123

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRIS 153
           ++SR KR +++D+ AAALILQ  +D ++
Sbjct: 124 DMSRAKRAERIDAHAAALILQGAIDALA 151


>gi|85373365|ref|YP_457427.1| Holliday junction resolvase-like protein [Erythrobacter litoralis
           HTCC2594]
 gi|84786448|gb|ABC62630.1| hypothetical protein ELI_02690 [Erythrobacter litoralis HTCC2594]
          Length = 167

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 85/133 (63%), Gaps = 1/133 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++DLGTK IG A SD G RFA     L R +  +   +L   +++ N+A  ++GLP NM+
Sbjct: 27  ALDLGTKTIGTATSDAGWRFATAGKTLPRGRFGKDKAKLQEIVSSRNVAGLVLGLPRNMD 86

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSEGPR  ++RA+  N+ +    +P + WDER +T SA+  +I  ++SR KR +K+DS A
Sbjct: 87  GSEGPRAQASRAYARNLAE-AFGLPVLLWDERWSTQSAESAMIGQDMSRAKRAEKIDSHA 145

Query: 141 AALILQEVLDRIS 153
           AA+ LQ  LD ++
Sbjct: 146 AAIFLQAALDTLA 158


>gi|23015713|ref|ZP_00055482.1| COG0816: Predicted endonuclease involved in recombination (possible
           Holliday junction resolvase in Mycoplasmas and B.
           subtilis) [Magnetospirillum magnetotacticum MS-1]
          Length = 159

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 95/150 (63%), Gaps = 1/150 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M IL   +L+ SL  +Q +  +DLG+K IGLA+SD  R  A P   + R K T+ A +LL
Sbjct: 5   MPILSPVELLGSLSRDQRLLGLDLGSKTIGLALSDVSRTIATPFDTIRRTKFTKDAEQLL 64

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  +++   ++GLP+ M+G EGPR  S R+F  N+  R   +P  +WDERL+T +  +
Sbjct: 65  AIVDKQDVGGLVLGLPVEMDGFEGPRCQSVRSFAANLA-RLRDMPIAYWDERLSTSAVTR 123

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLD 150
            L++ + SRK+R + VD +AAA ILQ +LD
Sbjct: 124 TLLEADSSRKRRAEVVDKMAAAYILQGLLD 153


>gi|103486415|ref|YP_615976.1| Holliday junction resolvase YqgF [Sphingopyxis alaskensis RB2256]
 gi|124107445|sp|Q1GUM9|RUVX_SPHAL RecName: Full=Putative Holliday junction resolvase
 gi|98976492|gb|ABF52643.1| Holliday junction resolvase YqgF [Sphingopyxis alaskensis RB2256]
          Length = 152

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 89/146 (60%), Gaps = 2/146 (1%)

Query: 8   DLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN 67
           D   +L     +A +D+GTK IG+A+ D G  FA P   +VRK+ +     L + +  + 
Sbjct: 8   DFAAALPNGGRLAGLDVGTKTIGVALCDAGWSFASPDKTIVRKRFSADLDALKALVAGQA 67

Query: 68  IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV 127
           +   ++GLPLNM+GS+ PR  STRAF  N+    + +P + WDER +T + ++ +I  +V
Sbjct: 68  VVGLVVGLPLNMDGSDSPRTQSTRAFARNLA--PLGLPVLLWDERWSTAAVERAMIAADV 125

Query: 128 SRKKRIQKVDSIAAALILQEVLDRIS 153
           SR KR +++DS AAA ILQ  +D ++
Sbjct: 126 SRAKRAERIDSAAAAFILQGAIDAMT 151


>gi|299135137|ref|ZP_07028328.1| Holliday junction resolvase YqgF [Afipia sp. 1NLS2]
 gi|298590114|gb|EFI50318.1| Holliday junction resolvase YqgF [Afipia sp. 1NLS2]
          Length = 165

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 64/153 (41%), Positives = 89/153 (58%), Gaps = 1/153 (0%)

Query: 3   ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSF 62
           IL + +      P   +  +DLGTK IG+A+SDP RR A     + RK  T+ A ELL  
Sbjct: 10  ILPLTEAATHWTPRGALIGLDLGTKTIGVAVSDPDRRLATGVTTIQRKTFTKDAAELLRI 69

Query: 63  ITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL 122
                 + F++GLP+NM+GSEGPR  STRAF  N   +   +    WDERL+T + ++ L
Sbjct: 70  AGERASSGFVLGLPINMDGSEGPRAQSTRAFARNF-SKLTDLAIGLWDERLSTAAVEREL 128

Query: 123 IDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           I  +VSR +R + +D  AA  ILQ  LDR++ L
Sbjct: 129 IANDVSRARRAEVIDEHAAIFILQGALDRLAAL 161


>gi|170746909|ref|YP_001753169.1| Holliday junction resolvase YqgF [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653431|gb|ACB22486.1| Holliday junction resolvase YqgF [Methylobacterium radiotolerans
           JCM 2831]
          Length = 170

 Score =  120 bits (300), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 83/130 (63%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            IDLGTK IGLA+SD GR+ A P   + R K T  A  L +      +   ++GLPLNM+
Sbjct: 21  GIDLGTKTIGLALSDLGRQIATPLETIRRVKFTPDAQRLAALCRQHAVGGLVVGLPLNMD 80

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSEGPRV STRAF+ N+    + +P VF+DERL+T    + LI+ + SR +R Q VD +A
Sbjct: 81  GSEGPRVQSTRAFMRNLAP-ILPLPHVFFDERLSTAVVTRALIEADASRARRGQLVDKLA 139

Query: 141 AALILQEVLD 150
           AA ILQ  LD
Sbjct: 140 AAYILQGCLD 149


>gi|302382947|ref|YP_003818770.1| Holliday junction resolvase YqgF [Brevundimonas subvibrioides ATCC
           15264]
 gi|302193575|gb|ADL01147.1| Holliday junction resolvase YqgF [Brevundimonas subvibrioides ATCC
           15264]
          Length = 173

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 89/151 (58%), Gaps = 2/151 (1%)

Query: 3   ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSF 62
           +L + DL  +  P+     +DLG   IG+A SD  R  A P   + + K T  A  L   
Sbjct: 11  VLNLTDLAAACPPDTAWMGLDLGETTIGVATSDTSRMIASPLELIRKSKFTAEAHALFRL 70

Query: 63  ITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL 122
           +    ++A +IGLP+NM+G+EGPR  S RAF  N+ DR   V   FWDERL+T + ++ L
Sbjct: 71  MDHRKVSALVIGLPVNMDGTEGPRAQSCRAFARNL-DRIRPVNVAFWDERLSTSAVERFL 129

Query: 123 ID-MNVSRKKRIQKVDSIAAALILQEVLDRI 152
           ID +++SRK+R   VD  AAA ILQ  LDR+
Sbjct: 130 IDELDLSRKRRAGVVDRTAAAWILQGALDRV 160


>gi|197104788|ref|YP_002130165.1| putative Holliday junction resolvase [Phenylobacterium zucineum
           HLK1]
 gi|226731635|sp|B4R966|RUVX_PHEZH RecName: Full=Putative Holliday junction resolvase
 gi|196478208|gb|ACG77736.1| putative Holliday junction resolvase [Phenylobacterium zucineum
           HLK1]
          Length = 156

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 94/156 (60%), Gaps = 1/156 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ + DL     PN P+  +DLG K IG+A+SD  R  A P   + + K T  A  L 
Sbjct: 1   MAVVDLIDLPAIAPPNTPLVGLDLGEKTIGVAVSDATRMVASPLGLIRKTKFTDDAKALF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + +   +  +IGLP+NM+G+EG R  S RAF  N++  +  +P  FWDER++T++  +
Sbjct: 61  KLMESRRASGIVIGLPVNMDGTEGTRCQSNRAFARNLLRLREDLPIAFWDERMSTMAVNR 120

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           +L+ + +++R +R   VD +AAA ILQ  LDR+  L
Sbjct: 121 MLVGEADMTRARRADVVDKMAAAWILQGALDRLRNL 156


>gi|296284265|ref|ZP_06862263.1| Holliday junction resolvase-like protein [Citromicrobium
           bathyomarinum JL354]
          Length = 162

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 87/142 (61%), Gaps = 1/142 (0%)

Query: 9   LVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENI 68
           L ++L     +  +DLGTK IG+A+ D G RFA     L R K  +   EL   I   +I
Sbjct: 14  LAETLPDGGALIGLDLGTKTIGIAVCDAGWRFASALKTLPRGKFGRDRDELRKLIEARSI 73

Query: 69  AAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVS 128
              +IGLP NM+GSEGPR  ++RA+  N+ +    +P + WDER +T SA+  +I ++VS
Sbjct: 74  RGIVIGLPRNMDGSEGPRAQASRAYARNLAE-AFGLPVLLWDERWSTKSAEDAMIGLDVS 132

Query: 129 RKKRIQKVDSIAAALILQEVLD 150
           R+KR +++D+ AA +ILQ  +D
Sbjct: 133 RRKRAERIDAEAATIILQGAID 154


>gi|84684665|ref|ZP_01012565.1| hypothetical protein 1099457000245_RB2654_02114 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667000|gb|EAQ13470.1| hypothetical protein RB2654_02114 [Rhodobacterales bacterium
           HTCC2654]
          Length = 155

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 86/138 (62%), Gaps = 2/138 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVR-KKVTQTALELLSFITTENIAAFIIGLPL 77
           +A +D G K IG+A+SD  R+ A P   + R KK TQ A  L++ +    I+  ++GLP 
Sbjct: 19  LAGLDYGDKTIGVAVSDGMRQVATPLDTIRRGKKFTQDAEALMAILDERAISGLVLGLPR 78

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NM+G+EGPR   TRAF  N + R    P  FWDERL+TV+A++ L++ + SR KR   +D
Sbjct: 79  NMDGTEGPRCQKTRAFARN-LSRLTERPITFWDERLSTVAAERALLEADTSRAKRSGVID 137

Query: 138 SIAAALILQEVLDRISFL 155
            +AA  ILQ  LDR+  L
Sbjct: 138 HVAAGYILQGALDRMRHL 155


>gi|332186801|ref|ZP_08388543.1| uncharacterized family protein [Sphingomonas sp. S17]
 gi|332013134|gb|EGI55197.1| uncharacterized family protein [Sphingomonas sp. S17]
          Length = 154

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 82/130 (63%), Gaps = 3/130 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+GTK IG A+ D G  FA P   + R K T+    L++ I  + +   +IGLPLN++
Sbjct: 23  GLDVGTKTIGTALCDAGWSFASPATLVRRTKFTKDKEALIAMIAQQGVKGLVIGLPLNLD 82

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSE PR  STRAF  N  D     P + WDER +TV+ ++ +I+ ++SR KR +++D++A
Sbjct: 83  GSESPRSQSTRAFARNCAD---LGPILLWDERWSTVAVERTMIEQDMSRAKRAERIDNLA 139

Query: 141 AALILQEVLD 150
           AA ILQ  +D
Sbjct: 140 AAHILQAAID 149


>gi|85716409|ref|ZP_01047381.1| Holliday junction resolvase YqgF [Nitrobacter sp. Nb-311A]
 gi|85696766|gb|EAQ34652.1| Holliday junction resolvase YqgF [Nitrobacter sp. Nb-311A]
          Length = 166

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 86/142 (60%), Gaps = 1/142 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +DLGT+ IG+A+SDP RR A     + RK  T  A  LL+     +   FI+GLP+N
Sbjct: 21  LVGLDLGTRTIGVAVSDPDRRLATGVETIRRKAFTADAARLLAIAGERHAKGFILGLPIN 80

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+GSEGPR  STRAF  N+  R   +    WDERL+T + ++ LI +++SR +R + +D 
Sbjct: 81  MDGSEGPRAQSTRAFARNLA-RLTDLAIGLWDERLSTAAVERELIGLDMSRARRARVIDE 139

Query: 139 IAAALILQEVLDRISFLESSKG 160
            AA  ILQ  LDR++    S G
Sbjct: 140 HAAIFILQGALDRLAAQRRSSG 161


>gi|159043613|ref|YP_001532407.1| Holliday junction resolvase-like protein [Dinoroseobacter shibae
           DFL 12]
 gi|157911373|gb|ABV92806.1| holliday junction resolvase YqgF [Dinoroseobacter shibae DFL 12]
          Length = 163

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 85/140 (60%), Gaps = 1/140 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            + +  +DLGT  IG+A+SD     A P   + RKK    A  L + +   ++   I+GL
Sbjct: 18  GRALMGLDLGTATIGVAVSDLMWSVATPLETVKRKKFGLDAARLEALMDARDVGGLILGL 77

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NM+GSEGPR  STRAF  N   R+  +P  FWDERL+TV+A++ L++ + SR +R + 
Sbjct: 78  PRNMDGSEGPRAQSTRAFARNFTARRP-IPIAFWDERLSTVAAERALLEADTSRARRAEV 136

Query: 136 VDSIAAALILQEVLDRISFL 155
           +D +AA+ ILQ  LDR   +
Sbjct: 137 IDHVAASYILQGALDRFGHM 156


>gi|91977491|ref|YP_570150.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris BisB5]
 gi|123735326|sp|Q135J0|RUVX_RHOPS RecName: Full=Putative Holliday junction resolvase
 gi|91683947|gb|ABE40249.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris BisB5]
          Length = 160

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 81/135 (60%), Gaps = 1/135 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLGTK IG+A+SDP R+ A     + R   T  A  +L+     +   F++GLPLNM+
Sbjct: 23  GLDLGTKTIGVAVSDPDRKLATGIETVARTAFTADAKRVLALAAERSACGFVLGLPLNMD 82

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSEGPR  STRAF  N   R   +P   WDERL+T + ++ LI  +VSR KR + +D  A
Sbjct: 83  GSEGPRAQSTRAFARNFA-RLTELPIGLWDERLSTAAVERALIANDVSRAKRAKIIDEHA 141

Query: 141 AALILQEVLDRISFL 155
           A  ILQ  LDR+  L
Sbjct: 142 AIYILQGALDRLVAL 156


>gi|16126678|ref|NP_421242.1| hypothetical protein CC_2439 [Caulobacter crescentus CB15]
 gi|221235457|ref|YP_002517894.1| endonuclease involved in recombination [Caulobacter crescentus
           NA1000]
 gi|32130061|sp|Q9A5K8|RUVX_CAUCR RecName: Full=Putative Holliday junction resolvase
 gi|254767503|sp|B8GZJ7|RUVX_CAUCN RecName: Full=Putative Holliday junction resolvase
 gi|13423984|gb|AAK24410.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220964630|gb|ACL95986.1| endonuclease involved in recombination [Caulobacter crescentus
           NA1000]
          Length = 156

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 92/156 (58%), Gaps = 1/156 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +L IED   +L     +  +D G K IG+A+SD  R  A P   + + K ++ A +L 
Sbjct: 1   MPVLDIEDFADALPQYAAVVGLDPGEKTIGVAVSDVTRTVASPLALIEKTKFSKDAEQLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + +    A +IGLP+NM+G+EG R  S RA   N++  K  +P  FWDERL+T +  +
Sbjct: 61  KLMDSRGAVAIVIGLPMNMDGTEGVRCQSNRALGRNLLRLKPDLPITFWDERLSTAAVTR 120

Query: 121 ILID-MNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           +LID  ++SRK+R + VD +AA  ILQ  L+R+  L
Sbjct: 121 VLIDEHDISRKRRDEVVDKMAAGWILQGALERLRGL 156


>gi|220923238|ref|YP_002498540.1| Holliday junction resolvase YqgF [Methylobacterium nodulans ORS
           2060]
 gi|219947845|gb|ACL58237.1| Holliday junction resolvase YqgF [Methylobacterium nodulans ORS
           2060]
          Length = 163

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 62/135 (45%), Positives = 84/135 (62%), Gaps = 1/135 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLGTK IGLA+SD GRR A P   + R K T  A +L        +   +IGLPLNM+
Sbjct: 22  GLDLGTKTIGLALSDVGRRIASPLETIRRVKFTPDAQKLAGIARQHGVGGLVIGLPLNMD 81

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSEGPR  STRAFV N+    + +P + +DERL+T +  + L++ + SR +R   VD +A
Sbjct: 82  GSEGPRAQSTRAFVRNLAP-ILPLPVLLFDERLSTAAVTRTLLEADASRARRGDLVDKLA 140

Query: 141 AALILQEVLDRISFL 155
           AA ILQ  LD ++ L
Sbjct: 141 AAYILQGCLDVLAGL 155


>gi|170742466|ref|YP_001771121.1| Holliday junction resolvase YqgF [Methylobacterium sp. 4-46]
 gi|168196740|gb|ACA18687.1| Holliday junction resolvase YqgF [Methylobacterium sp. 4-46]
          Length = 168

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 61/139 (43%), Positives = 86/139 (61%), Gaps = 1/139 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLGTK IGLA+SD GRR A P   + R K T  A  L +      +   ++G PLNM+
Sbjct: 22  GLDLGTKTIGLALSDVGRRIASPLETIRRVKFTPDARRLAAIAAEHGVGGLVVGHPLNMD 81

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSEGPR  STRAFV N+    + +P + +DERL+T +  + L++ + SR +R + VD +A
Sbjct: 82  GSEGPRAQSTRAFVRNLAP-ILPLPVLLFDERLSTAAVTRTLLEADASRARRGKLVDKLA 140

Query: 141 AALILQEVLDRISFLESSK 159
           AA ILQ  LD ++ LE  +
Sbjct: 141 AAYILQGCLDVLAGLEPEE 159


>gi|75676194|ref|YP_318615.1| Holliday junction resolvase YqgF [Nitrobacter winogradskyi Nb-255]
 gi|146325584|sp|Q3SR28|RUVX_NITWN RecName: Full=Putative Holliday junction resolvase
 gi|74421064|gb|ABA05263.1| Holliday junction resolvase YqgF [Nitrobacter winogradskyi Nb-255]
          Length = 163

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 63/159 (39%), Positives = 89/159 (55%), Gaps = 1/159 (0%)

Query: 2   SILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS 61
           S+L + +          +  +DLGTK IG+A+SDP RR A     + RK  T  A  LL+
Sbjct: 4   SVLPLVEAAAHWPARGALVGLDLGTKTIGVAVSDPDRRLATGVETIRRKTFTADAARLLA 63

Query: 62  FITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQI 121
                    FI+GLP+NM+GSEGPR  STRAF  N+  R        WDERL+T + ++ 
Sbjct: 64  IAGERRAEGFILGLPINMDGSEGPRAQSTRAFARNLA-RLTDFAIGLWDERLSTAAVERE 122

Query: 122 LIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           LI +++SR +R + +D  AA  ILQ  LDR++    + G
Sbjct: 123 LIGLDMSRARRAKVIDEHAAIFILQGALDRLATQRRTSG 161


>gi|295690146|ref|YP_003593839.1| Holliday junction resolvase YqgF [Caulobacter segnis ATCC 21756]
 gi|295432049|gb|ADG11221.1| Holliday junction resolvase YqgF [Caulobacter segnis ATCC 21756]
          Length = 156

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 91/156 (58%), Gaps = 1/156 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +L IED   +L    P+  +D G K IG+A+SD  R  A P   + + K ++ A  L 
Sbjct: 1   MPVLDIEDFAAALPQYAPVVGLDPGEKTIGVAVSDVTRTVASPLALIEKTKFSKDAEALF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + +      +IGLP+NM+G+EG R  S RA   N++  K  +P  FWDERL+T +  +
Sbjct: 61  KLMDSRGAVGIVIGLPMNMDGTEGVRCQSNRALGRNLLRLKPDLPITFWDERLSTAAVTR 120

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           +LI + +V+RK+R + VD +AA  ILQ  L+R+  L
Sbjct: 121 VLIEEHDVNRKRRAEVVDKMAAGWILQGALERLRGL 156


>gi|118597211|sp|Q28QB4|RUVX_JANSC RecName: Full=Putative Holliday junction resolvase
          Length = 160

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 61/154 (39%), Positives = 92/154 (59%), Gaps = 2/154 (1%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           +++   ++ P + +  +DLGTK IG+A+SD     A     + RKK    A  L   I  
Sbjct: 6   LDEFAGAVPPMRGLIGLDLGTKTIGVALSDRLLTSASALETVKRKKFGVDADALAGLIAK 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRK--VYVPFVFWDERLTTVSAQQILI 123
             +   I+GLP NM+GSEGPR  +TRAF  N+  R    ++   FWDERL+TV+A++ LI
Sbjct: 66  HEVGGIILGLPRNMDGSEGPRAQATRAFALNLSRRGDFAHLALGFWDERLSTVAAERALI 125

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
             + SRK+R + +D++AA+ ILQ  LDR+  L +
Sbjct: 126 AADTSRKRRSEVIDAVAASYILQGALDRLRHLRA 159


>gi|39936176|ref|NP_948452.1| Holliday junction resolvase-like protein [Rhodopseudomonas
           palustris CGA009]
 gi|192291893|ref|YP_001992498.1| Holliday junction resolvase-like protein [Rhodopseudomonas
           palustris TIE-1]
 gi|62900984|sp|Q6N569|RUVX_RHOPA RecName: Full=Putative Holliday junction resolvase
 gi|226731645|sp|B3Q9X0|RUVX_RHOPT RecName: Full=Putative Holliday junction resolvase
 gi|39650031|emb|CAE28554.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
 gi|192285642|gb|ACF02023.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris TIE-1]
          Length = 160

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 84/139 (60%), Gaps = 1/139 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLGTK IG+A SDP R+ A     + RK  T  A  LL+         F++GLPLNM+
Sbjct: 23  GLDLGTKTIGVAASDPDRKLATGVETIARKAFTADAARLLALAAERTACGFVLGLPLNMD 82

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSEGPR  STRAF  N+  R   +P   WDERL+T + ++ LI  +VSR KR + +D  A
Sbjct: 83  GSEGPRAQSTRAFARNL-SRLTELPIGLWDERLSTAAVERELIANDVSRAKRAKVIDEHA 141

Query: 141 AALILQEVLDRISFLESSK 159
           A  ILQ  LDR++ L  ++
Sbjct: 142 AIFILQGALDRLAALRRAE 160


>gi|149185993|ref|ZP_01864308.1| hypothetical protein ED21_24706 [Erythrobacter sp. SD-21]
 gi|148830554|gb|EDL48990.1| hypothetical protein ED21_24706 [Erythrobacter sp. SD-21]
          Length = 162

 Score =  115 bits (287), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 80/128 (62%), Gaps = 1/128 (0%)

Query: 26  TKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMNGSEGP 85
           TK IG+A  D G RFA     + R K T    +L   +T  +IA  ++GLP NM+G+EGP
Sbjct: 32  TKTIGVATCDAGWRFATAGKTIERSKFTTDCGKLREIVTARSIAGLVVGLPRNMDGTEGP 91

Query: 86  RVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALIL 145
           R  ++RA+  N+  R   +P + WDER +T SA+  +I  ++SR KR +K+DS AAA+IL
Sbjct: 92  RAQASRAYAKNLA-RAFGLPVLLWDERWSTSSAESAMIGQDMSRAKRAEKIDSHAAAVIL 150

Query: 146 QEVLDRIS 153
           Q  +D ++
Sbjct: 151 QGAIDTLA 158


>gi|167645483|ref|YP_001683146.1| Holliday junction resolvase YqgF [Caulobacter sp. K31]
 gi|189046089|sp|B0T191|RUVX_CAUSK RecName: Full=Putative Holliday junction resolvase
 gi|167347913|gb|ABZ70648.1| Holliday junction resolvase YqgF [Caulobacter sp. K31]
          Length = 164

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 94/161 (58%), Gaps = 1/161 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +L I +   ++    PI  +D G K IG+A+SD     A P   + + K ++ A  L 
Sbjct: 1   MPVLDIAEFAAAIPDYLPIVGLDPGEKTIGVAVSDVTLTVASPLALIKKTKFSEDAATLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + +   A  +IGLP+NM+G+EG R  S RA   N++  + ++P  FWDERL+T +  +
Sbjct: 61  QLMGSRKAAGIVIGLPMNMDGTEGVRCQSNRALGRNLLRLQPHIPITFWDERLSTAAVTR 120

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           +LI + +V+RK+R + VD +AAA ILQ  L+R+  +  + G
Sbjct: 121 VLIEEHDVNRKRRAEVVDKMAAAWILQGALERMRGIAEAAG 161


>gi|294084181|ref|YP_003550939.1| putative Holliday junction resolvase [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663754|gb|ADE38855.1| Putative Holliday junction resolvase [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 159

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 88/152 (57%), Gaps = 1/152 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I  + D+ +S+   Q +  +D+G K IGLA+SD G + A P   L R K T    EL 
Sbjct: 1   MPICKLNDVKQSISDGQRLLGLDIGKKTIGLALSDAGLKIATPVKILYRTKFTPDVAELF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +  +N+   ++G P+NM+GS GPR  STR F + ++ R   VP  F DERL+T + + 
Sbjct: 61  KLVDEQNVGGLVLGWPVNMDGSTGPRCDSTRDFAYALM-RIRDVPVFFQDERLSTQAVES 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRI 152
            +I  +++R KR  + D++AA  ILQ  LD I
Sbjct: 120 AMIAADMTRAKRAVRRDALAAGWILQSALDTI 151


>gi|144897944|emb|CAM74808.1| Holliday junction resolvase [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 163

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 90/150 (60%), Gaps = 1/150 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M IL I +L  +L  +  +  +DLGTK IGLA+SD     A P   + R K T+ A  L 
Sbjct: 1   MPILPIAELKTALPRHARLMGLDLGTKTIGLALSDVRLSIASPFDTIRRTKFTKDAEALF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +     A  ++GLP+ M+G+EG R  STRAF  N++  +  +P VFWDERL+T +  +
Sbjct: 61  AALDKHEAAGIVLGLPVEMDGTEGARCQSTRAFARNLLGLR-DLPIVFWDERLSTAAVTR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLD 150
            L++ + SR +R + VD +AAA ILQ  LD
Sbjct: 120 TLLEADSSRARRAEVVDKMAAAYILQGALD 149


>gi|329851398|ref|ZP_08266155.1| hypothetical UPF0081 family protein [Asticcacaulis biprosthecum
           C19]
 gi|328840244|gb|EGF89816.1| hypothetical UPF0081 family protein [Asticcacaulis biprosthecum
           C19]
          Length = 157

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 61/153 (39%), Positives = 87/153 (56%), Gaps = 2/153 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ I +L   L     +  +DLG K IG+A+SD     A P   + + K T  A  L 
Sbjct: 1   MAVIDITELKAGLPARHALLGLDLGEKTIGVAVSDISLTLASPLELIRKTKFTHEAERLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +     A  +IGLP+NM+G+EGPR  S RAF  N++ R   VP  FWDER ++ +  +
Sbjct: 61  HLMQAREAAGLVIGLPVNMDGTEGPRAQSCRAFARNLL-RLRDVPIAFWDERWSSAAMNR 119

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLDRI 152
            LI + ++SR KR + +D  AAA ILQ  LDRI
Sbjct: 120 FLIEEADLSRAKRAEVIDRNAAAYILQGALDRI 152


>gi|154247845|ref|YP_001418803.1| Holliday junction resolvase YqgF [Xanthobacter autotrophicus Py2]
 gi|154161930|gb|ABS69146.1| Holliday junction resolvase YqgF [Xanthobacter autotrophicus Py2]
          Length = 176

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 83/148 (56%), Gaps = 1/148 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           + D+   L P   +  +DLGTK IG+A  DP RR A     + R K T  A  LL+    
Sbjct: 13  LADIAPLLPPRGALLGLDLGTKTIGVASCDPDRRVATVVETVQRTKFTADAQRLLALAAE 72

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
                F++GLPLNM+ SEGPR  ++RAF  N+  R   +P   WDERL+T + ++ LI  
Sbjct: 73  RRAVGFVLGLPLNMDASEGPRAQASRAFARNLA-RLTALPIALWDERLSTAAVERALISA 131

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRIS 153
           +VSR +R   VD  AAA IL+  L  +S
Sbjct: 132 DVSRARRAAVVDQHAAAFILEGALGFLS 159


>gi|89054672|ref|YP_510123.1| Holliday junction resolvase YqgF [Jannaschia sp. CCS1]
 gi|88864221|gb|ABD55098.1| Holliday junction resolvase YqgF [Jannaschia sp. CCS1]
          Length = 145

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLGTK IG+A+SD     A     + RKK    A  L   I    +   I+GLP NM+
Sbjct: 6   GLDLGTKTIGVALSDRLLTSASALETVKRKKFGVDADALAGLIAKHEVGGIILGLPRNMD 65

Query: 81  GSEGPRVHSTRAFVHNMIDRK--VYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           GSEGPR  +TRAF  N+  R    ++   FWDERL+TV+A++ LI  + SRK+R + +D+
Sbjct: 66  GSEGPRAQATRAFALNLSRRGDFAHLALGFWDERLSTVAAERALIAADTSRKRRSEVIDA 125

Query: 139 IAAALILQEVLDRISFLES 157
           +AA+ ILQ  LDR+  L +
Sbjct: 126 VAASYILQGALDRLRHLRA 144


>gi|254460515|ref|ZP_05073931.1| conserved hypothetical protein TIGR00250 [Rhodobacterales bacterium
           HTCC2083]
 gi|206677104|gb|EDZ41591.1| conserved hypothetical protein TIGR00250 [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 160

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 93/150 (62%), Gaps = 1/150 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           I+D   +L   + +  +DLGTK IG+++SD     A P   + R K T  A  L   I  
Sbjct: 6   IDDFAAALPRARALVGLDLGTKTIGVSVSDGLLSVASPLETIKRTKYTADAARLEQIIEA 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             I   ++GLP NM+GSEGPR  STRAF  N+  R+  +P  +WDERL+TV+A++ L+  
Sbjct: 66  RYIGGIVLGLPFNMDGSEGPRCQSTRAFARNLA-RQSELPITYWDERLSTVAAERALLAA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           + SR++R + +D++AAA ILQ  LDR+S +
Sbjct: 125 DASRRRRAEVIDNVAAAYILQGALDRLSHI 154


>gi|148259884|ref|YP_001234011.1| Holliday junction resolvase YqgF [Acidiphilium cryptum JF-5]
 gi|167012685|sp|A5FWW0|RUVX_ACICJ RecName: Full=Putative Holliday junction resolvase
 gi|146401565|gb|ABQ30092.1| Holliday junction resolvase YqgF [Acidiphilium cryptum JF-5]
          Length = 158

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 89/150 (59%), Gaps = 1/150 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++  + DL  +L  N  +  +D G+K IG+A+SD GRR A P   + R K+ + A  +L
Sbjct: 1   MTLFNLTDLASTLPRNARLIGLDPGSKIIGIALSDVGRRLATPYGAMKRGKLAEAAATIL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                E  AA IIGLPL+M+GS GP   + R + H  I R+  +P    DERL++ +  +
Sbjct: 61  DIARKEGAAALIIGLPLSMDGSIGPAAQAARDWAH-AIARETGLPVAMMDERLSSAAVNR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLD 150
            LI+ +V+R KR  +VD+ AA+ +LQ  LD
Sbjct: 120 ALIEADVTRAKRAGRVDAAAASYMLQGALD 149


>gi|326403186|ref|YP_004283267.1| putative Holliday junction resolvase [Acidiphilium multivorum
           AIU301]
 gi|325050047|dbj|BAJ80385.1| putative Holliday junction resolvase [Acidiphilium multivorum
           AIU301]
          Length = 158

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 89/150 (59%), Gaps = 1/150 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++  + DL  +L  N  +  +D G+K IG+A+SD GRR A P   + R K+  +A  +L
Sbjct: 1   MTLFNLTDLASTLPRNARLIGLDPGSKIIGIALSDVGRRLATPYGAMKRGKLADSAATIL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                E  AA IIGLPL+M+GS GP   + R + H  I R+  +P    DERL++ +  +
Sbjct: 61  DIARKEGAAALIIGLPLSMDGSIGPAAQAARDWAH-AIARETGLPVAMMDERLSSAAVNR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLD 150
            LI+ +V+R KR  +VD+ AA+ +LQ  LD
Sbjct: 120 ALIEADVTRAKRAGRVDAAAASYMLQGALD 149


>gi|163852734|ref|YP_001640777.1| Holliday junction resolvase YqgF [Methylobacterium extorquens PA1]
 gi|163664339|gb|ABY31706.1| Holliday junction resolvase YqgF [Methylobacterium extorquens PA1]
          Length = 160

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/130 (44%), Positives = 83/130 (63%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLGTK IG+A+SD GR+ A P   + R K T     ++S   T  +   +IGLPLNM+
Sbjct: 16  GLDLGTKTIGIALSDVGRQIASPLETIRRVKFTPDVARIVSLCATHAVGGLVIGLPLNMD 75

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSEGPR  S+R+F  N+    + +P +F+DERL+T +  + LI+ + SR +R + VD +A
Sbjct: 76  GSEGPRAQSSRSFARNLK-PLLPLPVLFFDERLSTAAVTRTLIEADASRARRGELVDKLA 134

Query: 141 AALILQEVLD 150
           AA ILQ  LD
Sbjct: 135 AAYILQSCLD 144


>gi|218531575|ref|YP_002422391.1| Holliday junction resolvase YqgF [Methylobacterium chloromethanicum
           CM4]
 gi|218523878|gb|ACK84463.1| Holliday junction resolvase YqgF [Methylobacterium chloromethanicum
           CM4]
          Length = 165

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/130 (44%), Positives = 83/130 (63%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLGTK IG+A+SD GR+ A P   + R K T     ++S   T  +   +IGLPLNM+
Sbjct: 21  GLDLGTKTIGIALSDVGRQIASPLETIRRVKFTPDVARIVSLCATHAVGGLVIGLPLNMD 80

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSEGPR  S+R+F  N+    + +P +F+DERL+T +  + LI+ + SR +R + VD +A
Sbjct: 81  GSEGPRAQSSRSFARNLK-PLLPLPVLFFDERLSTAAVTRTLIEADASRARRGELVDKLA 139

Query: 141 AALILQEVLD 150
           AA ILQ  LD
Sbjct: 140 AAYILQSCLD 149


>gi|304320050|ref|YP_003853693.1| putative endonuclease [Parvularcula bermudensis HTCC2503]
 gi|303298953|gb|ADM08552.1| putative endonuclease [Parvularcula bermudensis HTCC2503]
          Length = 158

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 84/139 (60%), Gaps = 1/139 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P  P+  +D G+K IG+A+S P RR A P   + R K  + A  L +      +   IIG
Sbjct: 13  PKGPLLGLDPGSKTIGVAVSTPERRLATPVTVIRRTKFGKDAEALFALAEARGVVGLIIG 72

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           +PLNM+GSEGPR  S R F  N+  R   +P  +WDERL++V+A++ L+  + SR +R +
Sbjct: 73  VPLNMDGSEGPRAQSARTFGRNLSQRG-PLPVAYWDERLSSVAAERALLATDTSRARRAE 131

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D+ AA  ILQ  LDR++
Sbjct: 132 VIDAHAATHILQGALDRLA 150


>gi|254294342|ref|YP_003060365.1| Holliday junction resolvase YqgF [Hirschia baltica ATCC 49814]
 gi|254042873|gb|ACT59668.1| Holliday junction resolvase YqgF [Hirschia baltica ATCC 49814]
          Length = 150

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 60/154 (38%), Positives = 93/154 (60%), Gaps = 6/154 (3%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+IL ++     L P  P+  +D GTK IG+A +D  R  A P   + + K    AL  L
Sbjct: 1   MAILELD----QLPPRGPLLGLDPGTKTIGIAAADGLRMIASPVETIKKGKKLAPALTRL 56

Query: 61  SFITTENIA-AFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQ 119
             +  + +    +IGLP+NM+GS GPRV + RA   N+++++  VP  FWDERL+T + +
Sbjct: 57  FELYDDRVCVGLVIGLPVNMDGSHGPRVQAVRALARNILEKR-DVPIAFWDERLSTAAVE 115

Query: 120 QILIDMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
           + L++ + SR KR + +D +AAA ILQ  +DR+S
Sbjct: 116 RTLLEADTSRAKRAEVIDKMAAAYILQGAIDRLS 149


>gi|254562494|ref|YP_003069589.1| Holliday junction resolvase [Methylobacterium extorquens DM4]
 gi|254269772|emb|CAX25744.1| putative Holliday junction resolvase [Methylobacterium extorquens
           DM4]
          Length = 160

 Score =  111 bits (277), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/130 (43%), Positives = 83/130 (63%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLGTK IG+A+SD GR+ A P   + R K T     +++   T  +   +IGLPLNM+
Sbjct: 16  GLDLGTKTIGIALSDVGRQIASPLETIRRVKFTPDVARIVTLCATHAVGGLVIGLPLNMD 75

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSEGPR  S+R+F  N+    + +P +F+DERL+T +  + LI+ + SR +R + VD +A
Sbjct: 76  GSEGPRAQSSRSFARNLK-PLLPLPVLFFDERLSTAAVTRTLIEADASRARRGELVDKLA 134

Query: 141 AALILQEVLD 150
           AA ILQ  LD
Sbjct: 135 AAYILQSCLD 144


>gi|90423758|ref|YP_532128.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris
           BisB18]
 gi|146325601|sp|Q215X7|RUVX_RHOPB RecName: Full=Putative Holliday junction resolvase
 gi|90105772|gb|ABD87809.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris
           BisB18]
          Length = 163

 Score =  111 bits (277), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 82/138 (59%), Gaps = 1/138 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLGTK IG+A+SDP RR A     ++       A  LL      N   F++GLP+NM+
Sbjct: 23  GLDLGTKTIGVAVSDPDRRLATGVETIIHTAFKANAARLLLLAGQRNAVGFVLGLPINMD 82

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSEGPR  STRAF  N   R   +P   WDERL+T + ++ LI  +VSR KR + +D  A
Sbjct: 83  GSEGPRAQSTRAFARNFA-RLTDLPIGLWDERLSTSAVERELIANDVSRAKRAKVIDEHA 141

Query: 141 AALILQEVLDRISFLESS 158
           A  ILQ  LDR++ L ++
Sbjct: 142 AIFILQGALDRLTVLNAA 159


>gi|188582759|ref|YP_001926204.1| Holliday junction resolvase YqgF [Methylobacterium populi BJ001]
 gi|179346257|gb|ACB81669.1| Holliday junction resolvase YqgF [Methylobacterium populi BJ001]
          Length = 165

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 83/130 (63%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLGTK IG+A+SD GR+ A P   + R K T  A  +++      +   +IGLPLNM+
Sbjct: 21  GLDLGTKTIGIALSDVGRQIASPLETIRRVKFTPDAGRIVALCAAHGVGGLVIGLPLNMD 80

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSEGPR  S+R+F  N+    + +P +F+DERL+T +  + L++ + SR +R + VD +A
Sbjct: 81  GSEGPRAQSSRSFARNLR-PLLPLPVLFFDERLSTAAVTRTLLEADASRARRGEVVDKLA 139

Query: 141 AALILQEVLD 150
           AA ILQ  LD
Sbjct: 140 AAYILQSCLD 149


>gi|114570258|ref|YP_756938.1| Holliday junction resolvase YqgF [Maricaulis maris MCS10]
 gi|114340720|gb|ABI66000.1| Holliday junction resolvase YqgF [Maricaulis maris MCS10]
          Length = 151

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 88/155 (56%), Gaps = 6/155 (3%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I+ +EDL     P+ P+ ++D G+K IG+A     R  + P   + R K T  A  + 
Sbjct: 1   MPIVTLEDL-----PDGPLIALDPGSKTIGVAACGASRGLSTPVETIKRTKFTADAERVF 55

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +      A ++GLP+NM+GSEGPRV S RA   N++ R   +P  F DERL+T  A++
Sbjct: 56  ALLDERQAVAIVMGLPVNMDGSEGPRVQSVRAMARNLM-RLRDLPIAFQDERLSTFEAEE 114

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            LI   V R KR   +D+ AAA ILQ  LDR+  L
Sbjct: 115 KLISAGVRRDKRKDIIDAHAAANILQSALDRLEML 149


>gi|240140069|ref|YP_002964546.1| putative Holliday junction resolvase [Methylobacterium extorquens
           AM1]
 gi|240010043|gb|ACS41269.1| putative Holliday junction resolvase [Methylobacterium extorquens
           AM1]
          Length = 165

 Score =  110 bits (274), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 83/130 (63%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLGTK IG+A+SD GR+ A P   + R K T     +++   T  +   +IGLPLNM+
Sbjct: 21  GLDLGTKTIGIALSDVGRQIASPLETIRRVKFTPDVARIVTLCATHAVGGLVIGLPLNMD 80

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSEGPR  S+R+F  N+    + +P +F+DERL+T +  + L++ + SR +R + VD +A
Sbjct: 81  GSEGPRAQSSRSFARNLK-PLLPLPVLFFDERLSTAAVTRTLLEADASRARRGELVDKLA 139

Query: 141 AALILQEVLD 150
           AA ILQ  LD
Sbjct: 140 AAYILQSCLD 149


>gi|83594508|ref|YP_428260.1| Holliday junction resolvase YqgF [Rhodospirillum rubrum ATCC 11170]
 gi|146325602|sp|Q2RPH2|RUVX_RHORT RecName: Full=Putative Holliday junction resolvase
 gi|83577422|gb|ABC23973.1| Holliday junction resolvase YqgF [Rhodospirillum rubrum ATCC 11170]
          Length = 161

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 88/151 (58%), Gaps = 2/151 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I  ++    +L P +P+  +DLGT+ IG+A SD     A P   + R+K T    EL 
Sbjct: 1   MPICSLQTFADALPPGRPVLGLDLGTRTIGVATSDVRLTLATPIITIKRRKFTLDVQELF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +       A  ++GLP+ M+GSEGPR  +TRAF  N++  +  +P + WDERL+T +  +
Sbjct: 61  ALADGRAAAGLVLGLPVEMDGSEGPRCQATRAFARNLLALR-DLPVLLWDERLSTAAVNR 119

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLD 150
            L+ + +++R +R + VD  AAA ILQ  LD
Sbjct: 120 FLVGEADMTRARRAEVVDRAAAAYILQGALD 150


>gi|300022168|ref|YP_003754779.1| Holliday junction resolvase YqgF [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523989|gb|ADJ22458.1| Holliday junction resolvase YqgF [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 166

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/133 (42%), Positives = 83/133 (62%), Gaps = 1/133 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            ID GTK +GLA+SD  R  A     + R K T  A  LL+  T   +   ++GLP N++
Sbjct: 32  GIDGGTKTLGLALSDVTRTIASALETIRRTKFTADAARLLALATEHGVTGLVLGLPRNLD 91

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G+EGPR  +TRA   N+ ++   +P + WDERLTT  A+++LID + SRK+R + +D +A
Sbjct: 92  GTEGPRAQATRALARNL-NKLSPLPILLWDERLTTAEAERMLIDADQSRKRRGEVIDKLA 150

Query: 141 AALILQEVLDRIS 153
           A +ILQ  LDR+ 
Sbjct: 151 ATIILQSALDRLG 163


>gi|315500169|ref|YP_004088972.1| holliday junction resolvase yqgf [Asticcacaulis excentricus CB 48]
 gi|315418181|gb|ADU14821.1| Holliday junction resolvase YqgF [Asticcacaulis excentricus CB 48]
          Length = 167

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 89/163 (54%), Gaps = 11/163 (6%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+IL I +L  +L P + +  +DLG K IG+A+SD       P   + + K TQ A  LL
Sbjct: 1   MAILDITELKAALPPRRALIGLDLGEKTIGVAVSDISLSIGSPLELIKKSKFTQEAERLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVY----------VPFVFWD 110
             +     +  +IGLP+NM+G+EGPR  S RAF  N++               +P  FWD
Sbjct: 61  LLMKQREASGLVIGLPVNMDGTEGPRCQSVRAFARNLLRLPAEKFAAAGLEPDLPIAFWD 120

Query: 111 ERLTTVSAQQILI-DMNVSRKKRIQKVDSIAAALILQEVLDRI 152
           ER ++    + LI + +++R KR + +D  AAA ILQ  LDRI
Sbjct: 121 ERWSSSVMNRFLIEEADLTRAKRAEVIDRSAAAYILQGALDRI 163


>gi|304391702|ref|ZP_07373644.1| putative Holliday junction resolvase [Ahrensia sp. R2A130]
 gi|303295931|gb|EFL90289.1| putative Holliday junction resolvase [Ahrensia sp. R2A130]
          Length = 160

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/135 (42%), Positives = 78/135 (57%), Gaps = 1/135 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            IDLGTK IGLAISD     + P   + R K T     +L F T E ++  +IGLPLNM+
Sbjct: 24  GIDLGTKTIGLAISDENWAISSPVRTIKRTKFTPDVQAMLEFATAERVSGIVIGLPLNMD 83

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSEGPR  S+RAF  N+  R   +P   WDE L+T  A + +     ++ K   K+D++A
Sbjct: 84  GSEGPRAQSSRAFARNL-SRLTELPIQLWDESLSTSEALEGVSAKKAAQMKADGKLDALA 142

Query: 141 AALILQEVLDRISFL 155
           A+LILQ   D +  L
Sbjct: 143 ASLILQGCCDAMRAL 157


>gi|307292653|ref|ZP_07572499.1| Holliday junction resolvase YqgF [Sphingobium chlorophenolicum L-1]
 gi|306880719|gb|EFN11935.1| Holliday junction resolvase YqgF [Sphingobium chlorophenolicum L-1]
          Length = 156

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 82/130 (63%), Gaps = 2/130 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+GTK IGLA+ D G   A P   + R K ++  + L +F+  + +   +IGLPLN++
Sbjct: 23  GLDVGTKTIGLALCDAGWSIASPAHTVSRGKFSKDKIALAAFMEQQQVKGVVIGLPLNLD 82

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSE PR  ++RAF  N+ D  + +P +FWDER +T +  + L++ + SR +R + VD +A
Sbjct: 83  GSESPRSQASRAFGRNIAD--LGLPILFWDERWSTQAVTRTLLEADASRARREELVDKLA 140

Query: 141 AALILQEVLD 150
           A+ ILQ  +D
Sbjct: 141 ASYILQGAID 150


>gi|87198928|ref|YP_496185.1| Holliday junction resolvase YqgF [Novosphingobium aromaticivorans
           DSM 12444]
 gi|146325585|sp|Q2G9X2|RUVX_NOVAD RecName: Full=Putative Holliday junction resolvase
 gi|87134609|gb|ABD25351.1| Holliday junction resolvase YqgF [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 155

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 84/146 (57%), Gaps = 2/146 (1%)

Query: 8   DLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN 67
           ++  +L     +  +D GTK IG+A+ D   RFA     + R K      ++ + +    
Sbjct: 8   EMRDALAEGGSLIGLDTGTKTIGVALCDREWRFATAGTTIRRTKFAADKAQIRAIVAERG 67

Query: 68  IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV 127
           +   +IGLPLNM+GSE PR    RA   N+ D  + +P + WDER TT +A++ +I+ + 
Sbjct: 68  VKGIVIGLPLNMDGSESPRSQGARAMARNLED--LGLPILLWDERWTTQAAERAMIEQDF 125

Query: 128 SRKKRIQKVDSIAAALILQEVLDRIS 153
           SR KR +++DS AAALILQ  +D ++
Sbjct: 126 SRAKRAERIDSHAAALILQGAIDALA 151


>gi|294012198|ref|YP_003545658.1| putative Holliday junction resolvase [Sphingobium japonicum UT26S]
 gi|292675528|dbj|BAI97046.1| putative Holliday junction resolvase [Sphingobium japonicum UT26S]
          Length = 156

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 91/152 (59%), Gaps = 4/152 (2%)

Query: 1   MSILLIEDLV--KSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE 58
           MSIL  +     ++L     +  +D+GTK IG+A+ D G   A P   + R K ++  + 
Sbjct: 1   MSILTADRAAFREALPHGGRLIGLDVGTKTIGIALCDAGWSIASPAHTVSRGKFSKDKIA 60

Query: 59  LLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSA 118
           L +F+  + +   +IGLPLN++GSE PR  ++RAF  N+ D  + +P +FWDER +T + 
Sbjct: 61  LAAFMEQQQVKGVVIGLPLNLDGSESPRSQASRAFGRNIAD--LGLPILFWDERWSTQAV 118

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLD 150
            + L++ + SR +R + VD +AA+ ILQ  +D
Sbjct: 119 TRTLLEADASRARRGELVDKLAASYILQGAID 150


>gi|316933654|ref|YP_004108636.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris DX-1]
 gi|315601368|gb|ADU43903.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris DX-1]
          Length = 160

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 60/134 (44%), Positives = 80/134 (59%), Gaps = 1/134 (0%)

Query: 26  TKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMNGSEGP 85
           TK IG+A SDP RR A     + RK  T  A  LL+         F++GLPLNM+GSEGP
Sbjct: 28  TKTIGVAASDPDRRLATGVETIARKAFTADAARLLALAAERTACGFVLGLPLNMDGSEGP 87

Query: 86  RVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALIL 145
           R  STRAF  N+  +   +P   WDERL+T + ++ LI  +VSR KR + +D  AA  IL
Sbjct: 88  RAQSTRAFARNLA-KLTELPIGLWDERLSTAAVERELIANDVSRAKRAKVIDEHAAIFIL 146

Query: 146 QEVLDRISFLESSK 159
           Q  LDR++ L  ++
Sbjct: 147 QGALDRLAALRRAE 160


>gi|148553525|ref|YP_001261107.1| Holliday junction resolvase YqgF [Sphingomonas wittichii RW1]
 gi|167016511|sp|A5V3V3|RUVX_SPHWW RecName: Full=Putative Holliday junction resolvase
 gi|148498715|gb|ABQ66969.1| Holliday junction resolvase YqgF [Sphingomonas wittichii RW1]
          Length = 151

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 83/143 (58%), Gaps = 2/143 (1%)

Query: 8   DLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN 67
           D   +L     +A +D+GT+ IG+A+ D G   A P   ++R K +  A +L + +  + 
Sbjct: 8   DFRDALPDRGRLAGLDVGTRTIGVALCDAGWTIASPAETILRAKFSVDAAKLRALVAAQL 67

Query: 68  IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV 127
           +   +IGLPLN++GS+ PR  S RAF  N+      +P + WDER +T +  + L+D + 
Sbjct: 68  VKGLVIGLPLNLDGSDSPRTQSVRAFARNV--EPFGLPILLWDERWSTQAVTRTLLDADA 125

Query: 128 SRKKRIQKVDSIAAALILQEVLD 150
           SR +R + VD +AAA ILQ  +D
Sbjct: 126 SRARRAELVDKLAAAYILQGAID 148


>gi|163792874|ref|ZP_02186850.1| Holliday junction resolvase YqgF [alpha proteobacterium BAL199]
 gi|159181520|gb|EDP66032.1| Holliday junction resolvase YqgF [alpha proteobacterium BAL199]
          Length = 168

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 95/151 (62%), Gaps = 2/151 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+I    DL + L P   +  +D GTK IG+A+SD   R A P   + R+K ++ A E+L
Sbjct: 1   MAICKPADLHRLLGPGARLMGLDFGTKTIGIAVSDAALRVASPVTIIRRRKFSEDAAEIL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + + + NI  F++GLPLNM+G+EGPR  STR     ++ R   +P VF DER++T + ++
Sbjct: 61  ALVGSRNIGGFVVGLPLNMDGTEGPRCQSTRDLTAELLLRH-DLPTVFQDERMSTQAVER 119

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLD 150
            +I + +++R +R + +DS AAA ILQ  LD
Sbjct: 120 AMISEADLTRGQRKKSIDSAAAAWILQAALD 150


>gi|262277133|ref|ZP_06054926.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
 gi|262224236|gb|EEY74695.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
          Length = 156

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 81/144 (56%), Gaps = 1/144 (0%)

Query: 7   EDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE 66
           +D +  +  N  I  ID G K IGL++SDP ++ A P   +V KK  Q   EL + I   
Sbjct: 10  KDFLIKVGKNSRILGIDPGKKNIGLSVSDPNQKIATPFKIIVMKKFKQFLEELNNIIREY 69

Query: 67  NIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMN 126
            I   +IG P+NM+G+ GPR  S R F  N I +   +P   WDERL++  A  ++ D++
Sbjct: 70  EIKGIVIGNPINMDGTSGPRSQSARDFAQN-ISKNTKLPITLWDERLSSEGAFNLMGDLD 128

Query: 127 VSRKKRIQKVDSIAAALILQEVLD 150
           ++  K+ + +D  AAA ILQ  LD
Sbjct: 129 INSSKKSKNLDQHAAAFILQGYLD 152


>gi|156743642|ref|YP_001433771.1| Holliday junction resolvase YqgF [Roseiflexus castenholzii DSM
           13941]
 gi|156234970|gb|ABU59753.1| Holliday junction resolvase YqgF [Roseiflexus castenholzii DSM
           13941]
          Length = 146

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 93/141 (65%), Gaps = 5/141 (3%)

Query: 13  LKPNQP--IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-LLSFITTENIA 69
           +K ++P  + ++D+G +RIG+A+SDP R  A P    +R K   TAL+ + S I   ++A
Sbjct: 1   MKIDEPGRVMALDVGEQRIGVALSDPTRTLATPL-TTIRAKPRATALKRIASLIREHDVA 59

Query: 70  AFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR 129
           A ++GLPL M+G  GP+    + FV  +  R + +P  F DERLTTV+A++++ID+ +  
Sbjct: 60  ALVVGLPLTMSGDVGPQAALVQQFVEEL-RRAIAIPLTFVDERLTTVAAERMMIDLKLKP 118

Query: 130 KKRIQKVDSIAAALILQEVLD 150
           ++R  ++D +AA++ILQ+ LD
Sbjct: 119 EQRKARIDEVAASIILQDFLD 139


>gi|94497357|ref|ZP_01303928.1| endonuclease [Sphingomonas sp. SKA58]
 gi|94423220|gb|EAT08250.1| endonuclease [Sphingomonas sp. SKA58]
          Length = 169

 Score =  105 bits (261), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 79/130 (60%), Gaps = 2/130 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+GTK IGLA+ D     A P   + R K  +  + L +FI  + +   +IGLPLN++
Sbjct: 35  GMDVGTKTIGLALCDAAWTIASPAYTVTRGKFGKDKIGLAAFIDQQQVKGVVIGLPLNLD 94

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GS  PR  ++RAF HN+ D  + +P + WDER +T +  + L++ + SR +R + VD +A
Sbjct: 95  GSFSPRAQASRAFAHNIAD--LGLPILLWDERWSTQAVTRTLLEADASRARRDELVDKLA 152

Query: 141 AALILQEVLD 150
           A+ ILQ  +D
Sbjct: 153 ASYILQGAID 162


>gi|294102018|ref|YP_003553876.1| Holliday junction resolvase YqgF [Aminobacterium colombiense DSM
           12261]
 gi|293616998|gb|ADE57152.1| Holliday junction resolvase YqgF [Aminobacterium colombiense DSM
           12261]
          Length = 138

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 79/132 (59%), Gaps = 2/132 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D+G KRIG+A+SDP   FA    F+   K  +  L+L   + + N+   +IG PL 
Sbjct: 4   ILALDIGEKRIGMAVSDPLGCFAQGVGFIPMNK--EWLLKLDESLISLNVEMLLIGNPLR 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
            NG+ GP     +     +  R  ++  V WDER TT  AQQ+L++ NVSRKKR +KVD 
Sbjct: 62  TNGTAGPETDKIKNIAAELKIRYPHISIVLWDERFTTSIAQQVLLEGNVSRKKRKEKVDQ 121

Query: 139 IAAALILQEVLD 150
           +AAALILQ  LD
Sbjct: 122 LAAALILQNYLD 133


>gi|118597226|sp|Q5NPF1|RUVX_ZYMMO RecName: Full=Putative Holliday junction resolvase
          Length = 163

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 81/133 (60%), Gaps = 4/133 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL-SFITTENIAAFIIGLPL 77
           +A +D+GTK IGLA+ D     A P   + RKK T   LELL  F+  + +   +IGLPL
Sbjct: 29  LAGLDVGTKTIGLALCDSQWIIASPAETIRRKKFT-LDLELLRQFVEKQQVKGLVIGLPL 87

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           N++GS+ PR  S RAF  N+    + +P + WDER +T +  + L++ + SR +R + VD
Sbjct: 88  NLDGSDSPRTQSVRAFAKNVA--PLSLPVLMWDERWSTKAVTRTLLEADASRARRSEVVD 145

Query: 138 SIAAALILQEVLD 150
            +AAA ILQ  +D
Sbjct: 146 KMAAAYILQGAID 158


>gi|167628659|ref|YP_001679158.1| holliday junction resolvase, putative [Heliobacterium modesticaldum
           Ice1]
 gi|226725525|sp|B0TFZ0|RUVX_HELMI RecName: Full=Putative Holliday junction resolvase
 gi|167591399|gb|ABZ83147.1| holliday junction resolvase, putative [Heliobacterium modesticaldum
           Ice1]
          Length = 149

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 82/141 (58%), Gaps = 1/141 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+A+SD     A     + R ++      L   + T  +   + GLP N
Sbjct: 3   IMGLDVGDKTIGVAVSDLMGWTAQGVATIRRSRLAADLEHLRELVKTYEVERIVCGLPRN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GPR    R F  +++++K+ +P  +WDERLTTV+AQ+ LI  ++SR KR Q VD 
Sbjct: 63  MNGTYGPRAEGIRKF-GSLVEKKLNIPVDYWDERLTTVAAQKTLIAGDLSRAKRKQVVDK 121

Query: 139 IAAALILQEVLDRISFLESSK 159
           +AA LILQ  +D  + L + +
Sbjct: 122 LAAVLILQNYMDAKAHLAAKE 142


>gi|56551681|ref|YP_162520.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241761198|ref|ZP_04759286.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|260752737|ref|YP_003225630.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56543255|gb|AAV89409.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241374105|gb|EER63602.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|258552100|gb|ACV75046.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 179

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/138 (39%), Positives = 82/138 (59%), Gaps = 4/138 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL-SFITTENIAAFIIGLPL 77
           +A +D+GTK IGLA+ D     A P   + RKK T   LELL  F+  + +   +IGLPL
Sbjct: 45  LAGLDVGTKTIGLALCDSQWIIASPAETIRRKKFT-LDLELLRQFVEKQQVKGLVIGLPL 103

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           N++GS+ PR  S RAF  N+    + +P + WDER +T +  + L++ + SR +R + VD
Sbjct: 104 NLDGSDSPRTQSVRAFAKNVA--PLSLPVLMWDERWSTKAVTRTLLEADASRARRSEVVD 161

Query: 138 SIAAALILQEVLDRISFL 155
            +AAA ILQ  +D  +  
Sbjct: 162 KMAAAYILQGAIDSFAMF 179


>gi|269837589|ref|YP_003319817.1| Holliday junction resolvase YqgF [Sphaerobacter thermophilus DSM
           20745]
 gi|269786852|gb|ACZ38995.1| Holliday junction resolvase YqgF [Sphaerobacter thermophilus DSM
           20745]
          Length = 143

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 83/142 (58%), Gaps = 3/142 (2%)

Query: 9   LVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENI 68
           +  S +P + + ++D+G +R+G+A+SD     A P   +  K+       L++ I   + 
Sbjct: 1   MASSSQPGRRLIALDVGARRVGVAVSDELGLIASPVESVDMKRDGMD--RLVALIERYDP 58

Query: 69  AAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVS 128
              IIGLPL M+G EGP+  +TRAF   +  R V  P +FWDERLTT  A Q LI+    
Sbjct: 59  ERIIIGLPLGMSGREGPQAAATRAFAQQLRGR-VDRPIIFWDERLTTFMADQSLIEAGHR 117

Query: 129 RKKRIQKVDSIAAALILQEVLD 150
           R +R Q VD++AAALILQ  LD
Sbjct: 118 RARRKQHVDAVAAALILQSYLD 139


>gi|330814160|ref|YP_004358399.1| putative Holliday junction resolvase [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487255|gb|AEA81660.1| putative Holliday junction resolvase [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 156

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 80/145 (55%), Gaps = 1/145 (0%)

Query: 8   DLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN 67
           D  K +     +  ID G + +G+AI DP    A P   +  KK+     EL   I   N
Sbjct: 11  DFAKLITEGSRLLGIDPGKRNVGIAICDPSHLIATPYETIQAKKLKNLLEELDKIIIENN 70

Query: 68  IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV 127
           I   ++G P+NM+G+EGPR  ST+ FV N+I +  ++P   WDERL++V A + + D+ +
Sbjct: 71  IKGIVVGHPINMDGTEGPRSQSTKDFVKNII-KHTHLPVTLWDERLSSVGAFKSMQDLGI 129

Query: 128 SRKKRIQKVDSIAAALILQEVLDRI 152
           +   +  K+D  +AA ILQ  +D +
Sbjct: 130 NSSSKKDKLDENSAAFILQGFIDYL 154


>gi|296115811|ref|ZP_06834437.1| putative Holliday junction resolvase [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295977788|gb|EFG84540.1| putative Holliday junction resolvase [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 153

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 92/151 (60%), Gaps = 2/151 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +  I +L  +L+P Q +  ID G K IG+A+SD     A P   + R+K++  A E+ 
Sbjct: 1   MPLFNIPELRLALRPGQRLMGIDPGQKTIGIALSDVSLMLASPCTTVRRRKLSLVAAEIG 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                 ++ A + GLPL+++GS GP   + R ++ N + ++V +P   WDERL++ +  +
Sbjct: 61  ELARRHDVGALVGGLPLSLDGSFGPAAQAARDWMMN-LSQQVGLPAAMWDERLSSSAVNR 119

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLD 150
           +LI D++++R++R Q VD +AAA ILQ  LD
Sbjct: 120 MLIQDVDMTRQRREQVVDKVAAAYILQAALD 150


>gi|295092925|emb|CBK82016.1| conserved hypothetical protein TIGR00250 [Coprococcus sp. ART55/1]
          Length = 149

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 60/143 (41%), Positives = 84/143 (58%), Gaps = 13/143 (9%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAA----- 70
           I  +D GTK +G+A+SDP +  A P   + RK   K+ QT L  +  I  E  AA     
Sbjct: 3   ILGLDYGTKTVGVAVSDPLKMTAQPLETIERKSANKLRQT-LARIEAILEEYGAAGERDR 61

Query: 71  ---FIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV 127
               ++G P NMN SEG R  +T+AF  ++ +R+  +  V WDERLTTV A++IL+D  V
Sbjct: 62  IELIVLGYPKNMNNSEGDRCEATQAFKEDL-ERRTGLEVVLWDERLTTVEAERILMDSGV 120

Query: 128 SRKKRIQKVDSIAAALILQEVLD 150
            R+ R   +D +AAA+ILQ  LD
Sbjct: 121 RRENRKTYIDKMAAAVILQNYLD 143


>gi|291087071|ref|ZP_06345320.2| putative Holliday junction resolvase [Clostridium sp. M62/1]
 gi|291076386|gb|EFE13750.1| putative Holliday junction resolvase [Clostridium sp. M62/1]
          Length = 175

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 78/135 (57%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K  G+A+SDP    A     +VRK   K+ QT   +   I    I A ++G 
Sbjct: 38  IMGLDFGSKTTGVAVSDPLGLTAQGLETIVRKDENKLRQTCARIEELIEEYQIEAIVLGY 97

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R   T +F   M++R+   P + WDERLTT++A+++L++  V R+ R   
Sbjct: 98  PKNMNNTAGERAEKTESF-KEMLERRTGKPVILWDERLTTIAAERMLMESGVRRENRKAV 156

Query: 136 VDSIAAALILQEVLD 150
           +D +AAALILQ  LD
Sbjct: 157 IDKVAAALILQGYLD 171


>gi|325479225|gb|EGC82321.1| RNAse H domain protein, YqgF family [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 139

 Score =  101 bits (251), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 79/133 (59%), Gaps = 1/133 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+A+SDP    A  +  + RKK +     LL  I   ++   ++GLP N
Sbjct: 4   IMGLDVGDKTIGVALSDPMFLLAQAKETIKRKKASLDIQRLLEIIDENDVNLIVVGLPKN 63

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MN + GP+     +FV +++ ++  V  V+ DER+TT+ ++ +LIDM V R+ R Q +D 
Sbjct: 64  MNNTIGPQSMKVMSFV-DLLKKQTDVEIVYEDERMTTIQSESVLIDMKVRRENRKQYIDK 122

Query: 139 IAAALILQEVLDR 151
           IAA  ILQ  LDR
Sbjct: 123 IAATFILQTYLDR 135


>gi|295092198|emb|CBK78305.1| conserved hypothetical protein TIGR00250 [Clostridium cf.
           saccharolyticum K10]
          Length = 140

 Score =  101 bits (251), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 78/135 (57%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K  G+A+SDP    A     +VRK   K+ QT   +   I    I A ++G 
Sbjct: 3   IMGLDFGSKTTGVAVSDPLGLTAQGLETIVRKDENKLRQTCARIEELIEEYQIEAIVLGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R   T +F   M++R+   P + WDERLTT++A+++L++  V R+ R   
Sbjct: 63  PKNMNNTAGERAEKTESF-KEMLERRTGKPVILWDERLTTIAAERMLMESGVRRENRKAV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AAALILQ  LD
Sbjct: 122 IDKVAAALILQGYLD 136


>gi|291563945|emb|CBL42761.1| conserved hypothetical protein TIGR00250 [butyrate-producing
           bacterium SS3/4]
          Length = 144

 Score =  101 bits (251), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 80/135 (59%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+A+SD     A     + RK   K+ +T   +   I    +   ++GL
Sbjct: 3   ILGLDFGSKTVGVAVSDGLLLTAQGVETIERKDENKLRKTCARIEELIAEYEVTEIVLGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NM+ +EG RV  T+AF   M++R+  +P  +WDERLTTV+A+QIL++  V R+ R   
Sbjct: 63  PKNMDNTEGERVEKTKAF-GEMLERRTGLPVHYWDERLTTVAAEQILMESGVRRENRKAV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA LILQ  LD
Sbjct: 122 IDKVAAGLILQGYLD 136


>gi|114566022|ref|YP_753176.1| Holliday junction resolvase YqgF [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|122318867|sp|Q0AZP9|RUVX_SYNWW RecName: Full=Putative Holliday junction resolvase
 gi|114336957|gb|ABI67805.1| Holliday junction resolvase YqgF [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 141

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 77/132 (58%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +DLG KRIG+A SDP    A     L RK + +    L        +   ++GLPLN
Sbjct: 3   IMGLDLGEKRIGIAFSDPMGWTAQGHSILQRKGLKKDLSYLQELCQEFQVEKIVLGLPLN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP+   T+ F    +   + +P  FWDERL++ SA+++L++ ++SRK+R + +D 
Sbjct: 63  MNGTMGPKALETQEFAR-ALQEALKIPVDFWDERLSSKSAERVLLEADLSRKRRKELIDK 121

Query: 139 IAAALILQEVLD 150
           IAA  ILQ  LD
Sbjct: 122 IAAVHILQAYLD 133


>gi|253574901|ref|ZP_04852241.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251845947|gb|EES73955.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 138

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 77/136 (56%), Gaps = 1/136 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D G +RIG+A+SD     A     + R+K       +   +    +   ++GLP N
Sbjct: 3   IMGLDYGDRRIGVAVSDSLGWTAQGLETIERRKEGSEFERIAELVKQHEVEEIVVGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GPR     AF  ++   K+ +P   WDERLTTVSAQ+ L+D +VSRKKR   VD 
Sbjct: 63  MNGTIGPRGEICMAFAEDL-RAKLNLPVHLWDERLTTVSAQRTLLDADVSRKKRKGVVDK 121

Query: 139 IAAALILQEVLDRISF 154
           +AA+LILQ  LD  S 
Sbjct: 122 MAASLILQNYLDSKSI 137


>gi|149174656|ref|ZP_01853281.1| Holliday junction resolvase YqgF [Planctomyces maris DSM 8797]
 gi|148846350|gb|EDL60688.1| Holliday junction resolvase YqgF [Planctomyces maris DSM 8797]
          Length = 162

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 49/130 (37%), Positives = 77/130 (59%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D GTKR+G+AIS   +  A P     R+ + Q    LLS IT       ++GLP++M+
Sbjct: 23  GLDYGTKRVGIAISTFEQNIASPLDNYNRQSLPQDQKHLLSIITEYRCKGLVVGLPVHMS 82

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EG +    R F  N + +   +P  +WDER ++ +A++IL+++N+SR KR   +D +A
Sbjct: 83  GDEGQKAKEARQF-GNWVSQFAEIPVRYWDERYSSATAEEILVNLNMSRNKRKAYLDKLA 141

Query: 141 AALILQEVLD 150
           A +ILQ  LD
Sbjct: 142 AQIILQSFLD 151


>gi|83590476|ref|YP_430485.1| Holliday junction resolvase YqgF [Moorella thermoacetica ATCC
           39073]
 gi|146325578|sp|Q2RHZ7|RUVX_MOOTA RecName: Full=Putative Holliday junction resolvase
 gi|83573390|gb|ABC19942.1| Holliday junction resolvase YqgF [Moorella thermoacetica ATCC
           39073]
          Length = 140

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 82/135 (60%), Gaps = 1/135 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+GTK IG+A+SDP    A     + R+ +      L   +    +   ++GLP N
Sbjct: 3   IMGLDVGTKTIGVALSDPLGWTAQGLTTIRRRNLAADLAALKELVRRYGVEELVVGLPRN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNGS GP+  + RAF  ++   +V +P  F+DERLTTV+A ++L++ ++SR++R Q +D 
Sbjct: 63  MNGSLGPQAEAVRAFARHL-QAEVGLPVHFFDERLTTVAAGRVLLEADLSRRRRRQVIDQ 121

Query: 139 IAAALILQEVLDRIS 153
           +AA  ILQ  LDR+ 
Sbjct: 122 VAATYILQGYLDRLG 136


>gi|312880062|ref|ZP_07739862.1| Holliday junction resolvase YqgF [Aminomonas paucivorans DSM 12260]
 gi|310783353|gb|EFQ23751.1| Holliday junction resolvase YqgF [Aminomonas paucivorans DSM 12260]
          Length = 144

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 78/133 (58%), Gaps = 4/133 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIAAFIIGLPL 77
           + ++DLGT R+G+A+SDP RRFA P   L  ++   Q   EL   + T  +   ++GLP 
Sbjct: 6   VLALDLGTVRVGVALSDPTRRFAQPLDVLPAQENWIQRVREL---VVTHQVTLVLVGLPT 62

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
             +G+ GP V   R +   +      VP  F+DER TT  AQQ L+  +VSRK R Q+VD
Sbjct: 63  RTDGTAGPEVERVRGWTEELRQGIPQVPIQFYDERFTTRIAQQALLAGDVSRKGRKQRVD 122

Query: 138 SIAAALILQEVLD 150
            +AAA++LQ  LD
Sbjct: 123 KVAAAVLLQGFLD 135


>gi|83945529|ref|ZP_00957876.1| hypothetical protein OA2633_01404 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851105|gb|EAP88963.1| hypothetical protein OA2633_01404 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 162

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 85/145 (58%), Gaps = 1/145 (0%)

Query: 9   LVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENI 68
           L  +L P  P+ +ID GTK +G+A+S+  R    P   + R+K TQ A  LL+       
Sbjct: 4   LDPALLPQGPLMAIDPGTKTLGVAVSNTDRTLVTPLTTIQREKFTQDAQALLNLYDERAC 63

Query: 69  AAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVS 128
              I+GLPL+M+G +G R  S+R+FV N++ R   +P  + DERL+T +A + LI+  V 
Sbjct: 64  VGLIVGLPLHMHGGDGRRAQSSRSFVTNLL-RLRDLPVAYQDERLSTFAATESLIEAGVK 122

Query: 129 RKKRIQKVDSIAAALILQEVLDRIS 153
              R   VD+ AAA+IL+  + RI+
Sbjct: 123 PSHRKDFVDAQAAAVILESAIGRIN 147


>gi|295115537|emb|CBL36384.1| conserved hypothetical protein TIGR00250 [butyrate-producing
           bacterium SM4/1]
          Length = 140

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 77/135 (57%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I   D G+K  G+A+SDP    A     +VRK   K+ QT   +   I    I A ++G 
Sbjct: 3   IMGQDFGSKTTGVAVSDPLGLTAQGLETIVRKDENKLRQTCARIEELIEEYQIEAIVLGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R   T +F   M++R+   P + WDERLTT++A+++L++  V R+ R   
Sbjct: 63  PKNMNNTAGERAEKTESF-KEMLERRTGKPVILWDERLTTIAAERMLMESGVRRENRKAV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AAALILQ  LD
Sbjct: 122 IDKVAAALILQGYLD 136


>gi|220931424|ref|YP_002508332.1| Holliday junction resolvase YqgF [Halothermothrix orenii H 168]
 gi|254767518|sp|B8D2B0|RUVX_HALOH RecName: Full=Putative Holliday junction resolvase
 gi|219992734|gb|ACL69337.1| Holliday junction resolvase YqgF [Halothermothrix orenii H 168]
          Length = 140

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 79/132 (59%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D G +RIG+AISD     A  +  ++RK   +    +   I    +   I+G+P N
Sbjct: 3   IMGLDYGDRRIGVAISDKLGMTAQGQEVIIRKTPEEDLEVIKGLIDKYEVEEIIVGMPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+GS GPR   TR F+ + + + +  P   WDERL+TV A+++LI+ +VSRKKR   +D 
Sbjct: 63  MDGSLGPRAEKTRDFI-DFLQKSLDTPVKVWDERLSTVEAERVLIEADVSRKKRKGVIDK 121

Query: 139 IAAALILQEVLD 150
           +AA++ILQ  L+
Sbjct: 122 VAASIILQGYLN 133


>gi|163816752|ref|ZP_02208115.1| hypothetical protein COPEUT_02942 [Coprococcus eutactus ATCC 27759]
 gi|158448009|gb|EDP25004.1| hypothetical protein COPEUT_02942 [Coprococcus eutactus ATCC 27759]
          Length = 149

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 81/142 (57%), Gaps = 11/142 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITT-------ENI 68
           +  +D GTK +G+A+SDP    A P   + RK   K+ QT   + + I         E I
Sbjct: 3   VLGLDYGTKTVGVAVSDPLEITAQPLETIERKSAGKLRQTLARIEAIIEEYGAAGQQEKI 62

Query: 69  AAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVS 128
              ++G P NMN +EG R  +T +F  N ++R+  +  V WDERLTTV A++IL+D  V 
Sbjct: 63  EKIVLGYPKNMNNTEGDRCEATVSF-KNDLERRTGLEVVLWDERLTTVEAERILMDSGVR 121

Query: 129 RKKRIQKVDSIAAALILQEVLD 150
           R+ R   +D +AAA+ILQ  LD
Sbjct: 122 RENRKTYIDKMAAAVILQNYLD 143


>gi|226311491|ref|YP_002771385.1| Holliday junction resolvase [Brevibacillus brevis NBRC 100599]
 gi|226094439|dbj|BAH42881.1| putative Holliday junction resolvase [Brevibacillus brevis NBRC
           100599]
          Length = 138

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 79/132 (59%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +D+G K IG+A+SD     A     + R+   +    L   ++   I AF++GLP N
Sbjct: 4   LMGLDVGDKTIGVAVSDELGWTAQGVETIKRQSKEKDFARLSELVSQYQIGAFVVGLPKN 63

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GPR    +AF   +++ +  +P   WDERLTT++A+++LI  +VSR+KR   +D 
Sbjct: 64  MNGTIGPRAEMCQAF-GKLLEERTSLPVHMWDERLTTMAAERMLISADVSRQKRKTVIDK 122

Query: 139 IAAALILQEVLD 150
           +AA LILQ  LD
Sbjct: 123 MAATLILQGYLD 134


>gi|147677400|ref|YP_001211615.1| endonuclease [Pelotomaculum thermopropionicum SI]
 gi|189046102|sp|A5D3C3|RUVX_PELTS RecName: Full=Putative Holliday junction resolvase
 gi|146273497|dbj|BAF59246.1| predicted endonuclease [Pelotomaculum thermopropionicum SI]
          Length = 154

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 79/133 (59%), Gaps = 2/133 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLPL 77
           I  +DLG K+IG+A+SDP    A     +  K   + ++E +S  +    +   ++GLP 
Sbjct: 3   IMGLDLGDKKIGVALSDPMGWTAQGLDVIAVKGPPEASVERISELVRQYGVGKIVVGLPR 62

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMNGS GPR    RAF   +    + +P   WDER+TT+ A+++LI+ ++SR +R Q +D
Sbjct: 63  NMNGSFGPRAERARAFAGCLAG-ALNLPVELWDERMTTLEAEKLLIEADLSRARRRQVID 121

Query: 138 SIAAALILQEVLD 150
            +AA LILQ  LD
Sbjct: 122 KMAAVLILQSFLD 134


>gi|223935593|ref|ZP_03627509.1| Holliday junction resolvase YqgF [bacterium Ellin514]
 gi|223895601|gb|EEF62046.1| Holliday junction resolvase YqgF [bacterium Ellin514]
          Length = 138

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/132 (41%), Positives = 75/132 (56%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID GTKRIGLAISD     A P  F++ +      + L   I  + +   ++G+P N
Sbjct: 4   ILAIDHGTKRIGLAISDELGVIAQPLEFVLAEPFANFLVRLKQLIQEKQVEMLLVGMPRN 63

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+GS GP     + FV  + D  V +P   WDERLT+  A + LI  +V R KR +KVD 
Sbjct: 64  MDGSYGPAALKVQEFVTVLKD-SVAIPIKTWDERLTSAQANRFLIQADVRRDKRKEKVDK 122

Query: 139 IAAALILQEVLD 150
            AAA++LQ  LD
Sbjct: 123 TAAAILLQSYLD 134


>gi|312143794|ref|YP_003995240.1| Holliday junction resolvase YqgF [Halanaerobium sp. 'sapolanicus']
 gi|311904445|gb|ADQ14886.1| Holliday junction resolvase YqgF [Halanaerobium sp. 'sapolanicus']
          Length = 136

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 77/132 (58%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  ID G KR+G+A+SD     A P   L +    +  +EL  +I   ++   I+G+P N
Sbjct: 3   ILGIDYGNKRVGIAVSDALGWTAQPLTTLKQHGHQELLVELRQYIEKYDVEKIIVGMPYN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+GS G R   T+AF+ N +   + +P    DERLTT  A+ IL++ ++SR +R   +D 
Sbjct: 63  MDGSRGKRAEITQAFI-NFLKNNLEIPVEIQDERLTTSQAENILLEADLSRSRRKDVIDK 121

Query: 139 IAAALILQEVLD 150
           +AAALILQ  LD
Sbjct: 122 LAAALILQSYLD 133


>gi|315645822|ref|ZP_07898943.1| Holliday junction resolvase YqgF [Paenibacillus vortex V453]
 gi|315278583|gb|EFU41897.1| Holliday junction resolvase YqgF [Paenibacillus vortex V453]
          Length = 137

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 78/134 (58%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + I  +D G +RIG+AISD     A     + R++     + + + +    +   ++GLP
Sbjct: 2   KKIMGLDYGDRRIGVAISDVFGWTAQGVEVIERRRDEGELVRIATLVKENEVGEVVVGLP 61

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR      F  N +   + +P   WDERL+TVSA++ L++ +VSRKKR Q V
Sbjct: 62  KNMNGTIGPRGEICMEFA-NTLRESLSLPVHLWDERLSTVSAERTLLEADVSRKKRKQVV 120

Query: 137 DSIAAALILQEVLD 150
           D +AA+LILQ  LD
Sbjct: 121 DKMAASLILQNYLD 134


>gi|284048258|ref|YP_003398597.1| Holliday junction resolvase YqgF [Acidaminococcus fermentans DSM
           20731]
 gi|283952479|gb|ADB47282.1| Holliday junction resolvase YqgF [Acidaminococcus fermentans DSM
           20731]
          Length = 139

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 78/132 (59%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +DLGT+ IG+++SD     A     + RK +      L   +  E +  F++G P N
Sbjct: 3   IMGLDLGTRTIGVSVSDETGFIARGVETIRRKGLENDLKRLGELVEQEEVGQFVLGYPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNGS G R  ++  F   + +R   +P V WDERL+TV+A+++LI+ ++ RKKR + +D 
Sbjct: 63  MNGSIGDRARASEEFKTILEERFPSIPVVLWDERLSTVAAEKVLIEADLQRKKRKKIIDM 122

Query: 139 IAAALILQEVLD 150
           +AA +ILQ  LD
Sbjct: 123 MAAVVILQNYLD 134


>gi|258645601|ref|ZP_05733070.1| putative Holliday junction resolvase [Dialister invisus DSM 15470]
 gi|260402959|gb|EEW96506.1| putative Holliday junction resolvase [Dialister invisus DSM 15470]
          Length = 142

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 79/136 (58%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I S+D+G++ IG+A+SD     A     +      +  + L       N+  F+IG+PLN
Sbjct: 3   IMSLDVGSQTIGVAVSDLFGWTAQGVETIRHTTREKDFVRLRHLADEYNVEEFVIGMPLN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG++G R   T  F   +      +P+ FWDERLTTV AQ+ LI+ +VSRKKR + +D 
Sbjct: 63  MNGTKGMRAEQTEKFAEALAAAFPDIPYHFWDERLTTVMAQRQLIEADVSRKKRKKVIDK 122

Query: 139 IAAALILQEVLDRISF 154
           +AA +IL+  L  +SF
Sbjct: 123 MAAVVILEGYLQHLSF 138


>gi|160947667|ref|ZP_02094834.1| hypothetical protein PEPMIC_01602 [Parvimonas micra ATCC 33270]
 gi|158446801|gb|EDP23796.1| hypothetical protein PEPMIC_01602 [Parvimonas micra ATCC 33270]
          Length = 148

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 80/135 (59%), Gaps = 4/135 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G + IG+A+SDP    A     + R+ + +    L + I  ENI   ++GLP NMN
Sbjct: 13  ALDVGDRTIGVAVSDPLFIMAEGYSTIFRESIEKDLESLKNIIVKENIIKVVVGLPKNMN 72

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPF----VFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            + GP+     +FV  + D  V   F    V  DERLTTVSA++ILI+ N+SRKKR + +
Sbjct: 73  NTIGPQGEKVLSFVDELKDFLVKNSFDIEIVMQDERLTTVSAERILIEGNMSRKKRKKVI 132

Query: 137 DSIAAALILQEVLDR 151
           D +AA  ILQ  LDR
Sbjct: 133 DKVAATYILQSYLDR 147


>gi|329113628|ref|ZP_08242406.1| Putative Holliday junction resolvase [Acetobacter pomorum DM001]
 gi|326697035|gb|EGE48698.1| Putative Holliday junction resolvase [Acetobacter pomorum DM001]
          Length = 154

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 90/153 (58%), Gaps = 2/153 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L + DLV +L  +  +  ID G K++GLA+SD  R  A P   + R K+ Q A  + 
Sbjct: 1   MTLLSLTDLVATLPRHARLLGIDPGKKQVGLALSDVSRMVASPFQTVKRGKLGQMASFIR 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
              T   I   ++G+PL+++GS GP   ++R +   + + +  +P   WDERL++ +  +
Sbjct: 61  DLATEHEIGGMVVGIPLSLDGSFGPAAQASRDWALALSE-QTGLPVCQWDERLSSSAVNR 119

Query: 121 ILID-MNVSRKKRIQKVDSIAAALILQEVLDRI 152
           +LID  ++SR +R + VD +AAA ILQ  LD +
Sbjct: 120 MLIDEADLSRARRAEMVDRLAAAYILQAALDSL 152


>gi|261405445|ref|YP_003241686.1| Holliday junction resolvase YqgF [Paenibacillus sp. Y412MC10]
 gi|261281908|gb|ACX63879.1| Holliday junction resolvase YqgF [Paenibacillus sp. Y412MC10]
          Length = 137

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 77/134 (57%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + I  +D G +RIG+AISD     A     + R++       + + +    +   ++GLP
Sbjct: 2   KKIMGLDYGDRRIGVAISDAFGWTAQGVEVIERRRDEGELDRIAALVKDNEVGEIVVGLP 61

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR      F  N +   + +P   WDERL+TVSA++ L++ +VSRKKR Q V
Sbjct: 62  KNMNGTIGPRGEICMEFA-NTLRESLSLPVHLWDERLSTVSAERTLLEADVSRKKRKQVV 120

Query: 137 DSIAAALILQEVLD 150
           D +AA+LILQ  LD
Sbjct: 121 DKMAASLILQNYLD 134


>gi|239627761|ref|ZP_04670792.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239517907|gb|EEQ57773.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 150

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 79/141 (56%), Gaps = 4/141 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFI 72
           N  I  +D G+K +G+A+ DP    A     + RK   K+ QT   + + I    I   +
Sbjct: 2   NMRIMGLDFGSKTVGVAVCDPLGITAQTVETITRKDENKLRQTLARIEALIGQYEIERIV 61

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +G P NMN + G R   T  F    ++R+  +P V WDERLTTV+A ++LI+  V R+ R
Sbjct: 62  LGYPKNMNNTLGERAVKTEEF-KTSLERRTGLPVVLWDERLTTVAASRVLIESGVRREHR 120

Query: 133 IQKVDSIAAALILQEVLDRIS 153
            + VD IAAA+ILQ  LD +S
Sbjct: 121 KESVDQIAAAMILQGYLDSLS 141


>gi|148657331|ref|YP_001277536.1| Holliday junction resolvase YqgF [Roseiflexus sp. RS-1]
 gi|226731646|sp|A5UY83|RUVX_ROSS1 RecName: Full=Putative Holliday junction resolvase
 gi|148569441|gb|ABQ91586.1| Holliday junction resolvase YqgF [Roseiflexus sp. RS-1]
          Length = 141

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 86/136 (63%), Gaps = 9/136 (6%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-LLSFITTENIAAFIIGLPL 77
           + ++D+G +RIG+A+SDP R  A P    +R     TAL+ +L+ I    + A ++GLPL
Sbjct: 8   VMALDVGERRIGVALSDPTRMLASPL-TTIRAVPRSTALKRILTLIRDYQVTALVVGLPL 66

Query: 78  NMNGSEGPRVHSTRAFVHNM---IDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            MNG  GP+    + FV  +   ID    +P  F DERLTTV+A++++ID+ +  ++R  
Sbjct: 67  TMNGDIGPQATLVQQFVDELRPLID----IPIFFVDERLTTVAAERMMIDLKIKPEQRRA 122

Query: 135 KVDSIAAALILQEVLD 150
           ++D +AA++ILQ+ LD
Sbjct: 123 RIDEVAASIILQDFLD 138


>gi|315303254|ref|ZP_07873898.1| putative Holliday junction resolvase [Listeria ivanovii FSL F6-596]
 gi|313628366|gb|EFR96855.1| putative Holliday junction resolvase [Listeria ivanovii FSL F6-596]
          Length = 138

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 82/134 (61%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP G          + +K  Q   E +  +  E  +   ++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGWTAQGVETIQIDEKRKQFGYERVKELVLEYEVEKVVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR + +
Sbjct: 63  KNMNNTIGPRAESSKIYAE-VLEARIGLPVVLWDERLTTTAAERTLIEADVSRKKRKEVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKLAAVMILQSYLD 135


>gi|167462225|ref|ZP_02327314.1| hypothetical protein Plarl_06660 [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322382969|ref|ZP_08056801.1| Holliday junction resolvase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321153089|gb|EFX45547.1| Holliday junction resolvase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 136

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 53/130 (40%), Positives = 76/130 (58%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D G + IG+A+SD     A     + RKK  +    +   I    ++  ++GLP NMN
Sbjct: 5   GLDYGDRTIGVAVSDLLGLTAQGVEVIRRKKQEEDLARIGELIREYEVSELVVGLPKNMN 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G+ GPR    + F   ++ R+  +P   WDERLTTVSA + L++ +VSRKKR Q VD +A
Sbjct: 65  GTIGPRGELCQEFA-GLLKRQFGLPVHLWDERLTTVSATRTLLEADVSRKKRKQVVDKMA 123

Query: 141 AALILQEVLD 150
           AALILQ  +D
Sbjct: 124 AALILQGYMD 133


>gi|331085955|ref|ZP_08335038.1| Holliday junction resolvase [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330406878|gb|EGG86383.1| Holliday junction resolvase [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 151

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 4/143 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+AISDP    A     + RK   K+ +T   + + +    +   ++G 
Sbjct: 3   IMGLDYGSKTVGVAISDPLGLTAQGIETICRKEENKLRKTLARIEALVQEYQVEEIVLGF 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R   +  F   M++R+  +P   WDERLTTV A++ LI+ NV R+ R + 
Sbjct: 63  PKNMNNTVGDRAEKSLEF-KEMLERRTALPVTMWDERLTTVEAERTLIENNVRREDRKKY 121

Query: 136 VDSIAAALILQEVLDRISFLESS 158
           VD IAA  ILQ  LD + F + S
Sbjct: 122 VDKIAAVFILQGYLDSVYFRQKS 144


>gi|269798239|ref|YP_003312139.1| Holliday junction resolvase YqgF [Veillonella parvula DSM 2008]
 gi|282850477|ref|ZP_06259856.1| RNAse YqgF [Veillonella parvula ATCC 17745]
 gi|269094868|gb|ACZ24859.1| Holliday junction resolvase YqgF [Veillonella parvula DSM 2008]
 gi|282579970|gb|EFB85374.1| RNAse YqgF [Veillonella parvula ATCC 17745]
          Length = 139

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 79/136 (58%), Gaps = 1/136 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I S+D+G++ IG+A SD     A     + R  + +    L   I+   +   ++G+P N
Sbjct: 3   IMSLDVGSRTIGIACSDALLMTAQGIETIRRTSLEKDFNRLQELISEYEVHELVVGMPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG++G R   T  FV  M +  + +P  +WDERL+TV A++ LI  +VSRKKR   +D 
Sbjct: 63  MNGTKGERAEKTEEFVAKMKE-VIDLPVTYWDERLSTVMAERQLIAADVSRKKRKSVIDK 121

Query: 139 IAAALILQEVLDRISF 154
           +AA +ILQ  LDR+ F
Sbjct: 122 MAAVVILQGYLDRLQF 137


>gi|227499548|ref|ZP_03929655.1| crossover junction endodeoxyribonuclease [Anaerococcus tetradius
           ATCC 35098]
 gi|227218307|gb|EEI83561.1| crossover junction endodeoxyribonuclease [Anaerococcus tetradius
           ATCC 35098]
          Length = 139

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 79/133 (59%), Gaps = 1/133 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+A+SDP    A+    + RK  +     L   I   ++   ++GLP N
Sbjct: 4   IMGLDVGNKTIGVALSDPMFLLANGLETIKRKNASSDIERLREIINDNDVELIVVGLPKN 63

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MN + GP+     +FV ++I ++V +  V+ DER+TT+ ++ +LIDM+V R+ R + +D 
Sbjct: 64  MNNTIGPQAMRVMSFV-DLIKKQVDIEIVYQDERMTTIQSEAVLIDMDVRRENRKKYIDK 122

Query: 139 IAAALILQEVLDR 151
           IAA  ILQ  LDR
Sbjct: 123 IAATFILQTYLDR 135


>gi|309389102|gb|ADO76982.1| Holliday junction resolvase YqgF [Halanaerobium praevalens DSM
           2228]
          Length = 135

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 80/134 (59%), Gaps = 1/134 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  ID G KR+G+A+SD     A P   L      +  +E+  +I   ++   I+G+P N
Sbjct: 3   ILGIDYGNKRVGIAVSDALGWTAQPLVTLKMNGHQKLLVEIKKYIDKYDVEKIIVGMPYN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           ++GS G R   T+AF+ N ++ ++ +P    DERLTT  AQ IL++ +VSR+ R + +D 
Sbjct: 63  LDGSRGKRAEITQAFI-NFLNNQLEIPIQIQDERLTTKQAQNILLEADVSRQGRKKVIDK 121

Query: 139 IAAALILQEVLDRI 152
           +AA+LILQ  LD +
Sbjct: 122 LAASLILQSYLDSL 135


>gi|238018987|ref|ZP_04599413.1| hypothetical protein VEIDISOL_00849 [Veillonella dispar ATCC 17748]
 gi|313892893|ref|ZP_07826470.1| RNAse H domain protein, YqgF family [Veillonella sp. oral taxon 158
           str. F0412]
 gi|237864471|gb|EEP65761.1| hypothetical protein VEIDISOL_00849 [Veillonella dispar ATCC 17748]
 gi|313442246|gb|EFR60661.1| RNAse H domain protein, YqgF family [Veillonella sp. oral taxon 158
           str. F0412]
          Length = 139

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 78/136 (57%), Gaps = 1/136 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I S+D+G++ IG+A SD     A     + R  + +    L   I    +   ++G+P N
Sbjct: 3   IMSLDVGSRTIGIACSDALLMTAQGIETIRRTSLEKDFNRLQELIAEYEVHELVVGMPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG++G R   T  FV  M +  + +P  +WDERL+TV A++ LI  +VSRKKR   +D 
Sbjct: 63  MNGTKGERAEKTEEFVEKMKE-VIDLPVSYWDERLSTVMAERQLIAADVSRKKRKSVIDK 121

Query: 139 IAAALILQEVLDRISF 154
           +AA +ILQ  LDR+ F
Sbjct: 122 MAAVVILQGYLDRLQF 137


>gi|329926758|ref|ZP_08281166.1| RNAse H domain protein, YqgF family [Paenibacillus sp. HGF5]
 gi|328938958|gb|EGG35326.1| RNAse H domain protein, YqgF family [Paenibacillus sp. HGF5]
          Length = 137

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 77/134 (57%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + I  +D G +RIG+AISD     A     + R++       + + +    +   ++GLP
Sbjct: 2   KKIMGLDYGDRRIGVAISDVFGWTAQGVEVIERRRDEGELDRIAALVKDNEVGEIVVGLP 61

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR      F  N +   + +P   WDERL+TVSA++ L++ +VSRKKR Q V
Sbjct: 62  KNMNGTIGPRGEICMEFA-NTLRESLSLPVHLWDERLSTVSAERTLLEADVSRKKRKQVV 120

Query: 137 DSIAAALILQEVLD 150
           D +AA+LILQ  LD
Sbjct: 121 DKMAASLILQNYLD 134


>gi|160895347|ref|ZP_02076118.1| hypothetical protein CLOL250_02906 [Clostridium sp. L2-50]
 gi|156863040|gb|EDO56471.1| hypothetical protein CLOL250_02906 [Clostridium sp. L2-50]
          Length = 165

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 78/138 (56%), Gaps = 4/138 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFI 72
           N  I  +D GTK +G+A+SD     A P   + RK   K+ QT   + S I        +
Sbjct: 20  NMRIIGLDYGTKTVGVAVSDALMITAQPLETIERKSANKLRQTLARIESIIEEYQAERIV 79

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +G P NMN + G R  +T  F  ++ +R+  +  + WDERL+TV A++IL+D  V R+ R
Sbjct: 80  LGYPKNMNNTIGERAEATEQFKEDL-ERRTGLEVILWDERLSTVEAERILMDTGVRRENR 138

Query: 133 IQKVDSIAAALILQEVLD 150
            Q VD +AAA+ILQ  LD
Sbjct: 139 KQYVDKMAAAVILQNYLD 156


>gi|153953951|ref|YP_001394716.1| Holliday junction resolvase-like protein [Clostridium kluyveri DSM
           555]
 gi|219854565|ref|YP_002471687.1| hypothetical protein CKR_1222 [Clostridium kluyveri NBRC 12016]
 gi|189046093|sp|A5N7T7|RUVX_CLOK5 RecName: Full=Putative Holliday junction resolvase
 gi|254767509|sp|B9E198|RUVX_CLOK1 RecName: Full=Putative Holliday junction resolvase
 gi|146346832|gb|EDK33368.1| Predicted Holliday junction resolvase [Clostridium kluyveri DSM
           555]
 gi|219568289|dbj|BAH06273.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 137

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 77/135 (57%), Gaps = 1/135 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+A+SDP    A     + RK   +   EL +      +   + GLP N
Sbjct: 3   ILGLDIGNKTIGVALSDPLGITAQGITTIKRKGEDRDIEELKAICDKYKVEVIVCGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP+      F  N+I+  + +P   WDERLTTV+A + +++ ++SR KR + VD 
Sbjct: 63  MNGTLGPQSEKVLKFC-NIIEEVINLPIKMWDERLTTVAANKAMLEADLSRAKRKKIVDK 121

Query: 139 IAAALILQEVLDRIS 153
           +AA  ILQ  LDRIS
Sbjct: 122 MAATYILQGYLDRIS 136


>gi|303229331|ref|ZP_07316121.1| RNAse H domain protein, YqgF family [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302515867|gb|EFL57819.1| RNAse H domain protein, YqgF family [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 140

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 55/142 (38%), Positives = 80/142 (56%), Gaps = 7/142 (4%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D+G++ IG+A SD     A     + R  +      L   I+   +   ++G+P N
Sbjct: 3   IMALDVGSRTIGIACSDALLMTAQGIETIRRTSLENDFNRLRELISEYEVHELVVGMPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNM---IDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           MNG++G R   T  FV  M   ID    +P  FWDERL+TV A++ LI  +VSRKKR   
Sbjct: 63  MNGTKGERAEKTEEFVEKMKAVID----LPVTFWDERLSTVMAERQLIAADVSRKKRKGV 118

Query: 136 VDSIAAALILQEVLDRISFLES 157
           +D +AA +ILQ  LDR+ F +S
Sbjct: 119 IDKMAAVVILQGYLDRLQFSKS 140


>gi|259046501|ref|ZP_05736902.1| Holliday junction resolvase [Granulicatella adiacens ATCC 49175]
 gi|259036666|gb|EEW37921.1| Holliday junction resolvase [Granulicatella adiacens ATCC 49175]
          Length = 144

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 88/139 (63%), Gaps = 4/139 (2%)

Query: 15  PNQPIASIDLGTKRIGLAISD-PGRRFAHPRPFLVRKKVTQTALE-LLSFITTENIAAFI 72
           PN  +  +D+G+K +G+A+SD  G          + +K ++   + ++  +    +   +
Sbjct: 2   PNMRLMGLDVGSKTVGVAVSDLMGWTAQGVETIPINEKASEFGFKRVVELVEEYGVEKIV 61

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKK 131
           IGLP NMN +EGPRV ++R +  + +++++ +P VF DERLTT+ A+++L++  NVSRKK
Sbjct: 62  IGLPKNMNNTEGPRVEASRRYGAS-LEKRLQIPIVFHDERLTTMQAERMLVEEGNVSRKK 120

Query: 132 RIQKVDSIAAALILQEVLD 150
           R Q +D +AA +ILQ  LD
Sbjct: 121 RKQVIDMLAAVMILQNYLD 139


>gi|303230717|ref|ZP_07317464.1| RNAse H domain protein, YqgF family [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514477|gb|EFL56472.1| RNAse H domain protein, YqgF family [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 140

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/142 (38%), Positives = 80/142 (56%), Gaps = 7/142 (4%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D+G++ IG+A SD     A     + R  +      L   I+   +   ++G+P N
Sbjct: 3   IMALDVGSRTIGIACSDALLMTAQGIETIRRTSLENDFNRLRELISEYEVHELVVGMPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNM---IDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           MNG++G R   T  FV  M   ID    +P  FWDERL+TV A++ LI  +VSRKKR   
Sbjct: 63  MNGTKGDRAEKTEEFVEKMKAVID----LPVTFWDERLSTVMAERQLIAADVSRKKRKGV 118

Query: 136 VDSIAAALILQEVLDRISFLES 157
           +D +AA +ILQ  LDR+ F +S
Sbjct: 119 IDKMAAVVILQGYLDRLQFSKS 140


>gi|294792100|ref|ZP_06757248.1| putative Holliday junction resolvase [Veillonella sp. 6_1_27]
 gi|294793971|ref|ZP_06759108.1| putative Holliday junction resolvase [Veillonella sp. 3_1_44]
 gi|294455541|gb|EFG23913.1| putative Holliday junction resolvase [Veillonella sp. 3_1_44]
 gi|294457330|gb|EFG25692.1| putative Holliday junction resolvase [Veillonella sp. 6_1_27]
          Length = 136

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 78/134 (58%), Gaps = 1/134 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           S+D+G++ IG+A SD     A     + R  + +    L   I+   +   ++G+P NMN
Sbjct: 2   SLDVGSRTIGIACSDALLMTAQGIETIRRTSLEKDFNRLQELISEYEVHELVVGMPKNMN 61

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G++G R   T  FV  M +  + +P  +WDERL+TV A++ LI  +VSRKKR   +D +A
Sbjct: 62  GTKGERAEKTEEFVAKMKE-VIDLPVTYWDERLSTVMAERQLIAADVSRKKRKSVIDKMA 120

Query: 141 AALILQEVLDRISF 154
           A +ILQ  LDR+ F
Sbjct: 121 AVVILQGYLDRLQF 134


>gi|56963359|ref|YP_175090.1| holliday junction resolvase [Bacillus clausii KSM-K16]
 gi|62900942|sp|Q5WHM6|RUVX_BACSK RecName: Full=Putative Holliday junction resolvase
 gi|56909602|dbj|BAD64129.1| holliday junction resolvase [Bacillus clausii KSM-K16]
          Length = 142

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 78/135 (57%), Gaps = 3/135 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVT-QTALELLSFITTEN-IAAFIIGLPLN 78
            +D+GTK IG+AISD     A   P + R +       E L+ +  EN +   +IG P N
Sbjct: 5   GLDVGTKTIGVAISDAFGWTAQGLPTIQRSEDDPNRDFEALAQLIKENDVQKVVIGYPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ G     +  F   + +++  V  V WDERLTT +AQ++LID +VSRKKR + VD 
Sbjct: 65  MNGTVGESATRSETFARTL-EQQCNVQTVLWDERLTTAAAQRVLIDADVSRKKRKKAVDK 123

Query: 139 IAAALILQEVLDRIS 153
           +AA  ILQ  LDR S
Sbjct: 124 MAAVFILQGYLDRQS 138


>gi|329117501|ref|ZP_08246218.1| RNAse H domain protein, YqgF family [Streptococcus parauberis NCFD
           2020]
 gi|326907906|gb|EGE54820.1| RNAse H domain protein, YqgF family [Streptococcus parauberis NCFD
           2020]
          Length = 139

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 84/140 (60%), Gaps = 10/140 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFII 73
           I  +D+G+K +G+AISDP    A     +   K+ +   E     L   +    +  F++
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEII---KIDEDKKEFGLARLEELVNQYKVDKFVV 59

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
           GLP NMN S GPRV +++A+  N+I  +  +P  + DERLTTV A+++LI+  ++SR KR
Sbjct: 60  GLPKNMNNSSGPRVEASQAY-GNLIQEQFNIPVEYQDERLTTVQAERMLIEQADISRGKR 118

Query: 133 IQKVDSIAAALILQEVLDRI 152
            + +D +AA LILQ  LDRI
Sbjct: 119 KKVIDKLAAQLILQNYLDRI 138


>gi|325662158|ref|ZP_08150776.1| Holliday junction resolvase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325471607|gb|EGC74827.1| Holliday junction resolvase [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 148

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 78/141 (55%), Gaps = 4/141 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGLPL 77
            +D G+K +G+AISDP    A     + RK   K+ +T   + + +    +   ++G P 
Sbjct: 2   GLDYGSKTVGVAISDPLGLTAQGIETICRKEENKLRKTLARIEALVQEYQVEEIVLGFPK 61

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMN + G R   +  F   M++R+  +P   WDERLTTV A++ LI+ NV R+ R + VD
Sbjct: 62  NMNNTVGDRAEKSLEF-KEMLERRTALPVTMWDERLTTVEAERTLIENNVRREDRKKYVD 120

Query: 138 SIAAALILQEVLDRISFLESS 158
            IAA  ILQ  LD + F + S
Sbjct: 121 KIAAVFILQGYLDSVYFRQKS 141


>gi|149918360|ref|ZP_01906851.1| hypothetical protein PPSIR1_36632 [Plesiocystis pacifica SIR-1]
 gi|149820886|gb|EDM80295.1| hypothetical protein PPSIR1_36632 [Plesiocystis pacifica SIR-1]
          Length = 156

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 81/136 (59%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + ++D+G+K IGLA+SD G   AH R  L R+     +  +L+  +   + A ++GLPL 
Sbjct: 3   VLALDVGSKTIGLAVSDVGGSMAHAREVLRRQGHKLDSAAVLALASELEVRALVVGLPLE 62

Query: 79  MNGSEGPRVHSTRAFVHNM----IDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           ++GSEG R    R F+  +     + +  +P   WDER +T +A++ L++ +VSR KR Q
Sbjct: 63  LDGSEGHRARLVRRFLKVLEAAIAEAERALPVHTWDERYSTAAAERTLLEADVSRAKRKQ 122

Query: 135 KVDSIAAALILQEVLD 150
            +D++AA  ILQ  LD
Sbjct: 123 NIDAVAAQFILQGWLD 138


>gi|115375305|ref|ZP_01462569.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|310823720|ref|YP_003956078.1| holliday junction resolvase [Stigmatella aurantiaca DW4/3-1]
 gi|115367678|gb|EAU66649.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|309396792|gb|ADO74251.1| Holliday junction resolvase [Stigmatella aurantiaca DW4/3-1]
          Length = 150

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 78/130 (60%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLGTK IG+A+SD     A     + R  +      L         +  ++GLPLNM+
Sbjct: 5   GLDLGTKTIGVAVSDGLGLTAQALTTVRRTNLKADLAALAELAREHEASRIVLGLPLNMD 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSEGPR  ++R F  + + + +++P  FWDERL+TV+A++ L++ +++R KR Q +D +A
Sbjct: 65  GSEGPRAEASRKFA-DALGQALHLPVEFWDERLSTVAAERTLLEADLTRAKRKQVIDQMA 123

Query: 141 AALILQEVLD 150
           A  ILQ  LD
Sbjct: 124 AQFILQGWLD 133


>gi|313633177|gb|EFS00059.1| putative Holliday junction resolvase [Listeria seeligeri FSL
           N1-067]
 gi|313637761|gb|EFS03116.1| putative Holliday junction resolvase [Listeria seeligeri FSL
           S4-171]
          Length = 138

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 82/134 (61%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP G          + +K  Q   + +  +  E  +   ++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGWTAQGVETIQIDEKRKQFGYDRVKELVLEYEVEKVVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR + +
Sbjct: 63  KNMNNTIGPRAESSKIYAE-VLEARIGLPVVLWDERLTTTAAERTLIEADVSRKKRKEVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKLAAVMILQSYLD 135


>gi|320547640|ref|ZP_08041925.1| crossover junction endodeoxyribonuclease [Streptococcus equinus
           ATCC 9812]
 gi|320447715|gb|EFW88473.1| crossover junction endodeoxyribonuclease [Streptococcus equinus
           ATCC 9812]
          Length = 139

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 84/137 (61%), Gaps = 4/137 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+G+K +G+AISDP G          + ++  +   E L   +   N+  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGVEIIQIDEEAGEFGFERLGELVKQYNVDKFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN +EGPRV +++A+  + I     +P  + DERLTTV A+++L++  +VSR KR + 
Sbjct: 63  KNMNNTEGPRVEASKAY-GDQIKELFNIPVDYQDERLTTVQAERMLVEQADVSRGKRKKV 121

Query: 136 VDSIAAALILQEVLDRI 152
           +D +AA LILQ  LDR+
Sbjct: 122 IDKLAAQLILQNYLDRM 138


>gi|296110666|ref|YP_003621047.1| Holliday junction resolvase-like protein [Leuconostoc kimchii IMSNU
           11154]
 gi|295832197|gb|ADG40078.1| Holliday junction resolvase-like protein [Leuconostoc kimchii IMSNU
           11154]
          Length = 143

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 81/135 (60%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIA-AFIIGLP 76
           I  +D+G++ +G+A+SDP    A     + + +   +  LE L  I  +  A   ++GLP
Sbjct: 3   ILGLDVGSRTVGVAVSDPMGWTAQGVEIIRINEDEKEFGLERLGEIIKDKQAKGVVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQK 135
            NMN SEGPR  ++R +   M+  K  +P  F DERLTTV A+++LI+  N+SRKKR Q 
Sbjct: 63  KNMNNSEGPRAEASRLYAK-MVQDKFNLPIDFQDERLTTVQAERMLIEEANISRKKRKQV 121

Query: 136 VDSIAAALILQEVLD 150
           +D IAA  ILQ  LD
Sbjct: 122 IDKIAAEFILQNYLD 136


>gi|323483777|ref|ZP_08089157.1| hypothetical protein HMPREF9474_00906 [Clostridium symbiosum
           WAL-14163]
 gi|323692750|ref|ZP_08106978.1| hypothetical protein HMPREF9475_01841 [Clostridium symbiosum
           WAL-14673]
 gi|323402968|gb|EGA95286.1| hypothetical protein HMPREF9474_00906 [Clostridium symbiosum
           WAL-14163]
 gi|323503192|gb|EGB19026.1| hypothetical protein HMPREF9475_01841 [Clostridium symbiosum
           WAL-14673]
          Length = 163

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 78/139 (56%), Gaps = 4/139 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           +  +D G+K  G+A+SDP    A     + R+   K+ +T   +   I    I   ++G 
Sbjct: 17  VLGLDFGSKTTGVAVSDPLGFTAQGLETITREDENKLRRTCARIEELIREYQIETIVLGY 76

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G RV  T AF   M++R+  +  + WDERLTT +A+QILI+  V R+ R   
Sbjct: 77  PKNMNNTSGERVEKTLAF-KEMLERRTGLSVILWDERLTTTAAEQILIESGVRRENRKAV 135

Query: 136 VDSIAAALILQEVLDRISF 154
           +D +AA+LILQ  LD ++ 
Sbjct: 136 IDKVAASLILQGYLDSLAI 154


>gi|258543587|ref|YP_003189020.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634665|dbj|BAI00641.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-01]
 gi|256637721|dbj|BAI03690.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-03]
 gi|256640775|dbj|BAI06737.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-07]
 gi|256643830|dbj|BAI09785.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646885|dbj|BAI12833.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649938|dbj|BAI15879.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652928|dbj|BAI18862.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655982|dbj|BAI21909.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-12]
          Length = 154

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 89/153 (58%), Gaps = 2/153 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L + DLV +L  +  +  ID G K++GLA+SD  R  A P   + R K+ Q A  + 
Sbjct: 1   MTLLSLTDLVATLPRHARLLGIDPGKKQVGLALSDVSRMVASPFQTVKRGKLGQMASFIR 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                  I   ++G+PL+++GS GP   ++R +   + + +  +P   WDERL++ +  +
Sbjct: 61  DLAKEHEIGGMVVGIPLSLDGSFGPAAQASRDWALALSE-QTGLPVCQWDERLSSSAVNR 119

Query: 121 ILID-MNVSRKKRIQKVDSIAAALILQEVLDRI 152
           +LID  ++SR +R + VD +AAA ILQ  LD +
Sbjct: 120 MLIDEADLSRARRAEMVDRLAAAYILQAALDSL 152


>gi|221632739|ref|YP_002521960.1| hypothetical protein trd_0729 [Thermomicrobium roseum DSM 5159]
 gi|221156262|gb|ACM05389.1| conserved hypothetical protein TIGR00250 [Thermomicrobium roseum
           DSM 5159]
          Length = 161

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/131 (39%), Positives = 80/131 (61%), Gaps = 5/131 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-LLSFITTENIAAFIIGLPLNM 79
            +D+G +R+G+AISD     A P   L    + +  LE L+  I+  +    ++GLP+ M
Sbjct: 11  GLDVGGRRVGVAISDEMGMIASP---LATIDLDRDGLERLVELISRYDPVLIVVGLPVTM 67

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
            G EG +   T+AF   + +R +  P VFWDERLT+ +A+++L D  V RK+R + VD++
Sbjct: 68  RGREGSQAVETKAFAARLAER-IDRPIVFWDERLTSSAAERLLTDAGVGRKRRRELVDAV 126

Query: 140 AAALILQEVLD 150
           AAAL+LQ  LD
Sbjct: 127 AAALLLQSYLD 137


>gi|289434782|ref|YP_003464654.1| holliday junction resolvase, putative [Listeria seeligeri serovar
           1/2b str. SLCC3954]
 gi|289171026|emb|CBH27568.1| holliday junction resolvase, putative [Listeria seeligeri serovar
           1/2b str. SLCC3954]
          Length = 135

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 81/132 (61%), Gaps = 3/132 (2%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +D+G+K +G+AISDP G          + +K  Q   + +  +  E  +   ++GLP N
Sbjct: 2   GLDVGSKTVGVAISDPLGWTAQGVETIQIDEKRKQFGYDRVKELVLEYEVEKVVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR + +D 
Sbjct: 62  MNNTIGPRAESSKIYAE-VLEARIGLPVVLWDERLTTTAAERTLIEADVSRKKRKEVIDK 120

Query: 139 IAAALILQEVLD 150
           +AA +ILQ  LD
Sbjct: 121 LAAVMILQSYLD 132


>gi|108758109|ref|YP_633960.1| hypothetical protein MXAN_5823 [Myxococcus xanthus DK 1622]
 gi|118597216|sp|Q1D063|RUVX_MYXXD RecName: Full=Putative Holliday junction resolvase
 gi|108461989|gb|ABF87174.1| conserved hypothetical protein TIGR00250 [Myxococcus xanthus DK
           1622]
          Length = 151

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/131 (39%), Positives = 81/131 (61%), Gaps = 3/131 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN-IAAFIIGLPLNM 79
            +DLGTK IG+A+SD G          VR+   +  L  L+ + +E+ +   ++GLPLNM
Sbjct: 5   GLDLGTKTIGVAVSD-GLGLTAQGITTVRRTSLKADLAALATVASEHEVTHVVLGLPLNM 63

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +GSEGPR  ++R F  + + + + V    WDERL+TV+A + L++ +VSR +R + +D +
Sbjct: 64  DGSEGPRAEASRKFA-DTLAQSLGVTVELWDERLSTVAATRTLLEADVSRARRREVIDQV 122

Query: 140 AAALILQEVLD 150
           AA  ILQ  LD
Sbjct: 123 AAQFILQGWLD 133


>gi|256545147|ref|ZP_05472513.1| Holliday junction resolvase [Anaerococcus vaginalis ATCC 51170]
 gi|256399188|gb|EEU12799.1| Holliday junction resolvase [Anaerococcus vaginalis ATCC 51170]
          Length = 139

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 78/132 (59%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +DLG K IG+A+SDP    A     + RKK +    +L+  I  + +   IIGLP N
Sbjct: 4   IMGLDLGDKTIGVALSDPFFITAQAYITIKRKKASLDIEKLIEIINEKEVNLIIIGLPKN 63

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MN + GP+     +FV +++ +   +   + DER+TT+ + Q+L+DMNV+ K R + VD 
Sbjct: 64  MNNTLGPQAMKVISFV-DLLKKSTDIEIKYQDERMTTIQSDQVLMDMNVNLKDRKKYVDK 122

Query: 139 IAAALILQEVLD 150
           IAA+ ILQ  LD
Sbjct: 123 IAASFILQTYLD 134


>gi|291522741|emb|CBK81034.1| conserved hypothetical protein TIGR00250 [Coprococcus catus GD/7]
          Length = 155

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 82/142 (57%), Gaps = 4/142 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+A+SDP    A     + RK   K+ +T   + + I        ++G 
Sbjct: 5   IIGLDYGSKTVGVAVSDPLGFTAQGLETITRKDENKLRKTYARIEALIREYEAEQIVLGY 64

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN +EG RV  T AF    ++R+  +  + WDER++TV+++++L++ NV R+ R   
Sbjct: 65  PKNMNDTEGERVEKTLAF-KEALERRTGLEVILWDERMSTVASERVLMEGNVRREDRKTY 123

Query: 136 VDSIAAALILQEVLDRISFLES 157
           +D +AAA ILQ  LD  SF E+
Sbjct: 124 IDKMAAAFILQGYLDYQSFSEN 145


>gi|116626054|ref|YP_828210.1| Holliday junction resolvase YqgF [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229216|gb|ABJ87925.1| Holliday junction resolvase YqgF [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 140

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 75/132 (56%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++DLG +RIGLAISDP R  A   P LVR ++      L   +    +   ++G P+N
Sbjct: 8   ILALDLGKRRIGLAISDPLRITAQGLPNLVRTRIRDDLDALEQLVKEREVGLVLLGNPIN 67

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M G+EG +    R F   M +++  VP   WDERLT+V A ++L    +S +KR   VD 
Sbjct: 68  MKGTEGRQSGWVREFATAM-EKRTGVPVKLWDERLTSVEAGRVLRSSGISIEKRAAAVDK 126

Query: 139 IAAALILQEVLD 150
           ++A ++LQ  LD
Sbjct: 127 LSAVILLQSYLD 138


>gi|297584728|ref|YP_003700508.1| Holliday junction resolvase YqgF [Bacillus selenitireducens MLS10]
 gi|297143185|gb|ADH99942.1| Holliday junction resolvase YqgF [Bacillus selenitireducens MLS10]
          Length = 138

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 74/134 (55%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIGLP 76
           I  +D+GTK IG+A+SDP    A       RKK  +      ++  +  E     ++GLP
Sbjct: 3   IIGLDVGTKTIGIAVSDPFGWTAQGVETHRRKKGKENEDVQRIVDLVEEEGAEQIVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP     +AF  ++      +P + WDERLTT +A++ LI  +VSRKKR   +
Sbjct: 63  KNMNGTIGPSGELCQAFAESL-KEATGLPVILWDERLTTAAAEKTLISADVSRKKRKNVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA  ILQ  LD
Sbjct: 122 DKMAAVFILQGYLD 135


>gi|225387769|ref|ZP_03757533.1| hypothetical protein CLOSTASPAR_01539 [Clostridium asparagiforme
           DSM 15981]
 gi|225046130|gb|EEG56376.1| hypothetical protein CLOSTASPAR_01539 [Clostridium asparagiforme
           DSM 15981]
          Length = 151

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 77/139 (55%), Gaps = 4/139 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+A+ DP    A     +VRK   K+ +T   +   I    I   ++G 
Sbjct: 3   IMGLDYGSKTVGVAVCDPLGITAQTVETIVRKDENKLRKTLARIEELIGAYEIERIVLGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R           ++R+  +P + WDERLTTV+A ++L++  V R+ R + 
Sbjct: 63  PKNMNNTVGERAQKAEEL-KAALERRTGLPVILWDERLTTVAADRVLMESGVRREHRKES 121

Query: 136 VDSIAAALILQEVLDRISF 154
           VD IAAA+ILQ  LD +SF
Sbjct: 122 VDQIAAAMILQGYLDNLSF 140


>gi|116872931|ref|YP_849712.1| holliday junction resolvase, putative [Listeria welshimeri serovar
           6b str. SLCC5334]
 gi|116741809|emb|CAK20933.1| holliday junction resolvase, putative [Listeria welshimeri serovar
           6b str. SLCC5334]
          Length = 135

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 81/132 (61%), Gaps = 3/132 (2%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +D+G+K +G+AISDP G          + +K  Q   + +  +  E  +   ++GLP N
Sbjct: 2   GLDVGSKTVGVAISDPLGWTAQGVETIQIDEKRKQFGYDRVKELVLEYEVEKVVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR + +D 
Sbjct: 62  MNNTIGPRAESSKIYAE-VLEARIGLPVVLWDERLTTSAAERTLIEADVSRKKRKEVIDK 120

Query: 139 IAAALILQEVLD 150
           +AA +ILQ  LD
Sbjct: 121 LAAVMILQSYLD 132


>gi|220929652|ref|YP_002506561.1| Holliday junction resolvase-like protein [Clostridium
           cellulolyticum H10]
 gi|254767508|sp|B8I4S7|RUVX_CLOCE RecName: Full=Putative Holliday junction resolvase
 gi|219999980|gb|ACL76581.1| Holliday junction resolvase YqgF [Clostridium cellulolyticum H10]
          Length = 142

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 78/136 (57%), Gaps = 2/136 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPL 77
           I  ID G  RIG+AISDP    A     +  K   + A+  LS I  E ++   +IG P+
Sbjct: 3   ILGIDYGDSRIGVAISDPMGWTAQGLEMIKSKDSLKKAVLRLSEIINEYSVTDIVIGYPI 62

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMNG++GPR   T  F+  + D   +   + WDERLTTVSA + + ++ +   K+   VD
Sbjct: 63  NMNGTKGPRTERTEEFIKKISDLGQF-NIIKWDERLTTVSAHRTMNELGIKASKKKGIVD 121

Query: 138 SIAAALILQEVLDRIS 153
           +++A LILQ  LDRI+
Sbjct: 122 TMSAVLILQGYLDRIA 137


>gi|58040808|ref|YP_192772.1| DNA integration/recombination/invertion protein [Gluconobacter
           oxydans 621H]
 gi|62900900|sp|Q5FND1|RUVX_GLUOX RecName: Full=Putative Holliday junction resolvase
 gi|58003222|gb|AAW62116.1| DNA integration/recombination/invertion protein [Gluconobacter
           oxydans 621H]
          Length = 160

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 85/144 (59%), Gaps = 2/144 (1%)

Query: 8   DLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN 67
           DL   L+  Q +  +D G+K IG+A++D     A P   L R+K+ + A EL   + T++
Sbjct: 8   DLRNLLQSGQRVLGLDPGSKTIGVALTDVSLMLASPLIGLKRRKLGENAQELAKIVRTQD 67

Query: 68  IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMN 126
           + A ++GLPL+++GS GP   +   +    +  K+ +P   WDERL++ +  + LI D +
Sbjct: 68  VGALVVGLPLSLDGSFGPAARAASDWTQ-ALSEKLGIPAGLWDERLSSSAVNRFLIKDAD 126

Query: 127 VSRKKRIQKVDSIAAALILQEVLD 150
           ++R +R + VD +AAA +LQ  LD
Sbjct: 127 MTRGRRAEVVDKMAAAYMLQGWLD 150


>gi|311031560|ref|ZP_07709650.1| Holliday junction resolvase-like protein [Bacillus sp. m3-13]
          Length = 138

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 55/138 (39%), Positives = 84/138 (60%), Gaps = 11/138 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAA------FI 72
           I  +D+G+K +G+AISD           L   K+ + A++ L F   + I A       +
Sbjct: 3   ILGLDVGSKTVGVAISD---EMGWTAQGLETIKIDE-AIKNLGFKRLKQIIAEYKPEKVV 58

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLP NMNGS GPR  +++ +   M+  K  +P ++WDERL+TV+A++IL+  +VSRKKR
Sbjct: 59  VGLPKNMNGSIGPRGEASKHY-GEMLTAKTGLPVIYWDERLSTVAAERILLSADVSRKKR 117

Query: 133 IQKVDSIAAALILQEVLD 150
            Q +D +AA +ILQ  LD
Sbjct: 118 KQVIDKMAAVVILQGYLD 135


>gi|309791342|ref|ZP_07685865.1| Holliday junction resolvase YqgF [Oscillochloris trichoides DG6]
 gi|308226652|gb|EFO80357.1| Holliday junction resolvase YqgF [Oscillochloris trichoides DG6]
          Length = 148

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 79/137 (57%), Gaps = 1/137 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            Q +  +D+G +RIG+A+SD     A P   +     +Q    +   +    +   ++GL
Sbjct: 3   EQRLLGLDVGDRRIGVALSDALGMLASPLTTINANPRSQAITMIARLVREHEVQGIVVGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PL + G  GP+   TR+F   + +R+V +P + +DER TT  A+Q+L +M V  +KR Q+
Sbjct: 63  PLTLRGEIGPQAEQTRSFAQEL-ERQVGLPVMLFDERYTTTVAEQLLREMGVKPEKRKQQ 121

Query: 136 VDSIAAALILQEVLDRI 152
           +D +AA++ILQ+ LD I
Sbjct: 122 IDQVAASIILQDYLDHI 138


>gi|258592801|emb|CBE69110.1| putative Holliday junction resolvase [NC10 bacterium 'Dutch
           sediment']
          Length = 144

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 74/135 (54%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           Q    ID GTKRIG+AISD     A P P L           +   +    I   ++GLP
Sbjct: 2   QRYLGIDFGTKRIGVAISDELGLTAQPLPTLEPSTDEAAVRAIREIMDQYGILDVVVGLP 61

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP      AF    ++    V    WDERLT+++A+++LI+ ++SR KR ++V
Sbjct: 62  KNMNGTLGPSAERALAFA-GQLEEGGSVKVTMWDERLTSLAAERLLIEADLSRAKRKRRV 120

Query: 137 DSIAAALILQEVLDR 151
           D +AA LILQ  LDR
Sbjct: 121 DQMAAVLILQGFLDR 135


>gi|56416955|ref|YP_154029.1| hypothetical protein AM859 [Anaplasma marginale str. St. Maries]
 gi|222475321|ref|YP_002563738.1| Putative Holliday junction resolvase (YqgF) [Anaplasma marginale
           str. Florida]
 gi|56388187|gb|AAV86774.1| hypothetical protein AM859 [Anaplasma marginale str. St. Maries]
 gi|222419459|gb|ACM49482.1| Putative Holliday junction resolvase (YqgF) [Anaplasma marginale
           str. Florida]
          Length = 164

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 80/146 (54%), Gaps = 3/146 (2%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           IE    +L  ++ I  +D G K+ GLA+SD     A P    +R+ V Q   EL + +  
Sbjct: 13  IESFFGALGADRRILGLDFGEKKFGLAVSDSTGTIAMPHSVYLRRNVRQDLGELNAILKR 72

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
           E I A ++GLPL ++G EG      R+FV  +I +K  V     DER TT  A +    +
Sbjct: 73  EGICAAVVGLPLQLDGMEGEMCAVVRSFVQKLI-KKSGVYVYLHDERFTTAMASRTTESL 131

Query: 126 NVSRKKRIQKVDS-IAAALILQEVLD 150
            + R+K  QKVD  I+AALILQ+VLD
Sbjct: 132 GL-RRKASQKVDDKISAALILQQVLD 156


>gi|154686879|ref|YP_001422040.1| Holliday junction resolvase-like protein [Bacillus
           amyloliquefaciens FZB42]
 gi|308174438|ref|YP_003921143.1| Holliday junction resolvase [Bacillus amyloliquefaciens DSM 7]
 gi|167012691|sp|A7Z733|RUVX_BACA2 RecName: Full=Putative Holliday junction resolvase
 gi|154352730|gb|ABS74809.1| YrrK [Bacillus amyloliquefaciens FZB42]
 gi|307607302|emb|CBI43673.1| putative Holliday junction resolvase [Bacillus amyloliquefaciens
           DSM 7]
          Length = 138

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 83/137 (60%), Gaps = 3/137 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +DLGTK +G+A+SD  G          + +      L+ LS +  + N+   ++G P
Sbjct: 3   ILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLDRLSELMKDYNVEKIVLGFP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  +++ F   +++    VP V WDERLTT++A+++LI  +VSR+KR + +
Sbjct: 63  KNMNGTIGPRGEASQTFAK-LLETAYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKKVI 121

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA +ILQ  LD ++
Sbjct: 122 DKMAAVMILQGYLDSLN 138


>gi|254995134|ref|ZP_05277324.1| Putative Holliday junction resolvase (YqgF) [Anaplasma marginale
           str. Mississippi]
 gi|255003304|ref|ZP_05278268.1| Putative Holliday junction resolvase (YqgF) [Anaplasma marginale
           str. Puerto Rico]
 gi|255004430|ref|ZP_05279231.1| Putative Holliday junction resolvase (YqgF) [Anaplasma marginale
           str. Virginia]
 gi|62900915|sp|Q5PAA6|RUVX_ANAMM RecName: Full=Putative Holliday junction resolvase
          Length = 157

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 80/146 (54%), Gaps = 3/146 (2%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           IE    +L  ++ I  +D G K+ GLA+SD     A P    +R+ V Q   EL + +  
Sbjct: 6   IESFFGALGADRRILGLDFGEKKFGLAVSDSTGTIAMPHSVYLRRNVRQDLGELNAILKR 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
           E I A ++GLPL ++G EG      R+FV  +I +K  V     DER TT  A +    +
Sbjct: 66  EGICAAVVGLPLQLDGMEGEMCAVVRSFVQKLI-KKSGVYVYLHDERFTTAMASRTTESL 124

Query: 126 NVSRKKRIQKVDS-IAAALILQEVLD 150
            + R+K  QKVD  I+AALILQ+VLD
Sbjct: 125 GL-RRKASQKVDDKISAALILQQVLD 149


>gi|304407567|ref|ZP_07389219.1| Holliday junction resolvase YqgF [Paenibacillus curdlanolyticus
           YK9]
 gi|304343518|gb|EFM09360.1| Holliday junction resolvase YqgF [Paenibacillus curdlanolyticus
           YK9]
          Length = 138

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 73/132 (55%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D G + IG+A+SD     A     + R+       E+   +    +   ++GLP N
Sbjct: 3   IMGLDYGDRNIGVAVSDAFGWTAQGTGVVQRRHNRGEFDEIAQLVKDHEVTEIVVGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNGS GPR     AF   +  +K+ +P   WDERLTTVSA++ L++ +VSRKKR   VD 
Sbjct: 63  MNGSVGPRGEICIAFAEEL-QQKLNLPVHLWDERLTTVSAERTLLEADVSRKKRKLVVDK 121

Query: 139 IAAALILQEVLD 150
           +AA  ILQ  LD
Sbjct: 122 LAATFILQNYLD 133


>gi|300173637|ref|YP_003772803.1| putative Holliday junction resolvase [Leuconostoc gasicomitatum LMG
           18811]
 gi|299888016|emb|CBL91984.1| Putative Holliday junction resolvase [Leuconostoc gasicomitatum LMG
           18811]
          Length = 143

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 82/135 (60%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIA-AFIIGLP 76
           I  +D+G++ +G+++SDP    A     + + +   +  L+ L  I  E  A + ++GLP
Sbjct: 3   ILGLDVGSRTVGVSVSDPMGWTAQGVEIIRINEDENEFGLQRLGEIIKEKQAKSVVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQK 135
            NMN SEGPR  + R +   M++ +  +P  F DERLTTV A+++LI+  +VSRKKR Q 
Sbjct: 63  KNMNNSEGPRAEAARNYAK-MVEERFELPTDFQDERLTTVQAERMLIEEADVSRKKRKQV 121

Query: 136 VDSIAAALILQEVLD 150
           +D IAA  ILQ  LD
Sbjct: 122 IDKIAAEFILQNYLD 136


>gi|168054242|ref|XP_001779541.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162669022|gb|EDQ55617.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 171

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 86/162 (53%), Gaps = 4/162 (2%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVT--QTALE 58
           M ++ ++ L + L     +  +D+G++ IGLA+SDP  R A P   + R   T  +    
Sbjct: 1   MELVSLKQLFQRLSSGGRLLGLDVGSRNIGLAVSDPKCRIASPHSVMYRSNTTTLKNISR 60

Query: 59  LLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVH--NMIDRKVYVPFVFWDERLTTV 116
           L S +   NI   +IG PL + G +G +    + F     M  R   + +V+WDERLT+V
Sbjct: 61  LESLVQEMNITGLVIGYPLELTGFQGKQGAQVKLFAKELQMSGRFPNLAYVYWDERLTSV 120

Query: 117 SAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           +   ++  M+++ ++R   VD ++A  ILQ  LD +S +E+ 
Sbjct: 121 AVTNVIGSMDITGRRRKNIVDKMSALCILQGCLDSLSRIENG 162


>gi|302391206|ref|YP_003827026.1| Holliday junction resolvase YqgF [Acetohalobium arabaticum DSM
           5501]
 gi|302203283|gb|ADL11961.1| Holliday junction resolvase YqgF [Acetohalobium arabaticum DSM
           5501]
          Length = 138

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 72/132 (54%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D G KRIG A SD     A  +  +      +   E+ S I   ++   ++GLP N
Sbjct: 4   ILGLDFGDKRIGAATSDALGWTAQGKKVIQNTSWEEVVAEINSLIEQYDVGKVVVGLPKN 63

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GPR   T  FV  +   ++  P + WDERL+T +A++ L+  +VSR KR   +D 
Sbjct: 64  MNGTLGPRAEKTLDFVEQL-KEEIEPPIITWDERLSTAAAERTLLKADVSRAKRKDVIDK 122

Query: 139 IAAALILQEVLD 150
           +AA +ILQ  LD
Sbjct: 123 MAAVVILQSYLD 134


>gi|46907730|ref|YP_014119.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47093424|ref|ZP_00231189.1| conserved hypothetical protein TIGR00250 [Listeria monocytogenes
           str. 4b H7858]
 gi|226224103|ref|YP_002758210.1| hypothetical protein Lm4b_01512 [Listeria monocytogenes Clip81459]
 gi|254824439|ref|ZP_05229440.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|254852126|ref|ZP_05241474.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|254931437|ref|ZP_05264796.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|255521191|ref|ZP_05388428.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           FSL J1-175]
 gi|300764832|ref|ZP_07074822.1| conserved hypothetical protein [Listeria monocytogenes FSL N1-017]
 gi|62900990|sp|Q71ZG8|RUVX_LISMF RecName: Full=Putative Holliday junction resolvase
 gi|259495707|sp|C1KVE9|RUVX_LISMC RecName: Full=Putative Holliday junction resolvase
 gi|46880999|gb|AAT04296.1| conserved hypothetical protein TIGR00250 [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47018203|gb|EAL08971.1| conserved hypothetical protein TIGR00250 [Listeria monocytogenes
           str. 4b H7858]
 gi|225876565|emb|CAS05274.1| Hypothetical protein of unknown function [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|258605429|gb|EEW18037.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|293582988|gb|EFF95020.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|293593675|gb|EFG01436.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|300514508|gb|EFK41565.1| conserved hypothetical protein [Listeria monocytogenes FSL N1-017]
 gi|328465540|gb|EGF36769.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           1816]
          Length = 138

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 81/134 (60%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP G          + +   Q   + +  +  E  +   ++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGWTAQGVETIQIDENRKQFGYDRVKELVLEYEVEKVVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR + +
Sbjct: 63  KNMNNTIGPRAESSKIYAE-VLESRIGLPVVLWDERLTTSAAERTLIEADVSRKKRKEVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKLAAVMILQSYLD 135


>gi|328554357|gb|AEB24849.1| Holliday junction resolvase-like protein [Bacillus
           amyloliquefaciens TA208]
 gi|328912761|gb|AEB64357.1| Putative Holliday junction resolvase [Bacillus amyloliquefaciens
           LL3]
          Length = 138

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 83/137 (60%), Gaps = 3/137 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +DLGTK +G+A+SD  G          + +      L+ LS +  + N+   ++G P
Sbjct: 3   ILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLDRLSELMKDYNVEKIVLGFP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  +++ F   +++    VP V WDERLTT++A+++LI  +VSR+KR + +
Sbjct: 63  KNMNGTIGPRGEASQTFAK-LLETAYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKKVI 121

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA +ILQ  LD ++
Sbjct: 122 DKMAAVMILQGFLDSLN 138


>gi|150015990|ref|YP_001308244.1| Holliday junction resolvase-like protein [Clostridium beijerinckii
           NCIMB 8052]
 gi|189046092|sp|A6LSF8|RUVX_CLOB8 RecName: Full=Putative Holliday junction resolvase
 gi|149902455|gb|ABR33288.1| Holliday junction resolvase YqgF [Clostridium beijerinckii NCIMB
           8052]
          Length = 138

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 77/135 (57%), Gaps = 1/135 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +DLG+K IG+A+SDP    A     + R    +   E+  F    +    +IGLP N
Sbjct: 3   ILGLDLGSKTIGVAVSDPLGFTAQGLTTVRRTNKEKDIAEIKKFCDEYDAKVIVIGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP      AF   +I+ ++ V   FWDERLTTV+A + +++ ++SR KR + VD 
Sbjct: 63  MNGTIGPSGEIAMAF-GKVIEEELNVEVKFWDERLTTVAAHKAMLEADLSRNKRKKIVDK 121

Query: 139 IAAALILQEVLDRIS 153
           +A+  ILQ  LD IS
Sbjct: 122 VASTYILQGYLDMIS 136


>gi|322374034|ref|ZP_08048568.1| putative Holliday junction resolvase [Streptococcus sp. C150]
 gi|321277000|gb|EFX54071.1| putative Holliday junction resolvase [Streptococcus sp. C150]
          Length = 139

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 84/140 (60%), Gaps = 10/140 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFII 73
           +  +D+G+K +G+AISDP    A     +   K+ + A E     L   +    +  F++
Sbjct: 3   VMGLDVGSKTVGVAISDPLGFTAQGVEII---KIDEEAEEFGFDRLGELVKEYKVDKFVV 59

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
           GLP NMN +EGPRV +++A+  N I     +P  + DERLTTV A+++L++  +VSR KR
Sbjct: 60  GLPKNMNNTEGPRVEASKAY-GNKIKEIFGIPVDYQDERLTTVQAERMLVEQADVSRGKR 118

Query: 133 IQKVDSIAAALILQEVLDRI 152
            + +D +AA LILQ  LDR+
Sbjct: 119 KKVIDKLAAQLILQNYLDRM 138


>gi|51893132|ref|YP_075823.1| hypothetical protein STH1994 [Symbiobacterium thermophilum IAM
           14863]
 gi|62900963|sp|Q67MW4|RUVX_SYMTH RecName: Full=Putative Holliday junction resolvase
 gi|51856821|dbj|BAD40979.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 144

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 78/132 (59%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+A+SD     A     + R+ + Q    L        +  +++G+P N
Sbjct: 3   IGGLDVGEKTIGVALSDELGLTAQALEVIRRRSLEQDLARLDEIARHYGVVRWVVGMPRN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GPR   TRAF+  +      +P   WDERL+T++A+++L++ +VSR +R + +D 
Sbjct: 63  MNGTYGPRAELTRAFMERLAGHS-GLPVEAWDERLSTMAAERVLLEADVSRARRRKVIDK 121

Query: 139 IAAALILQEVLD 150
           +AAA+ILQ  LD
Sbjct: 122 MAAAVILQGYLD 133


>gi|227498473|ref|ZP_03928619.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226903931|gb|EEH89849.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 138

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 74/132 (56%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +DLGT+ IG+A+SD     A     + R         L   +  E + AF++G P N
Sbjct: 3   IMGLDLGTRTIGVAVSDEMGLIARGIETIRRSGTKNDLARLHELVQKEEVGAFVLGYPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ G R  ++ AF   +           WDERL+TV+A+++LID +++RKKR + +D 
Sbjct: 63  MNGTIGERGKASEAFSKLLQTEFPDAKITLWDERLSTVAAEKVLIDADLTRKKRKKVIDM 122

Query: 139 IAAALILQEVLD 150
           +AA +ILQ  LD
Sbjct: 123 MAAVVILQNYLD 134


>gi|16800605|ref|NP_470873.1| Holliday junction resolvase-like protein [Listeria innocua
           Clip11262]
 gi|32130053|sp|Q92BL1|RUVX_LISIN RecName: Full=Putative Holliday junction resolvase
 gi|16414010|emb|CAC96768.1| lin1537 [Listeria innocua Clip11262]
 gi|313618843|gb|EFR90723.1| putative Holliday junction resolvase [Listeria innocua FSL S4-378]
 gi|313623694|gb|EFR93845.1| putative Holliday junction resolvase [Listeria innocua FSL J1-023]
          Length = 138

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 81/134 (60%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP G          + +   Q   + +  +  E  +   ++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGWTAQGVETIQIDESRKQFGYDRVKELVLEYEVEKVVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR + +
Sbjct: 63  KNMNNTIGPRAESSKIYAE-VLESRIGLPVVLWDERLTTSAAERTLIEADVSRKKRKEVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKLAAVMILQSYLD 135


>gi|319940102|ref|ZP_08014456.1| crossover junction endodeoxyribonuclease [Streptococcus anginosus
           1_2_62CV]
 gi|319810816|gb|EFW07143.1| crossover junction endodeoxyribonuclease [Streptococcus anginosus
           1_2_62CV]
          Length = 139

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 88/136 (64%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+A+SDP    A     + + ++  +   + LS +  E  +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAVSDPLGFTAQGLEIIPIDEEKGEFGFDRLSELVKEYKVNKFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+    I++  ++P  + DERLTTV+A+++LI+  +VSRKKR + 
Sbjct: 63  KNMNNTSGPRVEASQAY-GAKIEQLFHLPVEYQDERLTTVAAERMLIEQADVSRKKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|296875599|ref|ZP_06899670.1| crossover junction endodeoxyribonuclease [Streptococcus
           parasanguinis ATCC 15912]
 gi|296433396|gb|EFH19172.1| crossover junction endodeoxyribonuclease [Streptococcus
           parasanguinis ATCC 15912]
          Length = 139

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 85/136 (62%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+G+K +G+A+SDP    A     + + +   +  LE L+  +    +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAVSDPLGFTAQGLEIIQIDEDKKEFGLERLAELVAQYKVDRFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+   MI  K  +P  + DERLTTV+A+++LI+  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAY-GTMIAEKFGLPVDYQDERLTTVAAERMLIEQADISRSKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|16803542|ref|NP_465027.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           EGD-e]
 gi|224500668|ref|ZP_03669017.1| hypothetical protein LmonF1_13746 [Listeria monocytogenes Finland
           1988]
 gi|224501558|ref|ZP_03669865.1| hypothetical protein LmonFR_03407 [Listeria monocytogenes FSL
           R2-561]
 gi|254828264|ref|ZP_05232951.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|254829739|ref|ZP_05234394.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           10403S]
 gi|254898332|ref|ZP_05258256.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           J0161]
 gi|254912176|ref|ZP_05262188.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254936504|ref|ZP_05268201.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|255018845|ref|ZP_05290971.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           FSL F2-515]
 gi|290893861|ref|ZP_06556839.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
 gi|315282410|ref|ZP_07870829.1| putative Holliday junction resolvase [Listeria marthii FSL S4-120]
 gi|32130047|sp|Q8Y723|RUVX_LISMO RecName: Full=Putative Holliday junction resolvase
 gi|16410931|emb|CAC99580.1| lmo1502 [Listeria monocytogenes EGD-e]
 gi|258600652|gb|EEW13977.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|258609098|gb|EEW21706.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|290556578|gb|EFD90114.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
 gi|293590149|gb|EFF98483.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|313608700|gb|EFR84531.1| putative Holliday junction resolvase [Listeria monocytogenes FSL
           F2-208]
 gi|313613944|gb|EFR87669.1| putative Holliday junction resolvase [Listeria marthii FSL S4-120]
          Length = 138

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 81/134 (60%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP G          + +   Q   + +  +  E  +   ++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGWTAQGVETIQIDENRKQFGYDRVKELVLEYEVEKVVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR + +
Sbjct: 63  KNMNNTIGPRAESSKIYAE-VLEARIGLPVVLWDERLTTSAAERTLIEADVSRKKRKEVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKLAAVMILQSYLD 135


>gi|326201373|ref|ZP_08191245.1| Holliday junction resolvase YqgF [Clostridium papyrosolvens DSM
           2782]
 gi|325988941|gb|EGD49765.1| Holliday junction resolvase YqgF [Clostridium papyrosolvens DSM
           2782]
          Length = 142

 Score = 93.2 bits (230), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 78/136 (57%), Gaps = 2/136 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPL 77
           I  ID G  RIG+AISDP    A     +  K+  + A+  LS I  E  +   +IG P+
Sbjct: 3   ILGIDYGDSRIGVAISDPMGWTAQGLEMIKSKESLKKAVLRLSEIIKEYGVTDIVIGYPI 62

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMNG++GPR   T  F+  + D   +   + WDERLTTVSA + + ++ +   K+   VD
Sbjct: 63  NMNGTKGPRTERTEEFIKKISDFGEF-NIIKWDERLTTVSAHRTMNELGIKASKKKDIVD 121

Query: 138 SIAAALILQEVLDRIS 153
           +++A LILQ  LDR++
Sbjct: 122 TMSAVLILQGYLDRMA 137


>gi|239787333|emb|CAX83809.1| Resolvase family protein, holliday junction-type, YqgF-like
           [uncultured bacterium]
          Length = 161

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 77/137 (56%), Gaps = 1/137 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            Q + +ID G + +G+A+SD     + P  F +  K       L + I        ++G 
Sbjct: 11  GQRLLAIDYGDRFLGVAVSDIMWHISTPL-FPIDSKSCNAFQALGALIDQHACGGIVVGY 69

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P+NMNGSEGP     R F   +      +P   +DERL+TV+A++ +++ ++SRKKR QK
Sbjct: 70  PINMNGSEGPACERVREFCQKIKKFFPSIPIGLFDERLSTVAAERNMVEADMSRKKRKQK 129

Query: 136 VDSIAAALILQEVLDRI 152
           VDS+AA+ +LQ  LD +
Sbjct: 130 VDSLAASYVLQGTLDYL 146


>gi|134298642|ref|YP_001112138.1| Holliday junction resolvase YqgF [Desulfotomaculum reducens MI-1]
 gi|172044263|sp|A4J2L0|RUVX_DESRM RecName: Full=Putative Holliday junction resolvase
 gi|134051342|gb|ABO49313.1| Holliday junction resolvase YqgF [Desulfotomaculum reducens MI-1]
          Length = 137

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 78/132 (59%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+A+SDP    A     + R  + +    L   I+  ++   ++G+P N
Sbjct: 3   IMGLDVGDKTIGVALSDPLGWTAQGLEVIRRDTIEKDMNRLAQIISEYSVERILVGMPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ G +     AF+   +  K+ +P   WDERL+TV+A+++LI  +VSR KR + +D 
Sbjct: 63  MNGTVGSQGEKVLAFIEK-VKEKIDLPIKTWDERLSTVAAEKMLIQADVSRGKRKKVIDK 121

Query: 139 IAAALILQEVLD 150
           +AAA+ILQ  LD
Sbjct: 122 MAAAVILQGYLD 133


>gi|326693839|ref|ZP_08230844.1| putative Holliday junction resolvase [Leuconostoc argentinum KCTC
           3773]
          Length = 143

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 80/135 (59%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+G++ +G+A+SDP    A     + + +   +  LE L   I  + +   ++GLP
Sbjct: 3   ILGLDVGSRTVGVAVSDPMGWTAQGVEIIRINEDEAEFGLERLGEIIKAKQVKGVVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQK 135
            NMN SEGPR  + R +   M++    +P  F DERLTTV A+++LI + ++SRKKR Q 
Sbjct: 63  KNMNNSEGPRAEAARRYAK-MVEETFGLPTDFQDERLTTVQAERMLIEEADISRKKRKQV 121

Query: 136 VDSIAAALILQEVLD 150
           +D IAA  ILQ  LD
Sbjct: 122 IDKIAAEFILQNYLD 136


>gi|288906372|ref|YP_003431594.1| hypothetical protein GALLO_2188 [Streptococcus gallolyticus UCN34]
 gi|306832418|ref|ZP_07465571.1| crossover junction endodeoxyribonuclease [Streptococcus
           gallolyticus subsp. gallolyticus TX20005]
 gi|325979385|ref|YP_004289101.1| putative holliday junction resolvase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|288733098|emb|CBI14679.1| Conserved hypothetical protein [Streptococcus gallolyticus UCN34]
 gi|304425458|gb|EFM28577.1| crossover junction endodeoxyribonuclease [Streptococcus
           gallolyticus subsp. gallolyticus TX20005]
 gi|325179313|emb|CBZ49357.1| putative holliday junction resolvase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
          Length = 139

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 84/137 (61%), Gaps = 4/137 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+G+K +G+AISDP G          + ++  +   E L   +    +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGVEIIRIDEEAGEFGFERLEELVKQYKVDKFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN +EGPRV +++A+  + I+    +P  + DERLTTV A+++L++  +VSR KR + 
Sbjct: 63  KNMNNTEGPRVEASKAY-GDKINELFNIPVDYQDERLTTVQAERMLVEQADVSRGKRKKV 121

Query: 136 VDSIAAALILQEVLDRI 152
           +D +AA LILQ  LDR+
Sbjct: 122 IDKLAAQLILQNYLDRM 138


>gi|332799383|ref|YP_004460882.1| Holliday junction resolvase [Tepidanaerobacter sp. Re1]
 gi|332697118|gb|AEE91575.1| Holliday junction resolvase [Tepidanaerobacter sp. Re1]
          Length = 143

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (56%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL--ELLSFITTENIAAFIIGLP 76
           I  +D+G KR+G+AISD     A     + RK   +      +   I+  N+   I+GLP
Sbjct: 3   ILGLDVGEKRVGVAISDELGLTAQGIDVIERKNDGKNKDIDRICRIISDYNVTKVIVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP   +   +   +  + + +   FWDERLTT +A++ILI+ +VSR+KR   +
Sbjct: 63  KNMNGTLGPSSEAVENYTKKL-QKAISIDLEFWDERLTTAAAERILIEADVSRQKRKGVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA LILQ  LD
Sbjct: 122 DKLAAVLILQSYLD 135


>gi|160940886|ref|ZP_02088226.1| hypothetical protein CLOBOL_05778 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436130|gb|EDP13897.1| hypothetical protein CLOBOL_05778 [Clostridium bolteae ATCC
           BAA-613]
          Length = 171

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 78/142 (54%), Gaps = 4/142 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVR---KKVTQTALELLSFITTENIAAFI 72
           N  I  +D G+K +G+A+ DP    A     + R    K+ QT   +   I    I   +
Sbjct: 30  NMRIMGLDFGSKTVGVAVCDPLGITAQTVETITRASENKMRQTLARIEQLIGEYEIERIV 89

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +G P NMN + G R   T+ F    ++R+  +  + WDERLTTV+A+++LI+  V R+ R
Sbjct: 90  LGYPKNMNNTVGERGEKTQEF-KAALERRTGLEVILWDERLTTVAAERVLIESGVRRENR 148

Query: 133 IQKVDSIAAALILQEVLDRISF 154
            + VD IAAA+ILQ  LD + +
Sbjct: 149 KKSVDQIAAAMILQGYLDSLQY 170


>gi|222153870|ref|YP_002563047.1| Holliday junction resolvase [Streptococcus uberis 0140J]
 gi|254767528|sp|B9DW62|RUVX_STRU0 RecName: Full=Putative Holliday junction resolvase
 gi|222114683|emb|CAR43762.1| putative Holliday junction resolvase [Streptococcus uberis 0140J]
          Length = 139

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 84/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++      E LS  +    +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIPIDEEKNSFGFERLSELVKQYQVDKFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+   + D   ++P V+ DERLTTV A+++LI+  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGKKIEDL-FHIPVVYQDERLTTVQAERMLIEQADISRGKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|315221498|ref|ZP_07863418.1| conserved hypothetical protein TIGR00250 [Streptococcus anginosus
           F0211]
 gi|315189332|gb|EFU23027.1| conserved hypothetical protein TIGR00250 [Streptococcus anginosus
           F0211]
          Length = 139

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 88/136 (64%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+A+SDP    A     + + ++  +   + L+ +  E  +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAVSDPLGFTAQGLEIIPIDEEKGEFGFDRLNGLVQEYKVDKFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+    I++  ++P  + DERLTTV+A+++LI+  +VSRKKR + 
Sbjct: 63  KNMNNTSGPRVEASQAY-GTKIEQLFHLPVEYQDERLTTVAAERMLIEQADVSRKKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|322390444|ref|ZP_08063964.1| crossover junction endodeoxyribonuclease [Streptococcus
           parasanguinis ATCC 903]
 gi|321142843|gb|EFX38301.1| crossover junction endodeoxyribonuclease [Streptococcus
           parasanguinis ATCC 903]
          Length = 139

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 85/136 (62%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+G+K +G+A+SDP    A     + + +   +  LE L+  +    +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAVSDPLGFTAQGLEIIQIDEDKKEFGLERLAELVAQYKVDRFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+   MI  K  +P  + DERLTTV+A+++LI+  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAY-GAMIAEKFGMPVDYQDERLTTVAAERMLIEQADISRSKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|269958631|ref|YP_003328418.1| putative Holliday junction resolvase [Anaplasma centrale str.
           Israel]
 gi|269848460|gb|ACZ49104.1| putative Holliday junction resolvase [Anaplasma centrale str.
           Israel]
          Length = 157

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 78/145 (53%), Gaps = 1/145 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           IE   + L  N+ I  +D G +++GLAISD     A P    +R+ + Q   EL + +  
Sbjct: 6   IEGFFEKLGANKKILGLDFGERKLGLAISDSTGTIAMPHSVYLRRNIRQDLGELNAILKR 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
           E I A ++GLPL ++G EG      RAFV  +I +K  +     DER TT  A +    +
Sbjct: 66  EGIIAAVVGLPLQLDGLEGEMCAVVRAFVRKLI-KKSGIYVYLHDERYTTAMASRATESL 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLD 150
            + RK+  +  D I+A LILQ+VLD
Sbjct: 125 GLRRKESQKVDDKISAVLILQQVLD 149


>gi|311069221|ref|YP_003974144.1| Holliday junction resolvase-like protein [Bacillus atrophaeus 1942]
 gi|310869738|gb|ADP33213.1| Holliday junction resolvase-like protein [Bacillus atrophaeus 1942]
          Length = 138

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 83/137 (60%), Gaps = 3/137 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTEN-IAAFIIGLP 76
           I  +DLGTK +G+A+SD  G          + +      L  LS +T ++ I   ++G P
Sbjct: 3   ILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLPRLSELTKDHTIDKIVLGFP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  +++ F   +++    VP V WDERLTT++A+++LI  +VSR+KR + +
Sbjct: 63  KNMNGTVGPRGEASQTFAK-LLETTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKKVI 121

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA +ILQ  LD ++
Sbjct: 122 DKMAAVMILQGYLDSLN 138


>gi|312866891|ref|ZP_07727104.1| RNAse H domain protein, YqgF family [Streptococcus parasanguinis
           F0405]
 gi|311097674|gb|EFQ55905.1| RNAse H domain protein, YqgF family [Streptococcus parasanguinis
           F0405]
          Length = 139

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 85/136 (62%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+G+K +G+A+SDP    A     + + +   +  LE L+  +    +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAVSDPLGFTAQGLEIIQIDEDKREFGLERLAELVAQYKVDRFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+   MI  K  +P  + DERLTTV+A+++LI+  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAY-GTMIAEKFGLPVDYQDERLTTVAAERMLIEQADISRSKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|312862410|ref|ZP_07722653.1| RNAse H domain protein, YqgF family [Streptococcus vestibularis
           F0396]
 gi|322515847|ref|ZP_08068791.1| crossover junction endodeoxyribonuclease [Streptococcus
           vestibularis ATCC 49124]
 gi|311102053|gb|EFQ60253.1| RNAse H domain protein, YqgF family [Streptococcus vestibularis
           F0396]
 gi|322125733|gb|EFX97055.1| crossover junction endodeoxyribonuclease [Streptococcus
           vestibularis ATCC 49124]
          Length = 139

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 84/140 (60%), Gaps = 10/140 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFII 73
           +  +D+G+K +G+AISDP    A     +   K+ + A E     L   +    +  F++
Sbjct: 3   VMGLDVGSKTVGVAISDPLGFTAQGVEII---KIDEEAEEFGFDRLGELVKEYKVEKFVV 59

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
           GLP NMN +EGPRV +++A+  + I     +P  + DERLTTV A+++L++  +VSR KR
Sbjct: 60  GLPKNMNNTEGPRVEASKAY-GDKIKEIFEIPVDYQDERLTTVQAERMLVEQADVSRGKR 118

Query: 133 IQKVDSIAAALILQEVLDRI 152
            + +D +AA LILQ  LDR+
Sbjct: 119 KKVIDKLAAQLILQNYLDRM 138


>gi|206975936|ref|ZP_03236846.1| conserved hypothetical protein TIGR00250 [Bacillus cereus H3081.97]
 gi|217961876|ref|YP_002340446.1| Holliday junction resolvase-like protein [Bacillus cereus AH187]
 gi|222097829|ref|YP_002531886.1| holliday junction resolvase-like protein [Bacillus cereus Q1]
 gi|229141123|ref|ZP_04269665.1| Holliday junction resolvase [Bacillus cereus BDRD-ST26]
 gi|226725487|sp|B7HQE4|RUVX_BACC7 RecName: Full=Putative Holliday junction resolvase
 gi|254767497|sp|B9IYF1|RUVX_BACCQ RecName: Full=Putative Holliday junction resolvase
 gi|206745688|gb|EDZ57085.1| conserved hypothetical protein TIGR00250 [Bacillus cereus H3081.97]
 gi|217063507|gb|ACJ77757.1| conserved hypothetical protein TIGR00250 [Bacillus cereus AH187]
 gi|221241887|gb|ACM14597.1| conserved hypothetical protein [Bacillus cereus Q1]
 gi|228642401|gb|EEK98690.1| Holliday junction resolvase [Bacillus cereus BDRD-ST26]
          Length = 137

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 82/135 (60%), Gaps = 3/135 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+GTK +G+AISD  G          + ++  Q   + +S  +   ++   ++GLP
Sbjct: 3   ILGLDVGTKTVGVAISDEMGWTAQGLETIKINEERGQFGFDRISELVKQYDVDKIVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  + + F  N+ +  + +  V WDERL+T++A+++LI  +VSRKKR Q +
Sbjct: 63  KNMNGTIGPRGEACQQFAENLREL-LQLDVVMWDERLSTMAAERLLISADVSRKKRKQVI 121

Query: 137 DSIAAALILQEVLDR 151
           D +AA +ILQ  LDR
Sbjct: 122 DKMAAVVILQGFLDR 136


>gi|313890363|ref|ZP_07823994.1| RNAse H domain protein, YqgF family [Streptococcus pseudoporcinus
           SPIN 20026]
 gi|313121206|gb|EFR44314.1| RNAse H domain protein, YqgF family [Streptococcus pseudoporcinus
           SPIN 20026]
          Length = 139

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 82/136 (60%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT-ALELLS-FITTENIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     +   +  Q    + LS  +    ++ F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIKIDEANQAFGFDRLSELVAQYKVSQFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+    I     +P V+ DERLTTV A+++LI+  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGQK-IQELFKIPVVYQDERLTTVEAERMLIEQADISRGKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|328474865|gb|EGF45665.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           220]
 gi|332311944|gb|EGJ25039.1| Putative Holliday junction resolvase [Listeria monocytogenes str.
           Scott A]
          Length = 135

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 80/132 (60%), Gaps = 3/132 (2%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +D+G+K +G+AISDP G          + +   Q   + +  +  E  +   ++GLP N
Sbjct: 2   GLDVGSKTVGVAISDPLGWTAQGVETIQIDENRKQFGYDRVKELVLEYEVEKVVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR + +D 
Sbjct: 62  MNNTIGPRAESSKIYAE-VLESRIGLPVVLWDERLTTSAAERTLIEADVSRKKRKEVIDK 120

Query: 139 IAAALILQEVLD 150
           +AA +ILQ  LD
Sbjct: 121 LAAVMILQSYLD 132


>gi|306834532|ref|ZP_07467645.1| crossover junction endodeoxyribonuclease [Streptococcus bovis ATCC
           700338]
 gi|304423334|gb|EFM26487.1| crossover junction endodeoxyribonuclease [Streptococcus bovis ATCC
           700338]
          Length = 136

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 85/136 (62%), Gaps = 6/136 (4%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVR--KKVTQTALELLS-FITTENIAAFIIGLPL 77
            +D+G+K +G+AISDP   F      +VR  ++  +   E L   +    +  F++GLP 
Sbjct: 2   GLDVGSKTVGVAISDP-LGFTAQGVEIVRIDEEAGEFGFERLEELVKQYKVDKFVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKV 136
           NMN +EGPRV +++A+  + I+    +P  + DERLTTV A+++L++  +VSR KR + +
Sbjct: 61  NMNNTEGPRVEASKAY-GDKINELFNIPVDYQDERLTTVQAERMLVEQADVSRGKRKKVI 119

Query: 137 DSIAAALILQEVLDRI 152
           D +AA LILQ  LDR+
Sbjct: 120 DKLAAQLILQNYLDRM 135


>gi|293374256|ref|ZP_06620584.1| RNAse YqgF [Turicibacter sanguinis PC909]
 gi|325844837|ref|ZP_08168289.1| RNAse H domain protein, YqgF family [Turicibacter sp. HGF1]
 gi|292647089|gb|EFF65071.1| RNAse YqgF [Turicibacter sanguinis PC909]
 gi|325489024|gb|EGC91412.1| RNAse H domain protein, YqgF family [Turicibacter sp. HGF1]
          Length = 143

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 76/135 (56%), Gaps = 3/135 (2%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALE-LLSFITTENIAAFIIGL 75
            I  +DLGT+  G+AISD     AH    F   +   + A++ +   + T  I+  ++GL
Sbjct: 2   KILGLDLGTRTCGIAISDALGMMAHGVETFRFEENHYKKAIQHVQELVKTHKISKIVLGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMNGS G R   T+ F   + +    V  + WDERLTT+  +++LI  +VSR KR + 
Sbjct: 62  PKNMNGSIGERGQVTQEFAKKL-EEATNVTVILWDERLTTMQVERVLIQADVSRNKRKKV 120

Query: 136 VDSIAAALILQEVLD 150
           VD +AA +ILQ  LD
Sbjct: 121 VDKMAATIILQSYLD 135


>gi|226324641|ref|ZP_03800159.1| hypothetical protein COPCOM_02426 [Coprococcus comes ATCC 27758]
 gi|225207089|gb|EEG89443.1| hypothetical protein COPCOM_02426 [Coprococcus comes ATCC 27758]
          Length = 143

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 73/139 (52%), Gaps = 4/139 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D GTK +G+A+SDP    A     + RK   K+ +T   + S  T   +  F+IG 
Sbjct: 4   IMGLDYGTKTVGVAVSDPLGITAQAVETVTRKDENKLRKTLARIESLATEYGVEKFVIGF 63

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MN   G R      F   M+ R+  +  V WDERLTTV A++ L++  V R+ R Q 
Sbjct: 64  PKHMNNDIGERAEKALEF-GEMLKRRTGIEIVMWDERLTTVEAERTLMESGVRRENRKQY 122

Query: 136 VDSIAAALILQEVLDRISF 154
           VD IAA  ILQ  LD +  
Sbjct: 123 VDQIAAVFILQGYLDSLGM 141


>gi|315652510|ref|ZP_07905494.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Eubacterium saburreum DSM 3986]
 gi|315485226|gb|EFU75624.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Eubacterium saburreum DSM 3986]
          Length = 145

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVR---KKVTQTALELLSFITTENIAAFII 73
           + I  +D G+K IG+AISD     A P   + R    K+ ++  ++   +  +NI   ++
Sbjct: 5   ERIMGLDYGSKTIGVAISDSLGLTAQPFETIERSKENKLRRSLAKIAKIVEEKNIKKIVV 64

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP+NMNG  G RV  T  FV  +  R V VP +  DERLTTV A +IL +  V ++ R 
Sbjct: 65  GLPVNMNGRRGKRVSLTLEFVEKLKQR-VDVPIIMQDERLTTVEADEILDESGVKKENRK 123

Query: 134 QKVDSIAAALILQEVLDR 151
           Q +D +AA +IL+E +++
Sbjct: 124 QFIDMVAAGIILREYMEK 141


>gi|239827825|ref|YP_002950449.1| Holliday junction resolvase YqgF [Geobacillus sp. WCH70]
 gi|259495706|sp|C5D4Z1|RUVX_GEOSW RecName: Full=Putative Holliday junction resolvase
 gi|239808118|gb|ACS25183.1| Holliday junction resolvase YqgF [Geobacillus sp. WCH70]
          Length = 138

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 82/134 (61%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           +  +DLGTK +G+A+SD  G          + ++  +  L+ L  I  E  +   ++G P
Sbjct: 3   VLGLDLGTKTLGVAVSDELGWTAQGIETISIDEERGEYGLKRLREIIDEYEVDTIVVGFP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  +++ F   +++ +  +P + WDERL+T++A+++LI  +VSRKKR Q +
Sbjct: 63  KNMNGTVGPRAEASQRFAK-LLESEFSLPVILWDERLSTMAAERMLITADVSRKKRKQVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKMAAVVILQSYLD 135


>gi|217964351|ref|YP_002350029.1| hypothetical protein LMHCC_1067 [Listeria monocytogenes HCC23]
 gi|284801892|ref|YP_003413757.1| hypothetical protein LM5578_1647 [Listeria monocytogenes 08-5578]
 gi|284995034|ref|YP_003416802.1| hypothetical protein LM5923_1599 [Listeria monocytogenes 08-5923]
 gi|217333621|gb|ACK39415.1| conserved hypothetical protein [Listeria monocytogenes HCC23]
 gi|284057454|gb|ADB68395.1| hypothetical protein LM5578_1647 [Listeria monocytogenes 08-5578]
 gi|284060501|gb|ADB71440.1| hypothetical protein LM5923_1599 [Listeria monocytogenes 08-5923]
 gi|307571083|emb|CAR84262.1| holliday junction resolvase, putative [Listeria monocytogenes L99]
          Length = 135

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 80/132 (60%), Gaps = 3/132 (2%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +D+G+K +G+AISDP G          + +   Q   + +  +  E  +   ++GLP N
Sbjct: 2   GLDVGSKTVGVAISDPLGWTAQGVETIQIDENRKQFGYDRVKELVLEYEVEKVVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR + +D 
Sbjct: 62  MNNTIGPRAESSKIYAE-VLEARIGLPVVLWDERLTTSAAERTLIEADVSRKKRKEVIDK 120

Query: 139 IAAALILQEVLD 150
           +AA +ILQ  LD
Sbjct: 121 LAAVMILQSYLD 132


>gi|182418929|ref|ZP_02950186.1| conserved hypothetical protein [Clostridium butyricum 5521]
 gi|237669098|ref|ZP_04529082.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT
           E BL5262]
 gi|182377212|gb|EDT74780.1| conserved hypothetical protein [Clostridium butyricum 5521]
 gi|237657446|gb|EEP55002.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT
           E BL5262]
          Length = 140

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 78/136 (57%), Gaps = 3/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPL 77
           I  +DLG K IG+AISDP   F       +R+   +  +E L  I  E  +   +IGLP 
Sbjct: 4   ILGLDLGQKTIGVAISDP-LGFTAQGLTTIRRGSKEKDIEDLKKICDEYKVETIVIGLPK 62

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMNG+ GP      AF   +++ +  +   FWDERLTTV+A + +++ ++SR KR + VD
Sbjct: 63  NMNGTIGPSGEIAMAF-GKLLEEEFQIEIKFWDERLTTVAAHKAMLEADLSRNKRKKIVD 121

Query: 138 SIAAALILQEVLDRIS 153
            +A+  ILQ  LD IS
Sbjct: 122 KVASTYILQGYLDMIS 137


>gi|30022462|ref|NP_834093.1| Holliday junction resolvase-like protein [Bacillus cereus ATCC
           14579]
 gi|218232910|ref|YP_002369196.1| Holliday junction resolvase-like protein [Bacillus cereus B4264]
 gi|228923138|ref|ZP_04086429.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|229071895|ref|ZP_04205106.1| Holliday junction resolvase [Bacillus cereus F65185]
 gi|229111859|ref|ZP_04241405.1| Holliday junction resolvase [Bacillus cereus Rock1-15]
 gi|229129667|ref|ZP_04258635.1| Holliday junction resolvase [Bacillus cereus BDRD-Cer4]
 gi|229146957|ref|ZP_04275321.1| Holliday junction resolvase [Bacillus cereus BDRD-ST24]
 gi|229152590|ref|ZP_04280779.1| Holliday junction resolvase [Bacillus cereus m1550]
 gi|33301594|sp|Q812R9|RUVX_BACCR RecName: Full=Putative Holliday junction resolvase
 gi|226725486|sp|B7HE21|RUVX_BACC4 RecName: Full=Putative Holliday junction resolvase
 gi|29898020|gb|AAP11294.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579]
 gi|218160867|gb|ACK60859.1| conserved hypothetical protein TIGR00250 [Bacillus cereus B4264]
 gi|228630851|gb|EEK87491.1| Holliday junction resolvase [Bacillus cereus m1550]
 gi|228636556|gb|EEK93022.1| Holliday junction resolvase [Bacillus cereus BDRD-ST24]
 gi|228653784|gb|EEL09654.1| Holliday junction resolvase [Bacillus cereus BDRD-Cer4]
 gi|228671615|gb|EEL26913.1| Holliday junction resolvase [Bacillus cereus Rock1-15]
 gi|228711191|gb|EEL63155.1| Holliday junction resolvase [Bacillus cereus F65185]
 gi|228836517|gb|EEM81867.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 137

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 81/135 (60%), Gaps = 3/135 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+GTK +G+AISD  G          + ++      + +S  +   N+   ++GLP
Sbjct: 3   ILGLDVGTKTVGVAISDEMGWTAQGLETIKINEERGHFGFDRISELVKQYNVDKIVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  + + F  N+ +  + +  V WDERL+T++A+++LI  +VSRKKR Q +
Sbjct: 63  KNMNGTIGPRGEACQQFAENLREL-LQLDVVMWDERLSTMAAERLLISADVSRKKRKQVI 121

Query: 137 DSIAAALILQEVLDR 151
           D +AA +ILQ  LDR
Sbjct: 122 DKMAAVVILQGFLDR 136


>gi|325290060|ref|YP_004266241.1| Holliday junction resolvase [Syntrophobotulus glycolicus DSM 8271]
 gi|324965461|gb|ADY56240.1| Holliday junction resolvase [Syntrophobotulus glycolicus DSM 8271]
          Length = 134

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 73/132 (55%), Gaps = 3/132 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +DLG K IG+A+SD        +P LV K+  +   EL   I    +   ++G P N
Sbjct: 3   VMGLDLGEKTIGVAVSDL--LMLTAQPLLVIKRSEKEQEELAGIIKEYEVDTIVVGYPKN 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ G R  +T AF   +      +P   WDERL+TV+AQ+ LI  +VSR KR + +D 
Sbjct: 61  MNGTIGERALATEAFAQEL-QAAFRLPIKLWDERLSTVAAQKSLIQADVSRAKRKKVIDK 119

Query: 139 IAAALILQEVLD 150
           +AA  ILQ  LD
Sbjct: 120 MAAVFILQGFLD 131


>gi|255527853|ref|ZP_05394701.1| Holliday junction resolvase YqgF [Clostridium carboxidivorans P7]
 gi|296185454|ref|ZP_06853864.1| RNAse H-fold protein YqgF [Clostridium carboxidivorans P7]
 gi|255508464|gb|EET84856.1| Holliday junction resolvase YqgF [Clostridium carboxidivorans P7]
 gi|296050288|gb|EFG89712.1| RNAse H-fold protein YqgF [Clostridium carboxidivorans P7]
          Length = 138

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 75/135 (55%), Gaps = 1/135 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G + IG+A+SDP    A     + RK       EL +     N+   + GLP N
Sbjct: 3   ILGLDVGDRTIGVAVSDPLGFTAQGITTIRRKSQDADIKELKNICDEYNVETIVSGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP+      F   +I  K+ +P   WDERLTTV+A + +++ ++SR KR + VD 
Sbjct: 63  MNGTLGPQSEKVLKFCE-VIKEKIGLPIKMWDERLTTVAAHRAMLEADLSRNKRKKIVDK 121

Query: 139 IAAALILQEVLDRIS 153
           +AA  ILQ  LD IS
Sbjct: 122 MAAIYILQGYLDSIS 136


>gi|291539698|emb|CBL12809.1| conserved hypothetical protein TIGR00250 [Roseburia intestinalis
           XB6B4]
          Length = 144

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 75/135 (55%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +GLA+SD     A     + R+   K+ QT   + + I    +   ++G 
Sbjct: 3   ILGLDFGSKTVGLAVSDELLLTAQGLEIIRRQSPNKLRQTLARIEAIIAEYQVECIVLGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN +EG R   T+ F   M++R+  +  + WDERLTTVSA + +++  + R+ R + 
Sbjct: 63  PKNMNNTEGERCEKTKEF-KEMLERRTGLEVILWDERLTTVSADKHMMESGIRREDRKKY 121

Query: 136 VDSIAAALILQEVLD 150
           VD IAA  ILQ  LD
Sbjct: 122 VDEIAAVFILQGYLD 136


>gi|313891828|ref|ZP_07825433.1| RNAse H domain protein, YqgF family [Dialister microaerophilus UPII
           345-E]
 gi|329121066|ref|ZP_08249697.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Dialister micraerophilus DSM 19965]
 gi|313119822|gb|EFR43009.1| RNAse H domain protein, YqgF family [Dialister microaerophilus UPII
           345-E]
 gi|327471228|gb|EGF16682.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Dialister micraerophilus DSM 19965]
          Length = 145

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 80/137 (58%), Gaps = 2/137 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL-SFITTENIAAFIIGLPL 77
           I ++D+G+  IG+AISD     A      +R    +   E L + I + ++   ++G+PL
Sbjct: 3   IMALDVGSHTIGVAISDLMGWTAQGLE-TIRHSTREKDFERLKTIIDSYDVKEIVVGMPL 61

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMNG++G R   T  FV ++      +P  FWDERLTTV AQ+ LI  ++SRKKR + +D
Sbjct: 62  NMNGTKGIRAELTEDFVKDLKSAFPNIPCAFWDERLTTVMAQKTLISADMSRKKRKKVID 121

Query: 138 SIAAALILQEVLDRISF 154
            +AA +IL+  L  + F
Sbjct: 122 KLAATVILEGYLRHLEF 138


>gi|146317727|ref|YP_001197439.1| Holliday junction resolvase-like protein [Streptococcus suis
           05ZYH33]
 gi|146319916|ref|YP_001199627.1| Holliday junction resolvase-like protein [Streptococcus suis
           98HAH33]
 gi|223934259|ref|ZP_03626188.1| Holliday junction resolvase YqgF [Streptococcus suis 89/1591]
 gi|253750983|ref|YP_003024124.1| Holliday junction resolvase [Streptococcus suis SC84]
 gi|253752883|ref|YP_003026023.1| Holliday junction resolvase [Streptococcus suis P1/7]
 gi|253754708|ref|YP_003027848.1| Holliday junction resolvase [Streptococcus suis BM407]
 gi|167016513|sp|A4VYN8|RUVX_STRS2 RecName: Full=Putative Holliday junction resolvase
 gi|167016515|sp|A4VSF0|RUVX_STRSY RecName: Full=Putative Holliday junction resolvase
 gi|145688533|gb|ABP89039.1| Unknown protein [Streptococcus suis 05ZYH33]
 gi|145690722|gb|ABP91227.1| unknown protein [Streptococcus suis 98HAH33]
 gi|223897073|gb|EEF63505.1| Holliday junction resolvase YqgF [Streptococcus suis 89/1591]
 gi|251815272|emb|CAZ50837.1| putative Holliday junction resolvase [Streptococcus suis SC84]
 gi|251817172|emb|CAZ54893.1| putative Holliday junction resolvase [Streptococcus suis BM407]
 gi|251819128|emb|CAR44214.1| putative Holliday junction resolvase [Streptococcus suis P1/7]
 gi|292557526|gb|ADE30527.1| Resolvase, holliday junction-type, YqgF-like protein [Streptococcus
           suis GZ1]
          Length = 139

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 87/136 (63%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++  +  LE L+  +    +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIPIDEEKGEFGLERLTELVEQYKVDKFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+  +++  +  +P  + DERLTTV+A+++LI+  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAY-GDLLTERYKLPVDYQDERLTTVAAERMLIEQADISRGKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|116628625|ref|YP_821244.1| Holliday junction resolvase-like protein [Streptococcus
           thermophilus LMD-9]
 gi|122266781|sp|Q03IC4|RUVX_STRTD RecName: Full=Putative Holliday junction resolvase
 gi|116101902|gb|ABJ67048.1| RNase H-like ribonuclease [Streptococcus thermophilus LMD-9]
 gi|312279278|gb|ADQ63935.1| Holliday junction resolvase YqgF [Streptococcus thermophilus ND03]
          Length = 139

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 84/140 (60%), Gaps = 10/140 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFII 73
           +  +D+G+K +G+AISDP    A     +   K+ + A E     L   +    +  F++
Sbjct: 3   VMGLDVGSKTVGVAISDPLGFTAQGVEII---KINEEAKEFGFDRLGELVKEYQVDKFVV 59

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
           GLP NMN +EGPRV +++A+  + I     +P  + DERLTTV A+++L++  +VSR KR
Sbjct: 60  GLPKNMNNTEGPRVEASKAY-GDKIKEIFNLPVDYQDERLTTVQAERMLVEQADVSRDKR 118

Query: 133 IQKVDSIAAALILQEVLDRI 152
            + +D +AA LILQ  LDR+
Sbjct: 119 KKVIDKLAAQLILQNYLDRM 138


>gi|308070325|ref|YP_003871930.1| Holliday junction resolvase [Paenibacillus polymyxa E681]
 gi|305859604|gb|ADM71392.1| Putative Holliday junction resolvase [Paenibacillus polymyxa E681]
          Length = 138

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 75/132 (56%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +D G +RIG+A+SD     A     + R+       ++ + +    +   ++GLP N
Sbjct: 3   VMGLDYGDRRIGVAVSDAFGWTAQGLEVIERRGDDSEFGKIANLVRDNEVGEIVVGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GPR      F  N +   + +P   WDERLTT SA++ L++ +VSRKKR Q VD 
Sbjct: 63  MNGTVGPRGEICIEFA-NRLKELLGLPVHLWDERLTTRSAERALLEADVSRKKRKQVVDK 121

Query: 139 IAAALILQEVLD 150
           +AA+LILQ  LD
Sbjct: 122 LAASLILQNYLD 133


>gi|258515480|ref|YP_003191702.1| Holliday junction resolvase YqgF [Desulfotomaculum acetoxidans DSM
           771]
 gi|257779185|gb|ACV63079.1| Holliday junction resolvase YqgF [Desulfotomaculum acetoxidans DSM
           771]
          Length = 139

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 79/138 (57%), Gaps = 2/138 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL-SFITTENIAAFIIGLPL 77
           I  +DLG K IG+A+SDP    A     + RK   +  L  L   I    +   ++GLP 
Sbjct: 3   IMCLDLGEKTIGIALSDPFGWTAQGLEIINRKGQPKQELNRLREIIKQYEVEKVVVGLPK 62

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMNG+ GP+      F+   + RK+ +    WDERL+TV+A++IL+  ++SR KR + +D
Sbjct: 63  NMNGTTGPQAEKALDFIE-YLKRKLGLVVEAWDERLSTVAAERILLSADISRGKRKKVID 121

Query: 138 SIAAALILQEVLDRISFL 155
            +AAA+ILQ  LD  S +
Sbjct: 122 KMAAAVILQGYLDAHSCI 139


>gi|257066431|ref|YP_003152687.1| Holliday junction resolvase YqgF [Anaerococcus prevotii DSM 20548]
 gi|256798311|gb|ACV28966.1| Holliday junction resolvase YqgF [Anaerococcus prevotii DSM 20548]
          Length = 139

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 79/133 (59%), Gaps = 1/133 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+A+SDP    ++    + RKK +     +   +   ++   ++GLP N
Sbjct: 4   IMGLDVGNKTIGVALSDPMFLLSNALETIKRKKASVDIERIKQLVEENDVNLIVVGLPKN 63

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MN + GP+     +FV +++ ++V V  V+ DER+TT+ ++ +L+DM V R+ R + +D 
Sbjct: 64  MNNTIGPQAMRVISFV-DLLKKQVDVEVVYEDERMTTIQSEAVLMDMEVRRENRKKYIDK 122

Query: 139 IAAALILQEVLDR 151
           IAA  ILQ  LDR
Sbjct: 123 IAATFILQTYLDR 135


>gi|218132863|ref|ZP_03461667.1| hypothetical protein BACPEC_00724 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991736|gb|EEC57740.1| hypothetical protein BACPEC_00724 [Bacteroides pectinophilus ATCC
           43243]
          Length = 139

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 77/132 (58%), Gaps = 4/132 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVR---KKVTQTALELLSFITTENIAAFIIGL 75
           I  +D GTK +G+A++DP      P   + R    K+  T   +   I   ++   ++GL
Sbjct: 3   ILGLDYGTKTVGVAVTDPLGMTVQPLETITRDSDSKIRPTLRRIEEIIKELDVEQIVLGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+EG R   +R F  +M++R+  +  V  DERLTTV A++IL    V+RK   + 
Sbjct: 63  PLNMDGTEGERAACSREF-GDMLERRTGLQVVMTDERLTTVEAEEILETCKVARKDYKKY 121

Query: 136 VDSIAAALILQE 147
           VDS+AA LIL++
Sbjct: 122 VDSVAAVLILED 133


>gi|332523405|ref|ZP_08399657.1| RNAse H domain protein, YqgF family [Streptococcus porcinus str.
           Jelinkova 176]
 gi|332314669|gb|EGJ27654.1| RNAse H domain protein, YqgF family [Streptococcus porcinus str.
           Jelinkova 176]
          Length = 139

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 83/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT-ALELLS-FITTENIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     +   +  Q    + LS  +   +++ F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIKIDEDNQAFGFDRLSELVAQYDVSQFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+    I     +P V+ DERLTTV A+++LI+  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGQK-IQELFKIPVVYQDERLTTVEAERMLIEQADISRGKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|15613832|ref|NP_242135.1| hypothetical protein BH1269 [Bacillus halodurans C-125]
 gi|32130069|sp|Q9KDE4|RUVX_BACHD RecName: Full=Putative Holliday junction resolvase
 gi|10173885|dbj|BAB04988.1| BH1269 [Bacillus halodurans C-125]
          Length = 140

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 74/135 (54%), Gaps = 7/135 (5%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIGLPLN 78
            +D+GTK IG+A+SD     A       R    + A    + S +    +   +IGLP N
Sbjct: 5   GLDVGTKTIGIAVSDALGWTAQGLETWRRSDANEQADFEHIASLVKEHEVTTIVIGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVP--FVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           M+GS GP    +  F   +   + YVP   V WDERLTT +A+++LI  +VSRKKR   +
Sbjct: 65  MDGSIGPSGERSETFAAEL---RRYVPCEIVMWDERLTTTAAERMLISADVSRKKRKSVI 121

Query: 137 DSIAAALILQEVLDR 151
           D +AA +ILQ  LDR
Sbjct: 122 DKMAAVMILQGYLDR 136


>gi|227484975|ref|ZP_03915291.1| crossover junction endodeoxyribonuclease [Anaerococcus lactolyticus
           ATCC 51172]
 gi|227237130|gb|EEI87145.1| crossover junction endodeoxyribonuclease [Anaerococcus lactolyticus
           ATCC 51172]
          Length = 139

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 77/133 (57%), Gaps = 1/133 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+A+SDP    A P   + R K       +       +I+  ++GLP N
Sbjct: 4   IMGLDVGDKTIGVALSDPLFITAQPYETIKRTKAKFDIDRIEKIFVENDISLIVVGLPKN 63

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MN + GP+     +FV ++I +++    V+ DERLTT+ ++ +LIDM+V R+ R   +D 
Sbjct: 64  MNNTMGPQSMRIISFV-DLIKKRIDTEIVYQDERLTTIQSESVLIDMSVRRENRKAHIDK 122

Query: 139 IAAALILQEVLDR 151
           IAA+ ILQ  LDR
Sbjct: 123 IAASFILQTYLDR 135


>gi|288555385|ref|YP_003427320.1| hypothetical protein BpOF4_11875 [Bacillus pseudofirmus OF4]
 gi|288546545|gb|ADC50428.1| hypothetical protein BpOF4_11875 [Bacillus pseudofirmus OF4]
          Length = 139

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 77/133 (57%), Gaps = 3/133 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIGLPLN 78
            +D+GTK +G+A+SD     A     L R +    +  L++       ++   +IGLP N
Sbjct: 5   GLDVGTKTVGIALSDELGWTAQGIETLRRNEEDPESDFLKIAELAKQNDVETIVIGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP       F  ++ +  V   FV WDERLTTV+A+++L+  +VSRKKR + +D 
Sbjct: 65  MNGTIGPSGERCMEFADSLKEH-VDCEFVMWDERLTTVAAERMLVSADVSRKKRKKVIDK 123

Query: 139 IAAALILQEVLDR 151
           +AA +ILQ  LDR
Sbjct: 124 MAAVMILQGYLDR 136


>gi|310643513|ref|YP_003948271.1| holliday junction resolvase-like protein [Paenibacillus polymyxa
           SC2]
 gi|309248463|gb|ADO58030.1| Holliday junction resolvase-like protein [Paenibacillus polymyxa
           SC2]
          Length = 138

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 75/132 (56%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +D G +RIG+A+SD     A     + R+       ++ + +    I   ++GLP N
Sbjct: 3   VMGLDYGDRRIGVAVSDAFGWTAQGLVVIERRGDDSEFGKIANLVREHEIGEVVVGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GPR      F  N +   + +P   WDERLTT SA++ L++ +VSRKKR Q VD 
Sbjct: 63  MNGTVGPRGEICIEFA-NRLKELLGLPVHLWDERLTTRSAERALLEADVSRKKRKQVVDK 121

Query: 139 IAAALILQEVLD 150
           +AA+LILQ  LD
Sbjct: 122 LAASLILQNYLD 133


>gi|170016827|ref|YP_001727746.1| endonuclease [Leuconostoc citreum KM20]
 gi|226731627|sp|B1MXQ0|RUVX_LEUCK RecName: Full=Putative Holliday junction resolvase
 gi|169803684|gb|ACA82302.1| Predicted endonuclease [Leuconostoc citreum KM20]
          Length = 143

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/133 (39%), Positives = 79/133 (59%), Gaps = 4/133 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIA-AFIIGLPLN 78
            +D+G++ +G+A+SDP    A     + + +   +  L  L  I  E  A   ++GLP N
Sbjct: 5   GLDVGSRTVGVAVSDPMGWTAQGVEIIRINEDEKEFGLARLGEIIKEKQAKGVVVGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQKVD 137
           MN SEGPR  + R +   M++ +  +P  F DERLTTV A+++L+ + +VSRKKR Q +D
Sbjct: 65  MNNSEGPRAEAARQYAQ-MVEDQFNLPTDFQDERLTTVQAERMLVEEADVSRKKRKQVID 123

Query: 138 SIAAALILQEVLD 150
            IAA  ILQ  LD
Sbjct: 124 KIAAEFILQNYLD 136


>gi|323490024|ref|ZP_08095245.1| Holliday junction resolvase-like protein [Planococcus donghaensis
           MPA1U2]
 gi|323396320|gb|EGA89145.1| Holliday junction resolvase-like protein [Planococcus donghaensis
           MPA1U2]
          Length = 138

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 76/134 (56%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+G+K IG+AISDP G          + + + +  +E L   I    +   ++G P
Sbjct: 3   IIGLDVGSKTIGVAISDPMGWTAQGIETIKINEAIEEFGMERLGELIKQYEVTEAVVGYP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMN S GPR  ++  F   ++     +P V WDERLTT +A+++LI  +VSRK R + +
Sbjct: 63  KNMNNSIGPRAEASEKFAA-LLKEAYSIPVVLWDERLTTSAAEKMLISADVSRKNRKKVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKMAAVMILQGYLD 135


>gi|116617674|ref|YP_818045.1| RNase H-like ribonuclease [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|122272125|sp|Q03YQ0|RUVX_LEUMM RecName: Full=Putative Holliday junction resolvase
 gi|116096521|gb|ABJ61672.1| RNase H-like ribonuclease [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
          Length = 143

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 82/135 (60%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G++ +G+++SDP    A     + + +   +  ++ L  I  E N    ++GLP
Sbjct: 3   ILGLDVGSRTVGVSVSDPMGWTAQGVEIIRINEDEKEFGIDRLGEIIKEKNATGVVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQK 135
            NMN SEGPR  ++R +   +I++   +P  F DERLTTV A+++LI + N+SRKKR + 
Sbjct: 63  KNMNNSEGPRAEASRNYAK-LIEKTFGLPTDFQDERLTTVEAERMLIEEANISRKKRKKV 121

Query: 136 VDSIAAALILQEVLD 150
           +D IAA  ILQ  LD
Sbjct: 122 IDKIAAEFILQNYLD 136


>gi|323702199|ref|ZP_08113866.1| Holliday junction resolvase YqgF [Desulfotomaculum nigrificans DSM
           574]
 gi|323532886|gb|EGB22758.1| Holliday junction resolvase YqgF [Desulfotomaculum nigrificans DSM
           574]
          Length = 140

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 79/133 (59%), Gaps = 2/133 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPL 77
           +  +D+G K IG+A+SDP    A     + R       L  L+ I  E  +   ++GLP 
Sbjct: 3   VMGLDVGDKTIGVALSDPLGWTAQALEVIRRGDNLDKDLNRLAEIVQEYQVEQILVGLPK 62

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMNG+ GP+     AF+  + +R + +P   WDERL+TV+A++ L++ +VSR KR + +D
Sbjct: 63  NMNGTLGPQGEKVLAFIERLKER-INLPVKTWDERLSTVAAERALLEADVSRSKRKKVID 121

Query: 138 SIAAALILQEVLD 150
            +AAA+ILQ  LD
Sbjct: 122 KMAAAVILQGYLD 134


>gi|55821927|ref|YP_140369.1| Holliday junction resolvase-like protein [Streptococcus
           thermophilus LMG 18311]
 gi|55823846|ref|YP_142287.1| Holliday junction resolvase-like protein [Streptococcus
           thermophilus CNRZ1066]
 gi|62900908|sp|Q5LXP0|RUVX_STRT1 RecName: Full=Putative Holliday junction resolvase
 gi|62900909|sp|Q5M292|RUVX_STRT2 RecName: Full=Putative Holliday junction resolvase
 gi|55737912|gb|AAV61554.1| DNA recombination protein, putative [Streptococcus thermophilus LMG
           18311]
 gi|55739831|gb|AAV63472.1| DNA recombination protein, putative [Streptococcus thermophilus
           CNRZ1066]
          Length = 139

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 84/140 (60%), Gaps = 10/140 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFII 73
           +  +D+G+K +G+AISDP    A     +   K+ + A E     L   +    +  F++
Sbjct: 3   VMGLDVGSKTVGVAISDPLGFTAQGVEII---KINEEAKEFGFDRLGELVKEYQVDKFVV 59

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
           GLP NMN +EGPRV +++A+  + I     +P  + DERLTTV A+++L++  +VSR KR
Sbjct: 60  GLPKNMNNTEGPRVEASKAY-GDKIKEIFNLPVDYQDERLTTVQAERMLVEQADVSRGKR 118

Query: 133 IQKVDSIAAALILQEVLDRI 152
            + +D +AA LILQ  LDR+
Sbjct: 119 KKVIDKLAAQLILQNYLDRM 138


>gi|296333169|ref|ZP_06875622.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305675325|ref|YP_003866997.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296149367|gb|EFG90263.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305413569|gb|ADM38688.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 138

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 81/137 (59%), Gaps = 3/137 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +DLGTK +G+A+SD  G          + +      L  LS +  E  I   ++G P
Sbjct: 3   ILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLSRLSELIKEYTIDKIVLGFP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  +++ F   +++    VP V WDERLTT++A+++LI  +VSR+KR + +
Sbjct: 63  KNMNGTVGPRGEASQTFAK-VLETTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKKVI 121

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA +ILQ  LD ++
Sbjct: 122 DKMAAVMILQGYLDSLN 138


>gi|295396921|ref|ZP_06807045.1| crossover junction endodeoxyribonuclease [Aerococcus viridans ATCC
           11563]
 gi|294974855|gb|EFG50558.1| crossover junction endodeoxyribonuclease [Aerococcus viridans ATCC
           11563]
          Length = 139

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 83/132 (62%), Gaps = 3/132 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +D+G+K +G+A+SDP    A     + + +++ +  L+ L  +  E  + A ++GLP N
Sbjct: 5   GLDVGSKTVGVAVSDPFGWTAQGVEIIPIDEELEEFGLDRLGELIAEYKVEALVLGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MN S GPR  +++ +   +IDR   +P  + DERLTTV A+++LI  +VSRKKR + +D 
Sbjct: 65  MNNSIGPRAEASQKYGQLVIDR-FDLPVFYQDERLTTVQAERMLIANDVSRKKRKKVIDK 123

Query: 139 IAAALILQEVLD 150
           +AA LILQ  LD
Sbjct: 124 LAAVLILQNYLD 135


>gi|317128239|ref|YP_004094521.1| Holliday junction resolvase YqgF [Bacillus cellulosilyticus DSM
           2522]
 gi|315473187|gb|ADU29790.1| Holliday junction resolvase YqgF [Bacillus cellulosilyticus DSM
           2522]
          Length = 142

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 78/135 (57%), Gaps = 3/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV--TQTALELLSFITTENIAAFIIGLP 76
           +  +D+GT  IG+AISD     A     + R K    Q    L   I  ++++  ++GLP
Sbjct: 3   VLGLDVGTHTIGVAISDAFGWTAQGLETIKRAKEDEEQDFSRLDEIIRNKDVSTIVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP     +AF   + +R   +    WDERLTTV+A+++L+  +VSRKKR + +
Sbjct: 63  KNMNGTIGPSGELCQAFAEKLKER-TNLKVELWDERLTTVAAEKMLVSADVSRKKRKKVI 121

Query: 137 DSIAAALILQEVLDR 151
           D +AA +ILQ  LDR
Sbjct: 122 DKMAAVMILQGYLDR 136


>gi|296133403|ref|YP_003640650.1| Holliday junction resolvase YqgF [Thermincola sp. JR]
 gi|296031981|gb|ADG82749.1| Holliday junction resolvase YqgF [Thermincola potens JR]
          Length = 133

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 77/132 (58%), Gaps = 4/132 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +D+GTKRIG+A+SDP R  A     +   K  +   EL   I    ++  ++GLP N
Sbjct: 3   VLGLDVGTKRIGVAVSDPLRLTAQGLTVI---KKGEELTELPRIIEQMEVSEIVVGLPKN 59

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+GS GP+          + +  + +P   +DERLTTV+A++IL++ ++SR KR Q VD 
Sbjct: 60  MDGSLGPKAQEILELTEKLRE-TLQLPVHTYDERLTTVAAERILLEADLSRAKRRQVVDK 118

Query: 139 IAAALILQEVLD 150
            AA LILQ  LD
Sbjct: 119 TAAVLILQGYLD 130


>gi|322386556|ref|ZP_08060183.1| crossover junction endodeoxyribonuclease [Streptococcus cristatus
           ATCC 51100]
 gi|321269475|gb|EFX52408.1| crossover junction endodeoxyribonuclease [Streptococcus cristatus
           ATCC 51100]
          Length = 139

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 84/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++  Q   E L+  +    +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIQIDEEKEQFGFERLTELVEQYKVDKFVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+    I +   +P  + DERLTTV+A+++LI+  +VSR KR + 
Sbjct: 63  KNMNNTSGPRVEASKAYGEK-IAQLFQIPVEYQDERLTTVAAERMLIEQADVSRSKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|228478096|ref|ZP_04062707.1| conserved hypothetical protein [Streptococcus salivarius SK126]
 gi|228250276|gb|EEK09529.1| conserved hypothetical protein [Streptococcus salivarius SK126]
          Length = 139

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 84/140 (60%), Gaps = 10/140 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFII 73
           +  +D+G+K +G+AISDP    A     +   K+ + A E     L   +    +  F++
Sbjct: 3   VMGLDVGSKTVGVAISDPLGFTAQGVEII---KIDEEAEEFGFDRLGELVKEYKVEKFVV 59

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
           GLP NMN +EGPRV +++A+  + I     +P  + DERLTTV A+++L++  ++SR KR
Sbjct: 60  GLPKNMNNTEGPRVEASKAY-GDKIKEIFGIPVDYQDERLTTVQAERMLVEQADISRGKR 118

Query: 133 IQKVDSIAAALILQEVLDRI 152
            + +D +AA LILQ  LDR+
Sbjct: 119 KKVIDKLAAQLILQNYLDRM 138


>gi|114327615|ref|YP_744771.1| endonuclease involved in recombination [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315789|gb|ABI61849.1| endonuclease involved in recombination [Granulibacter bethesdensis
           CGDNIH1]
          Length = 168

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 81/151 (53%), Gaps = 2/151 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           MS+  + DL   L  NQ +  ID G++ IG+A+SD     A P   + R K+   A E+ 
Sbjct: 3   MSLFNVPDLQSRLSRNQRLLGIDPGSRIIGIALSDVLLGIASPYGSIRRGKLRVNAEEIA 62

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +    E     IIGLPL+M+GS GP   + R +   + D    +P   WDER T+    Q
Sbjct: 63  AIARKEEAGGMIIGLPLSMDGSFGPAAQAARDWAIALSD-ATGLPAALWDERETSSRVHQ 121

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLD 150
           +LI   ++ RK+R   VD +AAA++LQ  LD
Sbjct: 122 LLISSADLGRKRRAAVVDKMAAAVMLQSALD 152


>gi|169343788|ref|ZP_02864787.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens C
           str. JGS1495]
 gi|169298348|gb|EDS80438.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens C
           str. JGS1495]
          Length = 137

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 74/135 (54%), Gaps = 1/135 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G+K IG+A+SDP    A     + R   T+    ++       +   ++G+P N
Sbjct: 3   ILGLDIGSKTIGVAVSDPLGWTAQGVTTIKRDCYTKDVEAVMKICKEYGVETIVVGMPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP     +      I++       FWDERLTTV+A + +++ ++SR KR + VD 
Sbjct: 63  MNGTIGPSGEMVKNLCEQ-IEKSFDGKIEFWDERLTTVAAHRAMLEADLSRAKRKKIVDK 121

Query: 139 IAAALILQEVLDRIS 153
           IAA  ILQ  LDRIS
Sbjct: 122 IAATYILQGYLDRIS 136


>gi|299822852|ref|ZP_07054738.1| crossover junction endodeoxyribonuclease [Listeria grayi DSM 20601]
 gi|299816381|gb|EFI83619.1| crossover junction endodeoxyribonuclease [Listeria grayi DSM 20601]
          Length = 138

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 81/134 (60%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           +  +D+G+K +G+AISD  G          + +   Q   + +  +  E  ++  ++GLP
Sbjct: 3   VMGLDVGSKTVGVAISDALGWTAQGIETIAINEAAKQFGYDRVKELAQEYEVSKIVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMN + GPR  S++ +   +++++V +P V WDER+TT +A++ L++ +VSR KR + +
Sbjct: 63  KNMNNTLGPRAESSKKYAE-VLEKRVQLPVVLWDERMTTQAAERTLLEADVSRGKRKKVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKLAAVMILQSYLD 135


>gi|325509094|gb|ADZ20730.1| Holliday junction resolvase-like protein [Clostridium
           acetobutylicum EA 2018]
          Length = 135

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 73/134 (54%), Gaps = 1/134 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  ID+G K IG+A+SDP    A     + RK   +   EL        +   + GLP N
Sbjct: 3   ILGIDVGNKTIGVALSDPLGFTAQGITTIRRKNEEEDIKELKELCEKYEVDTIVCGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ G +      F   +I + + VP   WDERLTTV+A + +++ ++SRKKR + VD 
Sbjct: 63  MNGTIGFQSEKVLGFCE-VIKQNIDVPIKMWDERLTTVAANRAMLEADLSRKKRKKLVDK 121

Query: 139 IAAALILQEVLDRI 152
           +AA  ILQ  LD I
Sbjct: 122 VAATYILQGYLDSI 135


>gi|240145916|ref|ZP_04744517.1| putative holliday junction resolvase [Roseburia intestinalis L1-82]
 gi|257201981|gb|EEV00266.1| putative holliday junction resolvase [Roseburia intestinalis L1-82]
 gi|291535170|emb|CBL08282.1| conserved hypothetical protein TIGR00250 [Roseburia intestinalis
           M50/1]
          Length = 144

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 75/135 (55%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+A+SD     A     + R+   K+ QT   + + I    +   ++G 
Sbjct: 3   ILGLDFGSKTVGVAVSDELLLTAQGLEIIRRQSPNKLRQTLARIEAIIAEYQVECIVLGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN +EG R   T+ F   M++R+  +  + WDERLTTVSA + +++  + R+ R + 
Sbjct: 63  PKNMNNTEGERCEKTKEF-QEMLERRTGLEVILWDERLTTVSADKHMMESGIRREDRKKY 121

Query: 136 VDSIAAALILQEVLD 150
           VD IAA  ILQ  LD
Sbjct: 122 VDEIAAVFILQGYLD 136


>gi|171778528|ref|ZP_02919655.1| hypothetical protein STRINF_00507 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282751|gb|EDT48175.1| hypothetical protein STRINF_00507 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 139

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 85/137 (62%), Gaps = 4/137 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++  +   E L   +    +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGVEIIRIDEEAGEFGFERLGELVKQYKVDKFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN +EGPRV +++ +  + I++   +P  + DERLTTV A+++L++  ++SR KR + 
Sbjct: 63  KNMNNTEGPRVEASKVY-GDKINKLFNIPVDYQDERLTTVQAERMLVEQADISRGKRKKV 121

Query: 136 VDSIAAALILQEVLDRI 152
           +D +AA LILQ  LDR+
Sbjct: 122 IDKLAAQLILQNYLDRM 138


>gi|16079793|ref|NP_390617.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221310675|ref|ZP_03592522.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221314998|ref|ZP_03596803.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221319919|ref|ZP_03601213.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221324200|ref|ZP_03605494.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321312264|ref|YP_004204551.1| Holliday junction resolvase-like protein [Bacillus subtilis BSn5]
 gi|6226496|sp|O34634|RUVX_BACSU RecName: Full=Putative Holliday junction resolvase
 gi|2635185|emb|CAB14681.1| putative Holliday junction resolvase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|291485144|dbj|BAI86219.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           natto BEST195]
 gi|320018538|gb|ADV93524.1| Holliday junction resolvase-like protein [Bacillus subtilis BSn5]
          Length = 138

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +DLGTK +G+A+SD  G          + +      L  LS  I    I   ++G P
Sbjct: 3   ILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLSRLSELIKDYTIDKIVLGFP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  +++ F   +++    VP V WDERLTT++A+++LI  +VSR+KR + +
Sbjct: 63  KNMNGTVGPRGEASQTFAK-VLETTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKKVI 121

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA +ILQ  LD ++
Sbjct: 122 DKMAAVMILQGYLDSLN 138


>gi|289423537|ref|ZP_06425338.1| conserved hypothetical protein [Peptostreptococcus anaerobius
           653-L]
 gi|289156039|gb|EFD04703.1| conserved hypothetical protein [Peptostreptococcus anaerobius
           653-L]
          Length = 140

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 74/136 (54%), Gaps = 1/136 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G   IG+A+SD     A     + R+   +    +   I  +N+   + GLP N
Sbjct: 6   IMGLDIGNNTIGVAVSDLMGMTAQGITTIKRESKKKDIEAIKDIIKEQNVNLIVSGLPKN 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP+      F   +I  +  +   FWDERLTTVSA+++LI  +VSRK R + +D 
Sbjct: 66  MNGTVGPQAEKVMKFCE-LIKEETKLEVEFWDERLTTVSAEKMLISGDVSRKNRKKVIDK 124

Query: 139 IAAALILQEVLDRISF 154
           +AA LILQ  LD   F
Sbjct: 125 LAAVLILQNYLDFKKF 140


>gi|302874707|ref|YP_003843340.1| Holliday junction resolvase YqgF [Clostridium cellulovorans 743B]
 gi|307690680|ref|ZP_07633126.1| Holliday junction resolvase-like protein [Clostridium cellulovorans
           743B]
 gi|302577564|gb|ADL51576.1| Holliday junction resolvase YqgF [Clostridium cellulovorans 743B]
          Length = 135

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 75/134 (55%), Gaps = 1/134 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +D+G K IG+A+SDP    A     + RK +      ++++     +   ++GLP N
Sbjct: 3   VLGLDVGNKTIGVAVSDPLGFTAQGITTINRKNIKTDIETVVNYCNEYTVDTIVVGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP+     AFV  +  +   +    WDERLTTV+A + +++ ++SR KR + VD 
Sbjct: 63  MNGTLGPQSEKVMAFVEKL-KKNTDINIKMWDERLTTVAAHKAMLEADLSRAKRNKIVDK 121

Query: 139 IAAALILQEVLDRI 152
           +AA  ILQ  LD I
Sbjct: 122 VAATYILQGYLDSI 135


>gi|332360144|gb|EGJ37958.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK1056]
          Length = 139

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 85/136 (62%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++  +  LE LS +  E  +  F+IGLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEEKGEFGLERLSELVKEYKVDKFVIGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+    I     +P  + DERLTTV+A+++L++  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGQR-IAELFGLPVDYQDERLTTVAAERMLVEQADISRSKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|88607507|ref|YP_504940.1| hypothetical protein APH_0332 [Anaplasma phagocytophilum HZ]
 gi|146325550|sp|Q2GL11|RUVX_ANAPZ RecName: Full=Putative Holliday junction resolvase
 gi|88598570|gb|ABD44040.1| conserved hypothetical protein TIGR00250 [Anaplasma phagocytophilum
           HZ]
          Length = 166

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 79/145 (54%), Gaps = 1/145 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           I +L  +L+P + I  ID G ++IGLA+SDP    A P     R+ + Q   EL + + +
Sbjct: 6   IRELFSALEPGRRILGIDFGERKIGLALSDPTYLIAIPHSVYHRRNMRQDLGELSAVLRS 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
           E+ A  ++G PL  +G EG      RAF   +I +K  V     DER TT  A +   + 
Sbjct: 66  EDAAVVVMGNPLQSDGLEGEMCQIVRAFAQKLI-KKSGVSIYLHDERYTTAMASRATREA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLD 150
            + RK+  +  D I+AAL+LQ+VLD
Sbjct: 125 GLRRKESQKIDDKISAALVLQQVLD 149


>gi|227432459|ref|ZP_03914446.1| crossover junction endodeoxyribonuclease [Leuconostoc mesenteroides
           subsp. cremoris ATCC 19254]
 gi|227351780|gb|EEJ42019.1| crossover junction endodeoxyribonuclease [Leuconostoc mesenteroides
           subsp. cremoris ATCC 19254]
          Length = 143

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 81/135 (60%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G++ +G++ISDP    A     + + +   +  ++ L  I  E N    ++GLP
Sbjct: 3   ILGLDVGSRTVGVSISDPMGWTAQGVEIIRINEDDKEFGIDRLGEIIKEKNATGVVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQK 135
            NMN SEGPR  ++R +   +I+    +P  F DERLTTV A+++LI + N+SRKKR + 
Sbjct: 63  KNMNNSEGPRAEASRNYAK-LIEETFGLPTDFQDERLTTVEAERMLIEEANISRKKRKKV 121

Query: 136 VDSIAAALILQEVLD 150
           +D IAA  ILQ  LD
Sbjct: 122 IDKIAAEFILQNYLD 136


>gi|167767372|ref|ZP_02439425.1| hypothetical protein CLOSS21_01891 [Clostridium sp. SS2/1]
 gi|167711347|gb|EDS21926.1| hypothetical protein CLOSS21_01891 [Clostridium sp. SS2/1]
          Length = 139

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 79/135 (58%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D GTK +G+A+SD     A P   + RK   K+ +T   +   +   N+   ++GL
Sbjct: 4   ILGLDYGTKTVGVALSDELHITAQPLETITRKDANKLRKTYARIEELVKEYNVEKIVLGL 63

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R   T +F   ++ R+  +  + WDERLTTV+++++L++  V R+ R + 
Sbjct: 64  PKNMNNTVGERGEDTLSFRDALV-RRTGLEVILWDERLTTVASEKVLMESGVRRENRKKV 122

Query: 136 VDSIAAALILQEVLD 150
           +D IAA++ILQ  LD
Sbjct: 123 IDQIAASMILQGYLD 137


>gi|262283641|ref|ZP_06061406.1| conserved hypothetical protein [Streptococcus sp. 2_1_36FAA]
 gi|262260698|gb|EEY79399.1| conserved hypothetical protein [Streptococcus sp. 2_1_36FAA]
          Length = 139

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 83/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + +   +   E L  +  E  +  F+IGLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEDQEEFGFERLGELVAEYKVDKFVIGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV ++RA+   + +    +P  + DERLTTV+A+++LI+  +VSR KR + 
Sbjct: 63  KNMNNTSGPRVEASRAYGAKVTEL-FGLPVEYQDERLTTVAAERMLIEQADVSRNKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|299144217|ref|ZP_07037297.1| putative Holliday junction resolvase [Peptoniphilus sp. oral taxon
           386 str. F0131]
 gi|298518702|gb|EFI42441.1| putative Holliday junction resolvase [Peptoniphilus sp. oral taxon
           386 str. F0131]
          Length = 140

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 74/134 (55%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + I  +D+G K IG+A+SD     A P   + R+   Q   ++ + I   NIA  ++GLP
Sbjct: 6   EKILGLDIGDKWIGVAVSDLLGITAQPLVTIKRESNKQAYEDIYNLIKENNIAKVVVGLP 65

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMN + GP+      F   +   K  V  ++ DER+TT+SA +ILI+  V R+ R Q V
Sbjct: 66  KNMNNTLGPQSEKVLKFSEKL-KNKYGVEIIYIDERMTTISANRILIEGEVRRENRKQYV 124

Query: 137 DSIAAALILQEVLD 150
           D IAA  ILQ  LD
Sbjct: 125 DKIAATYILQTYLD 138


>gi|302023160|ref|ZP_07248371.1| Holliday junction resolvase-like protein [Streptococcus suis
           05HAS68]
 gi|330831916|ref|YP_004400741.1| Holliday junction resolvase-like protein [Streptococcus suis ST3]
 gi|319757235|gb|ADV69177.1| Holliday junction resolvase-like protein [Streptococcus suis JS14]
 gi|329306139|gb|AEB80555.1| Holliday junction resolvase-like protein [Streptococcus suis ST3]
          Length = 136

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 86/134 (64%), Gaps = 4/134 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLPLN 78
            +D+G+K +G+AISDP    A     + + ++  +  LE L+  +    +  F++GLP N
Sbjct: 2   GLDVGSKTVGVAISDPLGFTAQGLEIIPIDEEKGEFGLERLTELVEQYKVDKFVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKVD 137
           MN + GPRV +++A+  +++  +  +P  + DERLTTV+A+++LI+  ++SR KR + +D
Sbjct: 62  MNNTSGPRVEASQAY-GDLLTERYKLPVDYQDERLTTVAAERMLIEQADISRGKRKKVID 120

Query: 138 SIAAALILQEVLDR 151
            +AA LILQ  LDR
Sbjct: 121 KLAAQLILQNYLDR 134


>gi|288870608|ref|ZP_06114688.2| putative holliday junction resolvase [Clostridium hathewayi DSM
           13479]
 gi|288866578|gb|EFC98876.1| putative holliday junction resolvase [Clostridium hathewayi DSM
           13479]
          Length = 161

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (55%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+A+SD     A     + R+   K+ +T   +   I    I   ++G 
Sbjct: 18  IMGLDYGSKTVGVAVSDSLGLTAQALETITREDENKLRKTCARIEELIREYEIETIVLGY 77

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G RV  T +F   M++R+  +P V WDERLTTV +++IL +  V R+ R   
Sbjct: 78  PKNMNNTLGDRVEKTESF-KAMLERRTGLPVVLWDERLTTVQSERILQESGVRRENRKAV 136

Query: 136 VDSIAAALILQEVLD 150
           +D +AA LILQ  LD
Sbjct: 137 IDKVAAGLILQGYLD 151


>gi|157693142|ref|YP_001487604.1| Holliday junction resolvase-like protein [Bacillus pumilus
           SAFR-032]
 gi|194017226|ref|ZP_03055838.1| conserved hypothetical protein [Bacillus pumilus ATCC 7061]
 gi|167012693|sp|A8FFM7|RUVX_BACP2 RecName: Full=Putative Holliday junction resolvase
 gi|157681900|gb|ABV63044.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Bacillus pumilus SAFR-032]
 gi|194011094|gb|EDW20664.1| conserved hypothetical protein [Bacillus pumilus ATCC 7061]
          Length = 138

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 82/137 (59%), Gaps = 3/137 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +DLGTK +G+AISD  G          + +      L  LS I ++      ++G P
Sbjct: 3   ILGLDLGTKTLGVAISDEMGWTAQGIETIKIDEAGGDFGLSRLSEIVSQYGTDKIVLGFP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  ++++F   +++    VP V WDERL+T++A+++LI  +VSR+KR + +
Sbjct: 63  KNMNGTVGPRGEASQSFAK-VLENTYNVPVVLWDERLSTMAAEKMLISADVSRQKRKKVI 121

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA +ILQ  LD ++
Sbjct: 122 DKMAAVMILQGYLDSLN 138


>gi|283782872|ref|YP_003373626.1| RNAse YqgF [Gardnerella vaginalis 409-05]
 gi|298253345|ref|ZP_06977137.1| endonuclease [Gardnerella vaginalis 5-1]
 gi|283441449|gb|ADB13915.1| RNAse YqgF [Gardnerella vaginalis 409-05]
 gi|297532740|gb|EFH71626.1| endonuclease [Gardnerella vaginalis 5-1]
          Length = 152

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 58/143 (40%), Positives = 74/143 (51%), Gaps = 13/143 (9%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            IDLG  R+GLA+SDPG  FAHP     V         E+L  I   N+   +IGLPL +
Sbjct: 5   GIDLGDARVGLALSDPGLTFAHPIGNVQVFGDSFHAIDEVLEVIEDNNVEKVVIGLPLQL 64

Query: 80  NGSEGPRVHSTRAFVHNMIDRKV-----------YVPFVFW-DERLTTVSAQQILIDMNV 127
           +G+EG        +  N+I R             Y+P V W DERLTTVSA + L+  ++
Sbjct: 65  DGTEGKSAKKALRWGKNLIKRMQILHDEKDWALDYMPEVVWKDERLTTVSAHRQLLQADL 124

Query: 128 SRKKRIQKVDSIAAALILQEVLD 150
           S KK    VD  +A LILQ  LD
Sbjct: 125 STKKHRPMVDQQSAVLILQSALD 147


>gi|167037467|ref|YP_001665045.1| Holliday junction resolvase-like protein [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320115881|ref|YP_004186040.1| Holliday junction resolvase YqgF [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|226695311|sp|B0K996|RUVX_THEP3 RecName: Full=Putative Holliday junction resolvase
 gi|166856301|gb|ABY94709.1| Holliday junction resolvase YqgF [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319928972|gb|ADV79657.1| Holliday junction resolvase YqgF [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
          Length = 139

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 73/133 (54%), Gaps = 2/133 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+AISD     A     + R    +    +   I    +   I+GLP N
Sbjct: 3   IMGLDVGDKTIGVAISDLSGTIAQGLTTIKRSSNKKDFERIKQIINEYEVGMIIVGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKVD 137
           MNG+ GP+      FV ++      +P + WDERLTTV AQ++LI+  ++SR KR + +D
Sbjct: 63  MNGTLGPQGQKVMRFVEHL-KEAFSIPIILWDERLTTVEAQRVLIEKADISRAKRKEVID 121

Query: 138 SIAAALILQEVLD 150
            +AA LILQ  LD
Sbjct: 122 KLAAVLILQNYLD 134


>gi|294501347|ref|YP_003565047.1| putative Holliday junction resolvase [Bacillus megaterium QM B1551]
 gi|295706694|ref|YP_003599769.1| putative Holliday junction resolvase [Bacillus megaterium DSM 319]
 gi|294351284|gb|ADE71613.1| putative Holliday junction resolvase [Bacillus megaterium QM B1551]
 gi|294804353|gb|ADF41419.1| putative Holliday junction resolvase [Bacillus megaterium DSM 319]
          Length = 138

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 80/134 (59%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL--VRKKVTQTALELLSFITTENIAAFIIGLP 76
           +  +D+GTK IG+A+SD     A     +    +++ Q+   L   I   ++   ++GLP
Sbjct: 3   VLGLDVGTKTIGVAVSDEMGWTAQGIETIKIADEQMEQSYPRLQQLIDEYSVEKIVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  +   F  N +  K+ +  + WDERL+T++A+++L+  +VSRKKR + +
Sbjct: 63  KNMNGTIGPRGEACIEFADN-VKEKLNIETMMWDERLSTMAAERVLLSADVSRKKRKKVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKMAAVMILQGYLD 135


>gi|162148752|ref|YP_001603213.1| Holliday junction resolvase [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545482|ref|YP_002277711.1| Holliday junction resolvase YqgF [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|189046098|sp|A9HRJ3|RUVX_GLUDA RecName: Full=Putative Holliday junction resolvase
 gi|161787329|emb|CAP56923.1| putative Holliday junction resolvase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533159|gb|ACI53096.1| Holliday junction resolvase YqgF [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 154

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 82/139 (58%), Gaps = 2/139 (1%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           L  +Q +  +D G K IGLA+SD     A P   L R K++  A E+      E +   +
Sbjct: 13  LGRDQRLLGLDPGQKTIGLALSDVSLMLASPYGALRRGKLSVVAAEIRRIAAREGVGGLV 72

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKK 131
            GLPL+M+GS GP   + R ++ ++ + +V +P   WDERL++ +  ++LI D +++R++
Sbjct: 73  SGLPLSMDGSFGPAAQAARDWMISLSE-QVGLPAAMWDERLSSSAVNRMLIQDADMTRQR 131

Query: 132 RIQKVDSIAAALILQEVLD 150
           R + VD +AA+ +LQ  LD
Sbjct: 132 RAELVDKLAASYMLQGALD 150


>gi|197303729|ref|ZP_03168766.1| hypothetical protein RUMLAC_02458 [Ruminococcus lactaris ATCC
           29176]
 gi|197297249|gb|EDY31812.1| hypothetical protein RUMLAC_02458 [Ruminococcus lactaris ATCC
           29176]
          Length = 148

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 78/145 (53%), Gaps = 4/145 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D GTK +G+AISD  +  A     + RK   K+ +T   +   I    +   ++G 
Sbjct: 3   IMGLDYGTKTVGVAISDALKITAQGIETIQRKEENKLRKTCARIEQLIKEYEVEKIVLGF 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MN   G R   +  F   M++R+  +  V WDERLTTV+A++ LI+ +V R+ R Q 
Sbjct: 63  PKHMNNDVGERAEKSLEF-KAMLERRTGLEVVMWDERLTTVAAERTLIESSVRRENRKQY 121

Query: 136 VDSIAAALILQEVLDRISFLESSKG 160
           VD IAA  ILQ  LD +S    + G
Sbjct: 122 VDKIAAVFILQGYLDLLSMRNGADG 146


>gi|225574862|ref|ZP_03783472.1| hypothetical protein RUMHYD_02940 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037936|gb|EEG48182.1| hypothetical protein RUMHYD_02940 [Blautia hydrogenotrophica DSM
           10507]
          Length = 152

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 74/135 (54%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+A+SDP    A     + RK   K+ QT   + + I    +   ++GL
Sbjct: 3   ILGLDFGSKTVGVAVSDPLGLTAQGVEIIRRKSENKLRQTLARIEALIQEYEVETLVLGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R   +  F  +M+ R+  +P V WDERLTTV A + L++  V R+ R   
Sbjct: 63  PKNMNNTMGDRAQKSLEF-RDMLVRRTGLPVVMWDERLTTVEANRTLMESGVRRENRKDY 121

Query: 136 VDSIAAALILQEVLD 150
           VD +AA  ILQ  LD
Sbjct: 122 VDELAAIFILQGYLD 136


>gi|326791231|ref|YP_004309052.1| Holliday junction resolvase [Clostridium lentocellum DSM 5427]
 gi|326541995|gb|ADZ83854.1| Holliday junction resolvase [Clostridium lentocellum DSM 5427]
          Length = 139

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK---VTQTALELLSFITTENIAAFIIGL 75
           I  +D GTK  G+AISDP    A     + R++   +  T   +    T   +   ++GL
Sbjct: 3   ILGLDFGTKTTGVAISDPMGWTAQGLEIIRRQEDEHLKATMKRIEEICTAYKVEKIVLGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R   T  F   + + K+ +P   WDERL+TV+A+Q+L++ ++SRKKR   
Sbjct: 63  PKNMNNTLGERGEKTLLFKEKL-ENKLKIPVETWDERLSTVAAEQVLLEADMSRKKRKNV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA +ILQ  LD
Sbjct: 122 IDKLAATIILQNYLD 136


>gi|168702140|ref|ZP_02734417.1| hypothetical protein GobsU_21610 [Gemmata obscuriglobus UQM 2246]
          Length = 169

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 73/144 (50%), Gaps = 7/144 (4%)

Query: 12  SLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE--LLSFITTENIA 69
           S  P   +  +D GTKRIG+A+ DP R  A P    V  +      E            A
Sbjct: 10  SFPPRGALLGVDYGTKRIGVAVCDPDRVIASP----VGTQANDATREPYFRDLCARSKFA 65

Query: 70  AFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR 129
             ++GLPL+ +G E P     RAF   + D    +P V WDER T+ +A+  L+   ++R
Sbjct: 66  GVVVGLPLHASGEESPMSGEARAFARWLSDL-TGLPVVMWDERHTSFAAESALLGAGLTR 124

Query: 130 KKRIQKVDSIAAALILQEVLDRIS 153
           KKR +KVD +AA +ILQ  +D  S
Sbjct: 125 KKRKEKVDRVAAQMILQTFIDAGS 148


>gi|327439564|dbj|BAK15929.1| predicted endonuclease [Solibacillus silvestris StLB046]
          Length = 138

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 81/134 (60%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISD  G          + +   +  +E ++ +  E N+  F++G P
Sbjct: 3   IMGLDVGSKTVGVAISDALGWTAQGIETIKIDEAAGEFGIERINELVKEHNVTEFVVGYP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMN + GPR  ++ ++   +++     P   WDER+TT++A+++LI+ +VSRKKR Q +
Sbjct: 63  KNMNNTIGPRGEASESY-KKLLEDTFGFPVKLWDERMTTMAAERMLIEADVSRKKRKQVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKMAAVMILQGYLD 135


>gi|291549894|emb|CBL26156.1| conserved hypothetical protein TIGR00250 [Ruminococcus torques
           L2-14]
          Length = 145

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 78/144 (54%), Gaps = 4/144 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           +  +D GTK +G+AISDP    A     + RK   K+ +T   +   I    +   ++G 
Sbjct: 3   VMGLDYGTKTVGVAISDPLGLTAQGIETIQRKEENKLRRTCARIEELIKEYQVEKIVLGF 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MN   G R   +  F  +M+ R+  +  + WDERLTTV+A+Q LI+  V R+ R Q 
Sbjct: 63  PKHMNNDIGERAQKSLEF-RDMLVRRTGLEVIMWDERLTTVAAEQTLIESGVRRENRKQY 121

Query: 136 VDSIAAALILQEVLDRISFLESSK 159
           VD IAA  ILQ  LD I   ++++
Sbjct: 122 VDKIAAVFILQGYLDSIYMQKTAE 145


>gi|30264456|ref|NP_846833.1| Holliday junction resolvase-like protein [Bacillus anthracis str.
           Ames]
 gi|42783515|ref|NP_980762.1| Holliday junction resolvase-like protein [Bacillus cereus ATCC
           10987]
 gi|47529912|ref|YP_021261.1| Holliday junction resolvase-like protein [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49187278|ref|YP_030530.1| Holliday junction resolvase-like protein [Bacillus anthracis str.
           Sterne]
 gi|49478623|ref|YP_038437.1| Holliday junction resolvase-like protein [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|52141120|ref|YP_085709.1| Holliday junction resolvase-like protein [Bacillus cereus E33L]
 gi|65321754|ref|ZP_00394713.1| COG0816: Predicted endonuclease involved in recombination (possible
           Holliday junction resolvase in Mycoplasmas and B.
           subtilis) [Bacillus anthracis str. A2012]
 gi|118479548|ref|YP_896699.1| Holliday junction resolvase-like protein [Bacillus thuringiensis
           str. Al Hakam]
 gi|165872754|ref|ZP_02217382.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           A0488]
 gi|167638500|ref|ZP_02396776.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           A0193]
 gi|177653215|ref|ZP_02935467.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           A0174]
 gi|190566960|ref|ZP_03019876.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis
           Tsiankovskii-I]
 gi|196034479|ref|ZP_03101888.1| conserved hypothetical protein TIGR00250 [Bacillus cereus W]
 gi|196039375|ref|ZP_03106681.1| conserved hypothetical protein TIGR00250 [Bacillus cereus
           NVH0597-99]
 gi|196044968|ref|ZP_03112202.1| conserved hypothetical protein TIGR00250 [Bacillus cereus 03BB108]
 gi|218905581|ref|YP_002453415.1| conserved hypothetical protein TIGR00250 [Bacillus cereus AH820]
 gi|225866368|ref|YP_002751746.1| conserved hypothetical protein TIGR00250 [Bacillus cereus 03BB102]
 gi|227817165|ref|YP_002817174.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           CDC 684]
 gi|228917020|ref|ZP_04080580.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228929431|ref|ZP_04092452.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228935707|ref|ZP_04098520.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228948100|ref|ZP_04110384.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229093457|ref|ZP_04224560.1| Holliday junction resolvase [Bacillus cereus Rock3-42]
 gi|229123927|ref|ZP_04253119.1| Holliday junction resolvase [Bacillus cereus 95/8201]
 gi|229158002|ref|ZP_04286073.1| Holliday junction resolvase [Bacillus cereus ATCC 4342]
 gi|229186626|ref|ZP_04313787.1| Holliday junction resolvase [Bacillus cereus BGSC 6E1]
 gi|229603692|ref|YP_002868674.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           A0248]
 gi|254684142|ref|ZP_05148002.1| Holliday junction resolvase-like protein [Bacillus anthracis str.
           CNEVA-9066]
 gi|254724687|ref|ZP_05186470.1| Holliday junction resolvase-like protein [Bacillus anthracis str.
           A1055]
 gi|254736489|ref|ZP_05194195.1| Holliday junction resolvase-like protein [Bacillus anthracis str.
           Western North America USA6153]
 gi|254741527|ref|ZP_05199214.1| Holliday junction resolvase-like protein [Bacillus anthracis str.
           Kruger B]
 gi|254757706|ref|ZP_05209733.1| Holliday junction resolvase-like protein [Bacillus anthracis str.
           Australia 94]
 gi|300119207|ref|ZP_07056904.1| Holliday junction resolvase-like protein [Bacillus cereus SJ1]
 gi|301055895|ref|YP_003794106.1| holliday junction resolvase-like protein [Bacillus anthracis CI]
 gi|33301603|sp|Q81LK2|RUVX_BACAN RecName: Full=Putative Holliday junction resolvase
 gi|62900956|sp|Q634F8|RUVX_BACCZ RecName: Full=Putative Holliday junction resolvase
 gi|62900978|sp|Q6HDD9|RUVX_BACHK RecName: Full=Putative Holliday junction resolvase
 gi|62900993|sp|Q730E7|RUVX_BACC1 RecName: Full=Putative Holliday junction resolvase
 gi|167012692|sp|A0RIZ9|RUVX_BACAH RecName: Full=Putative Holliday junction resolvase
 gi|226725484|sp|B7JPX2|RUVX_BACC0 RecName: Full=Putative Holliday junction resolvase
 gi|254767494|sp|C3P975|RUVX_BACAA RecName: Full=Putative Holliday junction resolvase
 gi|254767495|sp|C3L5Z2|RUVX_BACAC RecName: Full=Putative Holliday junction resolvase
 gi|254767496|sp|C1EST1|RUVX_BACC3 RecName: Full=Putative Holliday junction resolvase
 gi|30259114|gb|AAP28319.1| RNAse H-fold protein YqgF [Bacillus anthracis str. Ames]
 gi|42739444|gb|AAS43370.1| conserved hypothetical protein TIGR00250 [Bacillus cereus ATCC
           10987]
 gi|47505060|gb|AAT33736.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49181205|gb|AAT56581.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           Sterne]
 gi|49330179|gb|AAT60825.1| conserved hypothetical protein, possible Holliday junction
           resolvase [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|51974589|gb|AAU16139.1| conserved hypothetical protein; possible Holliday junction
           resolvase [Bacillus cereus E33L]
 gi|118418773|gb|ABK87192.1| conserved hypothetical protein [Bacillus thuringiensis str. Al
           Hakam]
 gi|164711530|gb|EDR17079.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           A0488]
 gi|167513348|gb|EDR88718.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           A0193]
 gi|172081497|gb|EDT66569.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           A0174]
 gi|190561951|gb|EDV15920.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis
           Tsiankovskii-I]
 gi|195993021|gb|EDX56980.1| conserved hypothetical protein TIGR00250 [Bacillus cereus W]
 gi|196024456|gb|EDX63129.1| conserved hypothetical protein TIGR00250 [Bacillus cereus 03BB108]
 gi|196030002|gb|EDX68603.1| conserved hypothetical protein TIGR00250 [Bacillus cereus
           NVH0597-99]
 gi|218535867|gb|ACK88265.1| conserved hypothetical protein TIGR00250 [Bacillus cereus AH820]
 gi|225789273|gb|ACO29490.1| conserved hypothetical protein TIGR00250 [Bacillus cereus 03BB102]
 gi|227007492|gb|ACP17235.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           CDC 684]
 gi|228596885|gb|EEK54544.1| Holliday junction resolvase [Bacillus cereus BGSC 6E1]
 gi|228625455|gb|EEK82211.1| Holliday junction resolvase [Bacillus cereus ATCC 4342]
 gi|228659229|gb|EEL14877.1| Holliday junction resolvase [Bacillus cereus 95/8201]
 gi|228689928|gb|EEL43732.1| Holliday junction resolvase [Bacillus cereus Rock3-42]
 gi|228811458|gb|EEM57795.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228823945|gb|EEM69764.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228830219|gb|EEM75835.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228842627|gb|EEM87715.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|229268100|gb|ACQ49737.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           A0248]
 gi|298723427|gb|EFI64172.1| Holliday junction resolvase-like protein [Bacillus cereus SJ1]
 gi|300378064|gb|ADK06968.1| holliday junction resolvase-like protein [Bacillus cereus biovar
           anthracis str. CI]
 gi|324328290|gb|ADY23550.1| Holliday junction resolvase-like protein [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 137

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 81/134 (60%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+GTK +G+AISD  G          + ++  Q   + +S  +   ++   ++GLP
Sbjct: 3   ILGLDVGTKTVGVAISDEMGWTAQGLETIKINEERGQFGFDRISELVKQYDVDKIVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  + + F  N+ +  + +  V WDERL+T++A+++LI  +VSRKKR Q +
Sbjct: 63  KNMNGTIGPRGEACQQFAENLREL-LQLDVVMWDERLSTMAAERLLISADVSRKKRKQVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKMAAVVILQGFLD 135


>gi|295399319|ref|ZP_06809301.1| Holliday junction resolvase YqgF [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312110120|ref|YP_003988436.1| Holliday junction resolvase YqgF [Geobacillus sp. Y4.1MC1]
 gi|294978785|gb|EFG54381.1| Holliday junction resolvase YqgF [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311215221|gb|ADP73825.1| Holliday junction resolvase YqgF [Geobacillus sp. Y4.1MC1]
          Length = 138

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 82/132 (62%), Gaps = 3/132 (2%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +DLGTK +G+A+SD  G          + ++  +  L+ L  I  E  +   ++G P N
Sbjct: 5   GLDLGTKTLGVAVSDELGWTAQGIETISIDEEQGEYGLKRLREIIDEYKVDTIVVGFPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GPR  +++ F   +++++  +P + WDERL+T++A+++LI  +VSRKKR + +D 
Sbjct: 65  MNGTVGPRAEASQRFAK-ILEQEFALPVILWDERLSTMAAERMLIAADVSRKKRRKVIDK 123

Query: 139 IAAALILQEVLD 150
           +AA +ILQ  LD
Sbjct: 124 MAAVVILQSYLD 135


>gi|159900150|ref|YP_001546397.1| Holliday junction resolvase YqgF [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159893189|gb|ABX06269.1| Holliday junction resolvase YqgF [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 158

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 76/135 (56%), Gaps = 1/135 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D+G KRIG+A+ DP R  A  +P L  +   +   +LL  IT   +   +IGLPL 
Sbjct: 10  IIALDVGNKRIGVAMCDPDRIIASGQPTLPAQPTDKAYAQLLHMITEHEVVEVVIGLPLT 69

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           + G  G +  + +AF   + +++  +P   +DER T+V A++ L  M + + K    VD 
Sbjct: 70  LRGEVGAQAKAVQAFSRGL-EKRTKIPITLYDERFTSVEAERSLEAMGIKKSKHRDHVDE 128

Query: 139 IAAALILQEVLDRIS 153
           +AA LILQ+ +  I+
Sbjct: 129 LAAILILQDYMSSIA 143


>gi|326390159|ref|ZP_08211720.1| Holliday junction resolvase YqgF [Thermoanaerobacter ethanolicus JW
           200]
 gi|325993807|gb|EGD52238.1| Holliday junction resolvase YqgF [Thermoanaerobacter ethanolicus JW
           200]
          Length = 139

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 74/133 (55%), Gaps = 2/133 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+AISD     A     + R    +    +   I    +   I+GLP N
Sbjct: 3   IMGLDVGDKTIGVAISDLSGTIAQGLTTIKRSSNKKDFERIKQIINEYEVGMIIVGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKVD 137
           MNG+ GP+      FV ++    + +P + WDERLTTV A+++LI+  ++SR KR + +D
Sbjct: 63  MNGTLGPQGQKVVRFVEHL-KEAINIPIILWDERLTTVEAERVLIEKADISRAKRKEVID 121

Query: 138 SIAAALILQEVLD 150
            +AA LILQ  LD
Sbjct: 122 KLAAVLILQNYLD 134


>gi|253681805|ref|ZP_04862602.1| conserved hypothetical protein [Clostridium botulinum D str. 1873]
 gi|253561517|gb|EES90969.1| conserved hypothetical protein [Clostridium botulinum D str. 1873]
          Length = 135

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 75/134 (55%), Gaps = 1/134 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+A+SDP    A     + RK++ +   E+        I   I GLP N
Sbjct: 3   ILGLDVGNKTIGVAVSDPLGFTAQGITTVHRKELEEDIQEIDKICHEYKIELIISGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ G +      F  +++  K+ +P   WDERLTTV+A + +++ N+SR KR + VD 
Sbjct: 63  MNGTIGEQGEKVLEFC-DVLKEKLDIPIKMWDERLTTVAAHKAMLEANLSRAKRKKIVDK 121

Query: 139 IAAALILQEVLDRI 152
           IAA  ILQ  LD I
Sbjct: 122 IAATYILQGYLDSI 135


>gi|327467925|gb|EGF13415.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK330]
          Length = 139

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 84/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++  +  LE L  +  E  +  F+IGLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEEKGEFGLERLGELVKEYKVDKFVIGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+    I     +P  + DERLTTV+A+++L++  +VSR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGQR-IAELFGLPVDYQDERLTTVAAERMLVEQADVSRSKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|138896124|ref|YP_001126577.1| hypothetical protein GTNG_2487 [Geobacillus thermodenitrificans
           NG80-2]
 gi|196250077|ref|ZP_03148771.1| Holliday junction resolvase YqgF [Geobacillus sp. G11MC16]
 gi|167012727|sp|A4IR78|RUVX_GEOTN RecName: Full=Putative Holliday junction resolvase
 gi|134267637|gb|ABO67832.1| Conserved hypothetical protein [Geobacillus thermodenitrificans
           NG80-2]
 gi|196210261|gb|EDY05026.1| Holliday junction resolvase YqgF [Geobacillus sp. G11MC16]
          Length = 138

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 78/132 (59%), Gaps = 3/132 (2%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +DLGTK +G+A+SD  G          + ++      E L  I  E  +   ++G P N
Sbjct: 5   GLDLGTKTLGVAVSDEFGWTAQGLETIAIDEERGHYGFERLRAIIDEYGVDTIVVGWPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GPR  ++  F   + + +  +P V WDERL+T++A+++LI  +VSRKKR + +D 
Sbjct: 65  MNGTLGPRAEASERFAAKLRE-EFSLPVVLWDERLSTMAAERMLIAADVSRKKRRKVIDK 123

Query: 139 IAAALILQEVLD 150
           +AAA+ILQ  LD
Sbjct: 124 MAAAVILQSYLD 135


>gi|188587786|ref|YP_001920521.1| Holliday junction resolvase-like protein [Clostridium botulinum E3
           str. Alaska E43]
 gi|251780381|ref|ZP_04823301.1| conserved hypothetical protein [Clostridium botulinum E1 str. 'BoNT
           E Beluga']
 gi|226725502|sp|B2V3W4|RUVX_CLOBA RecName: Full=Putative Holliday junction resolvase
 gi|188498067|gb|ACD51203.1| conserved hypothetical protein [Clostridium botulinum E3 str.
           Alaska E43]
 gi|243084696|gb|EES50586.1| conserved hypothetical protein [Clostridium botulinum E1 str. 'BoNT
           E Beluga']
          Length = 137

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 78/136 (57%), Gaps = 3/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPL 77
           I  +DLG K IG+AISDP   F       +R+   +  +E L  I  E  +   +IGLP 
Sbjct: 3   ILGLDLGKKTIGVAISDP-LGFTAQGITTIRRANKEKDMEELRKICDEYKVETIVIGLPK 61

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMNG+ GP        +  +++  + +   FWDERLTTV+A + +++ ++SR KR + VD
Sbjct: 62  NMNGTIGPS-GEIAMEMGKLVEEALNIKVEFWDERLTTVAAHKAMLEADLSRSKRKKIVD 120

Query: 138 SIAAALILQEVLDRIS 153
            +A+  ILQ  LDRIS
Sbjct: 121 KVASTYILQGYLDRIS 136


>gi|47566574|ref|ZP_00237396.1| conserved hypothetical protein protein TIGR00250 [Bacillus cereus
           G9241]
 gi|206969800|ref|ZP_03230754.1| conserved hypothetical protein TIGR00250 [Bacillus cereus AH1134]
 gi|228941554|ref|ZP_04104103.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228954671|ref|ZP_04116694.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228960658|ref|ZP_04122303.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228974484|ref|ZP_04135051.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228981078|ref|ZP_04141379.1| Holliday junction resolvase [Bacillus thuringiensis Bt407]
 gi|228987638|ref|ZP_04147752.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229048094|ref|ZP_04193667.1| Holliday junction resolvase [Bacillus cereus AH676]
 gi|229081651|ref|ZP_04214146.1| Holliday junction resolvase [Bacillus cereus Rock4-2]
 gi|229180662|ref|ZP_04308002.1| Holliday junction resolvase [Bacillus cereus 172560W]
 gi|229192598|ref|ZP_04319559.1| Holliday junction resolvase [Bacillus cereus ATCC 10876]
 gi|296504877|ref|YP_003666577.1| Holliday junction resolvase-like protein [Bacillus thuringiensis
           BMB171]
 gi|47556604|gb|EAL14936.1| conserved hypothetical protein protein TIGR00250 [Bacillus cereus
           G9241]
 gi|206735488|gb|EDZ52656.1| conserved hypothetical protein TIGR00250 [Bacillus cereus AH1134]
 gi|228590905|gb|EEK48763.1| Holliday junction resolvase [Bacillus cereus ATCC 10876]
 gi|228602807|gb|EEK60288.1| Holliday junction resolvase [Bacillus cereus 172560W]
 gi|228701655|gb|EEL54146.1| Holliday junction resolvase [Bacillus cereus Rock4-2]
 gi|228723249|gb|EEL74621.1| Holliday junction resolvase [Bacillus cereus AH676]
 gi|228772098|gb|EEM20550.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228778619|gb|EEM26885.1| Holliday junction resolvase [Bacillus thuringiensis Bt407]
 gi|228785201|gb|EEM33213.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228799022|gb|EEM45994.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228804998|gb|EEM51594.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228818110|gb|EEM64186.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|296325929|gb|ADH08857.1| Holliday junction resolvase-like protein [Bacillus thuringiensis
           BMB171]
 gi|326942168|gb|AEA18064.1| Holliday junction resolvase-like protein [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 137

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 80/134 (59%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+GTK +G+AISD  G          + ++      + +S  +   N+   ++GLP
Sbjct: 3   ILGLDVGTKTVGVAISDEMGWTAQGLETIKINEERGHFGFDRISELVKQYNVDKIVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  + + F  N+ +  + +  V WDERL+T++A+++LI  +VSRKKR Q +
Sbjct: 63  KNMNGTIGPRGEACQQFAENLREL-LQLDVVMWDERLSTMAAERLLISADVSRKKRKQVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKMAAVVILQGFLD 135


>gi|323142335|ref|ZP_08077167.1| RNAse H domain protein, YqgF family [Phascolarctobacterium sp. YIT
           12067]
 gi|322413219|gb|EFY04106.1| RNAse H domain protein, YqgF family [Phascolarctobacterium sp. YIT
           12067]
          Length = 140

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 74/134 (55%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           S+D+GT+ IG+A+SD     A+    + R    +    +   I    +   ++G P NMN
Sbjct: 5   SLDVGTRTIGIAVSDLLGMIANGVETIHRTTEERDYARIAELIAEHEVDTLVVGYPKNMN 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G+ G R  +  A    +      V  V WDERL+TV+A+++L+D ++ RKKR + +D +A
Sbjct: 65  GTIGERAQACEAMAEKLRTMFPKVQVVLWDERLSTVAAEKVLVDADLRRKKRKKVIDMMA 124

Query: 141 AALILQEVLDRISF 154
           A +ILQ  LD  SF
Sbjct: 125 AVVILQNYLDSKSF 138


>gi|15894957|ref|NP_348306.1| Holliday junction resolvase-like protein [Clostridium
           acetobutylicum ATCC 824]
 gi|32130056|sp|Q97IG1|RUVX_CLOAB RecName: Full=Putative Holliday junction resolvase
 gi|15024643|gb|AAK79646.1|AE007678_2 Predicted endonuclease involved in recombination [Clostridium
           acetobutylicum ATCC 824]
          Length = 135

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 73/134 (54%), Gaps = 1/134 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  ID+G K IG+A+SDP    A     + RK   +   EL        +   + GLP N
Sbjct: 3   ILGIDVGNKTIGVALSDPLGFTAQGITTIRRKNEEEDIKELKELCEKYEVDTIVCGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ G +      F   +I + + VP   WDERLTTV+A + +++ ++SRKKR + VD 
Sbjct: 63  MNGTIGFQSEKVLGFCE-VIKQNINVPIKMWDERLTTVTANRAMLEADLSRKKRKKLVDK 121

Query: 139 IAAALILQEVLDRI 152
           +AA  ILQ  L+ I
Sbjct: 122 VAATYILQGYLNSI 135


>gi|242278598|ref|YP_002990727.1| Holliday junction resolvase YqgF [Desulfovibrio salexigens DSM
           2638]
 gi|259495701|sp|C6C125|RUVX_DESAD RecName: Full=Putative Holliday junction resolvase
 gi|242121492|gb|ACS79188.1| Holliday junction resolvase YqgF [Desulfovibrio salexigens DSM
           2638]
          Length = 135

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 83/135 (61%), Gaps = 5/135 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL--ELLSFITTENIAAFIIGLP 76
           + SID GTKR+GLAISDP + FA   P+ V ++ T+ A+  ELL  I  E +   +IGLP
Sbjct: 3   VLSIDFGTKRVGLAISDPDQIFAF--PYKVMERTTRDAMFSELLEIIENEKVGDIVIGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           L+++G +       R F  ++ +R+V +P    DERL++++A+  L +  +  +KR + +
Sbjct: 61  LSLDGEDTLTTRQVRNFAASL-ERRVDLPIHLVDERLSSIAAEDELKEAGLWDRKRKKNL 119

Query: 137 DSIAAALILQEVLDR 151
           DS AA +IL+  L R
Sbjct: 120 DSQAAKIILETWLAR 134


>gi|289578245|ref|YP_003476872.1| Holliday junction resolvase YqgF [Thermoanaerobacter italicus Ab9]
 gi|289527958|gb|ADD02310.1| Holliday junction resolvase YqgF [Thermoanaerobacter italicus Ab9]
          Length = 139

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (56%), Gaps = 4/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+AISD     A     + R    +    +   I    +   I+GLP N
Sbjct: 3   IMGLDVGDKTIGIAISDLSGTIAQGLTTIKRSSNKKDFERIKQIINEYEVGMIIVGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVY-VPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           MNG+ GP+      FV ++  +K + +P + WDERLTTV A+++LI+  ++SR KR + +
Sbjct: 63  MNGTLGPQGQKVVRFVEHL--KKAFSIPIILWDERLTTVEAERVLIEKADISRAKRKEVI 120

Query: 137 DSIAAALILQEVLD 150
           D +AA LILQ  LD
Sbjct: 121 DKLAAVLILQNYLD 134


>gi|228993125|ref|ZP_04153047.1| Holliday junction resolvase [Bacillus pseudomycoides DSM 12442]
 gi|228999173|ref|ZP_04158755.1| Holliday junction resolvase [Bacillus mycoides Rock3-17]
 gi|229006721|ref|ZP_04164355.1| Holliday junction resolvase [Bacillus mycoides Rock1-4]
 gi|228754582|gb|EEM03993.1| Holliday junction resolvase [Bacillus mycoides Rock1-4]
 gi|228760790|gb|EEM09754.1| Holliday junction resolvase [Bacillus mycoides Rock3-17]
 gi|228766584|gb|EEM15225.1| Holliday junction resolvase [Bacillus pseudomycoides DSM 12442]
          Length = 137

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 81/134 (60%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+GTK +G+AISD  G          + ++  Q   + +S  +   N+   I+GLP
Sbjct: 3   ILGLDVGTKTVGVAISDEMGWTAQGLETIKINEERGQFGFDRISELVKQYNVDKIIVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  + + F  ++ +  + +  + WDERL+T++A+++LI  +VSRKKR Q +
Sbjct: 63  KNMNGTIGPRGEACQQFAQSLREL-LQLDVMMWDERLSTMAAERLLISADVSRKKRKQVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKMAAVVILQGYLD 135


>gi|150390226|ref|YP_001320275.1| Holliday junction resolvase YqgF [Alkaliphilus metalliredigens
           QYMF]
 gi|149950088|gb|ABR48616.1| Holliday junction resolvase YqgF [Alkaliphilus metalliredigens
           QYMF]
          Length = 138

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 76/135 (56%), Gaps = 1/135 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G + IG+AISD     A     + R  + +    L   I    +   ++GLP N
Sbjct: 4   IIGLDVGDRTIGIAISDLMGWTAQGVETIQRISIKKDLQRLEELIAQYEVKKILVGLPKN 63

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP+      FV  + +++  +  V WDERL+TV+A++ LI  +VSRKKR Q +D 
Sbjct: 64  MNGTIGPQGEKVLLFVERL-EKRFKLEVVTWDERLSTVAAEKFLIGADVSRKKRKQVIDK 122

Query: 139 IAAALILQEVLDRIS 153
           +AA  ILQ  LD IS
Sbjct: 123 LAAVHILQGYLDSIS 137


>gi|18310760|ref|NP_562694.1| Holliday junction resolvase-like protein [Clostridium perfringens
           str. 13]
 gi|110799090|ref|YP_696464.1| Holliday junction resolvase-like protein [Clostridium perfringens
           ATCC 13124]
 gi|110803306|ref|YP_699063.1| Holliday junction resolvase-like protein [Clostridium perfringens
           SM101]
 gi|168207854|ref|ZP_02633859.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens E
           str. JGS1987]
 gi|168211403|ref|ZP_02637028.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens B
           str. ATCC 3626]
 gi|168214255|ref|ZP_02639880.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens
           CPE str. F4969]
 gi|168218243|ref|ZP_02643868.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens
           NCTC 8239]
 gi|182625715|ref|ZP_02953484.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens D
           str. JGS1721]
 gi|32130045|sp|Q8XJH8|RUVX_CLOPE RecName: Full=Putative Holliday junction resolvase
 gi|118597205|sp|Q0TPH6|RUVX_CLOP1 RecName: Full=Putative Holliday junction resolvase
 gi|118597206|sp|Q0SS44|RUVX_CLOPS RecName: Full=Putative Holliday junction resolvase
 gi|18145441|dbj|BAB81484.1| conserved hypothetical protein [Clostridium perfringens str. 13]
 gi|110673737|gb|ABG82724.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens
           ATCC 13124]
 gi|110683807|gb|ABG87177.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens
           SM101]
 gi|170660825|gb|EDT13508.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens E
           str. JGS1987]
 gi|170710607|gb|EDT22789.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens B
           str. ATCC 3626]
 gi|170714263|gb|EDT26445.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens
           CPE str. F4969]
 gi|177909117|gb|EDT71592.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens D
           str. JGS1721]
 gi|182379748|gb|EDT77227.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens
           NCTC 8239]
          Length = 137

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 73/135 (54%), Gaps = 1/135 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G+K IG+A+SDP    A     + R   T+    ++       +   + G+P N
Sbjct: 3   ILGLDIGSKTIGVAVSDPLGWTAQGVTTIKRDCYTKDVEAVMKICKEYGVETIVAGMPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP     +      I++       FWDERLTTV+A + +++ ++SR KR + VD 
Sbjct: 63  MNGTIGPSGEMVKNLCEQ-IEKSFDGKIEFWDERLTTVAAHRAMLEADLSRAKRKKIVDK 121

Query: 139 IAAALILQEVLDRIS 153
           IAA  ILQ  LDRIS
Sbjct: 122 IAATYILQGYLDRIS 136


>gi|227514537|ref|ZP_03944586.1| crossover junction endodeoxyribonuclease [Lactobacillus fermentum
           ATCC 14931]
 gi|227087094|gb|EEI22406.1| crossover junction endodeoxyribonuclease [Lactobacillus fermentum
           ATCC 14931]
          Length = 145

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 84/134 (62%), Gaps = 4/134 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLPLN 78
            +D+G+K +G+A SDP    A     + + ++     LE ++  + +  +A F++GLP N
Sbjct: 5   GLDVGSKTVGVAESDPLGWTAQAVEIIPIDEEAEVFGLERVAELVKSRQVAGFVLGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQKVD 137
           MN +EGPRV + R +   +++ +  +P  + DERLTTV A ++L+ + +VSR+K+ + +D
Sbjct: 65  MNNTEGPRVEAARHY-GELLEERFGLPIDYQDERLTTVQAHRMLVEEADVSRRKQKKVID 123

Query: 138 SIAAALILQEVLDR 151
            +AA LILQ  LDR
Sbjct: 124 ELAATLILQNYLDR 137


>gi|317497454|ref|ZP_07955774.1| hypothetical protein HMPREF0996_00754 [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|316895240|gb|EFV17402.1| hypothetical protein HMPREF0996_00754 [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 139

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 79/135 (58%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D GTK +G+A+SD     A P   + RK   K+ +T   +   +   ++   ++GL
Sbjct: 4   ILGLDYGTKTVGVALSDELHITAQPLETITRKDANKLRKTYARIEELVKEYDVEKIVLGL 63

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R   T +F   ++ R+  +  + WDERLTTV+++++L++  V R+ R + 
Sbjct: 64  PKNMNNTVGERGEDTLSFRDTLV-RRTGLEVILWDERLTTVASEKVLMESGVRRENRKKV 122

Query: 136 VDSIAAALILQEVLD 150
           +D IAA++ILQ  LD
Sbjct: 123 IDQIAASMILQGYLD 137


>gi|323350688|ref|ZP_08086349.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           VMC66]
 gi|322123108|gb|EFX94799.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           VMC66]
 gi|325686737|gb|EGD28763.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK72]
 gi|332363719|gb|EGJ41499.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK49]
 gi|332365296|gb|EGJ43059.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK1059]
          Length = 139

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 84/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++  +  LE L  +  E  +  F+IGLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEEKGEFGLERLGELVKEYKVDKFVIGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+    +     +P  + DERLTTV+A+++L++  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGQR-VSELFGLPVDYQDERLTTVAAERMLVEQADISRSKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|330718936|ref|ZP_08313536.1| Holliday junction resolvase-like protein [Leuconostoc fallax KCTC
           3537]
          Length = 143

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 80/136 (58%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIA-AFIIGLP 76
           I  +D+G++ +G+A+SDP    A     + + +   +  LE L  I  E  A   ++GLP
Sbjct: 3   ILGLDVGSRTVGVAVSDPMGWTAQGVEIIRIDEAAKEFGLERLGEIIQETKAKGVVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQK 135
            NMN +EGPR  + R +   M++    +   F DERLTTV A+++LI+  +VSRKKR + 
Sbjct: 63  KNMNNTEGPRAQAARDYAK-MVEDNFGLSTDFQDERLTTVQAERMLIEEADVSRKKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D IAA  ILQ  LDR
Sbjct: 122 IDKIAAEFILQNYLDR 137


>gi|255282413|ref|ZP_05346968.1| putative holliday junction resolvase [Bryantella formatexigens DSM
           14469]
 gi|255266997|gb|EET60202.1| putative holliday junction resolvase [Bryantella formatexigens DSM
           14469]
          Length = 161

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVR---KKVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+AISD     A     + R    K+ QT   + + I   ++   ++G 
Sbjct: 9   IMGLDFGSKTVGVAISDELLITAQGIEIIRRTSENKLRQTCARIETLIGEYHVGRIVLGF 68

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R   + AF   M++R+  +P V WDERLTTV A + L++  V R+KR   
Sbjct: 69  PKNMNNTIGERAEKSLAF-KEMLERRTSLPVVMWDERLTTVEADRTLMEGGVRREKRKDY 127

Query: 136 VDSIAAALILQEVLDRISF 154
           VD +AA  ILQ  LD ++ 
Sbjct: 128 VDKLAAVYILQGYLDYLAM 146


>gi|302389909|ref|YP_003825730.1| Holliday junction resolvase YqgF [Thermosediminibacter oceani DSM
           16646]
 gi|302200537|gb|ADL08107.1| Holliday junction resolvase YqgF [Thermosediminibacter oceani DSM
           16646]
          Length = 145

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 80/140 (57%), Gaps = 1/140 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G KRIG+A+SD     A     + R  V +    +   +    +   IIGLPLN
Sbjct: 3   ILGLDVGNKRIGVAVSDELGITAQGVGVIERGDVKRDIERISEIVKRYQVKKVIIGLPLN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP+    + F   +    + +   +WDERL+TV+A+++LID ++SR+KR   +D 
Sbjct: 63  MNGTLGPQGQLVKDFGEKL-RHSLNLDVEYWDERLSTVTAEKVLIDADISRRKRKGVIDK 121

Query: 139 IAAALILQEVLDRISFLESS 158
           ++A +ILQ  LD  S +++ 
Sbjct: 122 LSAIVILQSFLDSRSNIDTG 141


>gi|225028523|ref|ZP_03717715.1| hypothetical protein EUBHAL_02802 [Eubacterium hallii DSM 3353]
 gi|224954166|gb|EEG35375.1| hypothetical protein EUBHAL_02802 [Eubacterium hallii DSM 3353]
          Length = 145

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 76/133 (57%), Gaps = 4/133 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGLPL 77
            +D GTK +G+A+SD     A     + RK   K+ QT   + + I    ++  ++GLP 
Sbjct: 7   GLDYGTKTVGVAVSDALGITAQGVETVTRKSNKKLRQTLARIEALIEEYEVSKIVLGLPK 66

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMN + G R   T+ F   M+ R+  +  V WDERLTT+ +++IL +  V R+ R +++D
Sbjct: 67  NMNNTLGERAEETKEF-QAMLQRRTGLEVVLWDERLTTMESERILQEGGVRRENRKERID 125

Query: 138 SIAAALILQEVLD 150
            +AA LILQ  +D
Sbjct: 126 WMAATLILQSYMD 138


>gi|116491182|ref|YP_810726.1| RNase H-like ribonuclease [Oenococcus oeni PSU-1]
 gi|118587361|ref|ZP_01544787.1| Hollyday junction resolvase [Oenococcus oeni ATCC BAA-1163]
 gi|290890698|ref|ZP_06553768.1| hypothetical protein AWRIB429_1158 [Oenococcus oeni AWRIB429]
 gi|122276636|sp|Q04ER1|RUVX_OENOB RecName: Full=Putative Holliday junction resolvase
 gi|116091907|gb|ABJ57061.1| RNase H-like ribonuclease [Oenococcus oeni PSU-1]
 gi|118432185|gb|EAV38925.1| Hollyday junction resolvase [Oenococcus oeni ATCC BAA-1163]
 gi|290479673|gb|EFD88327.1| hypothetical protein AWRIB429_1158 [Oenococcus oeni AWRIB429]
          Length = 144

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 83/134 (61%), Gaps = 4/134 (2%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTEN-IAAFIIGLPLN 78
            +D+G+K +G+A SDP G   +      + +   +  L+ L  I +E  ++  +IGLP N
Sbjct: 5   GLDVGSKTVGVAQSDPLGWTASSIEIIRINEAQGEFGLDRLGQIISEKKVSGIVIGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQKVD 137
           MN +EGPRV ++R +   M+  +  +P  + DERLT+V A ++LI + ++SR KR + +D
Sbjct: 65  MNNTEGPRVEASRNY-GKMVSERFGLPIDYQDERLTSVEANRMLIEEADLSRAKRKKVID 123

Query: 138 SIAAALILQEVLDR 151
           S+AA LILQ  LD+
Sbjct: 124 SLAAQLILQNYLDK 137


>gi|300854403|ref|YP_003779387.1| putative Holliday junction resolvase [Clostridium ljungdahlii DSM
           13528]
 gi|300434518|gb|ADK14285.1| predicted Holliday junction resolvase [Clostridium ljungdahlii DSM
           13528]
          Length = 137

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 76/135 (56%), Gaps = 1/135 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G + IG+A+SDP    A     + RK   +   EL S      +   + GLP N
Sbjct: 3   ILGLDIGDRTIGVALSDPLGITAQGITTVRRKNQEKDIEELKSICEKYGVECIVSGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ G +     +F   +I++ + VP   WDERLTTV+A + +I+ ++SR KR + VD 
Sbjct: 63  MNGTLGLQSEKVLSFC-KVIEQSIKVPIKMWDERLTTVAAHRAMIEGDLSRAKRKKIVDK 121

Query: 139 IAAALILQEVLDRIS 153
           +AA  ILQ  LD IS
Sbjct: 122 MAAIYILQGYLDSIS 136


>gi|187933084|ref|YP_001885374.1| Holliday junction resolvase-like protein [Clostridium botulinum B
           str. Eklund 17B]
 gi|226725503|sp|B2THN2|RUVX_CLOBB RecName: Full=Putative Holliday junction resolvase
 gi|187721237|gb|ACD22458.1| conserved hypothetical protein [Clostridium botulinum B str. Eklund
           17B]
          Length = 137

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 78/136 (57%), Gaps = 3/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPL 77
           I  +DLG K IG+A+SDP   F       +R+   +  +E L  I  E  +   +IGLP 
Sbjct: 3   ILGLDLGKKTIGVAVSDP-LGFTAQGITTIRRANKEKDMEELRKICDEYKVETIVIGLPK 61

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMNG+ GP        +  +++  + +   FWDERLTTV+A + +++ ++SR KR + VD
Sbjct: 62  NMNGTIGPS-GEIAMEMGKLVEEALNIKVEFWDERLTTVAAHKAMLEADLSRSKRKKIVD 120

Query: 138 SIAAALILQEVLDRIS 153
            +A+  ILQ  LDRIS
Sbjct: 121 KVASTYILQGYLDRIS 136


>gi|325688814|gb|EGD30822.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK115]
          Length = 139

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 85/136 (62%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++  +  LE L  +  E  +  F+IGLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEEKGEFGLERLGELVKEYKVDKFVIGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+   + +    +P  + DERLTTV+A+++L++  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGQRVAEL-FGLPVDYQDERLTTVAAERMLVEQADISRNKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|125719019|ref|YP_001036152.1| Holliday junction resolvase-like protein [Streptococcus sanguinis
           SK36]
 gi|167016514|sp|A3CQZ7|RUVX_STRSV RecName: Full=Putative Holliday junction resolvase
 gi|125498936|gb|ABN45602.1| Holliday junction resolvase, putative [Streptococcus sanguinis
           SK36]
          Length = 139

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 84/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++  +  LE L  +  E  +  F+IGLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEEKGEFGLERLGELVKEYKVDKFVIGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+    I     +P  + DERLTTV+A+++L++  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGQR-IAELFGLPVDYQDERLTTVAAERMLVEQADISRSKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|319946059|ref|ZP_08020308.1| crossover junction endodeoxyribonuclease [Streptococcus australis
           ATCC 700641]
 gi|319747867|gb|EFW00112.1| crossover junction endodeoxyribonuclease [Streptococcus australis
           ATCC 700641]
          Length = 139

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 86/136 (63%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++  +  L+ LS +  E  +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIQIDEEKGEFGLDRLSELVKEYRVDRFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+    ++    +P  + DERLTTV+A+++LI+  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAY-GKRLEELFNLPVEYQDERLTTVAAERMLIEQADISRNKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|260583980|ref|ZP_05851728.1| Holliday junction resolvase [Granulicatella elegans ATCC 700633]
 gi|260158606|gb|EEW93674.1| Holliday junction resolvase [Granulicatella elegans ATCC 700633]
          Length = 140

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 84/135 (62%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALE-LLSFITTENIAAFIIGLP 76
           +  +D+G+K +G+AISDP G         ++ +  ++     ++  +    +   +IG+P
Sbjct: 3   VMGLDVGSKTVGVAISDPLGWTAQGVETIVINEAASEFGFNRVVELVKEYEVEKIVIGMP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQK 135
            NMN + GPR  +++ +  ++ ++++ +P VF DERLTT+ A+++L+ + NVSRKKR + 
Sbjct: 63  KNMNNTAGPRAEASQKYGRSL-EKRLEIPIVFHDERLTTMQAERMLVEEANVSRKKRKEV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA +ILQ  LD
Sbjct: 122 IDKLAAVIILQNYLD 136


>gi|210622572|ref|ZP_03293254.1| hypothetical protein CLOHIR_01202 [Clostridium hiranonis DSM 13275]
 gi|210154155|gb|EEA85161.1| hypothetical protein CLOHIR_01202 [Clostridium hiranonis DSM 13275]
          Length = 140

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 72/132 (54%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+A+SD     A     + R        E+   I  + +   + GLP N
Sbjct: 6   IMGLDIGDKTIGVAVSDLMGMTAQGIKTIKRTSKKNDIEEIKQIIKEKQVNLIVSGLPKN 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP+    + F   +I  +  +   FWDERLTTV+A++ LI  +VSRKKR   +D 
Sbjct: 66  MNGTVGPQGEKVQKFCE-LIKEETGLEIEFWDERLTTVAAEKTLITADVSRKKRKNVIDM 124

Query: 139 IAAALILQEVLD 150
           +AA LILQ  LD
Sbjct: 125 MAAVLILQGYLD 136


>gi|324992637|gb|EGC24558.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK405]
 gi|324995834|gb|EGC27745.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK678]
 gi|325695338|gb|EGD37238.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK150]
 gi|327460040|gb|EGF06379.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK1]
 gi|327463467|gb|EGF09786.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK1057]
 gi|327472186|gb|EGF17623.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK408]
 gi|327488630|gb|EGF20430.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK1058]
          Length = 139

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 85/136 (62%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++  +  LE L  +  E  +  F+IGLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEEKGEFGLERLGELVKEYKVDKFVIGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+   + +    +P  + DERLTTV+A+++L++  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGQRVAEL-FGLPVDYQDERLTTVAAERMLVEQADISRSKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|297544525|ref|YP_003676827.1| Holliday junction resolvase YqgF [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296842300|gb|ADH60816.1| Holliday junction resolvase YqgF [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 139

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (56%), Gaps = 4/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+AISD     A     + R    +    +   I    +   I+GLP N
Sbjct: 3   IMGLDVGDKTIGIAISDLSGTIAQGLTTIKRSSNKKDFERIKQIINEYEVGMIIVGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVY-VPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           MNG+ GP+      FV ++  +K + +P + WDERLTTV A+++LI+  ++SR KR + +
Sbjct: 63  MNGTLGPQGQKVVRFVEHL--KKAFSIPIILWDERLTTVEAERVLIEKADISRAKRKEVI 120

Query: 137 DSIAAALILQEVLD 150
           D +AA LILQ  LD
Sbjct: 121 DKLAAILILQNYLD 134


>gi|85707967|ref|ZP_01039033.1| hypothetical protein NAP1_01990 [Erythrobacter sp. NAP1]
 gi|85689501|gb|EAQ29504.1| hypothetical protein NAP1_01990 [Erythrobacter sp. NAP1]
          Length = 85

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/82 (47%), Positives = 58/82 (70%), Gaps = 1/82 (1%)

Query: 72  IIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           ++GLP NM+GSEGPR  ++RAF  N  +    +P + WDER +T SA+  +I  ++SRKK
Sbjct: 1   MLGLPRNMDGSEGPRAQASRAFARN-AEEAFALPLLLWDERWSTQSAEAAMIGQDMSRKK 59

Query: 132 RIQKVDSIAAALILQEVLDRIS 153
           R + +DS AAA+ILQ  +DR++
Sbjct: 60  RAESIDSHAAAVILQGAIDRLA 81


>gi|158320692|ref|YP_001513199.1| Holliday junction resolvase YqgF [Alkaliphilus oremlandii OhILAs]
 gi|158140891|gb|ABW19203.1| Holliday junction resolvase YqgF [Alkaliphilus oremlandii OhILAs]
          Length = 139

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/133 (39%), Positives = 73/133 (54%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+G K IG+AISD     A     + R  + +    L   I   +I   ++GLP NMN
Sbjct: 6   GLDVGDKTIGVAISDLFGWTAQGLETIQRIGIKKDLQRLEVIIKEHDINKIVVGLPKNMN 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G+ GP+      F   +  R   V  V WDERLTTV+A++ LI+ +VSRKKR + +D +A
Sbjct: 66  GTIGPQGEKVLEFNERLKGRFKDVEIVLWDERLTTVAAERSLIEADVSRKKRKEVIDKMA 125

Query: 141 AALILQEVLDRIS 153
           A  ILQ  LD  S
Sbjct: 126 AVYILQGYLDSAS 138


>gi|218513131|ref|ZP_03509971.1| holliday junction resolvase protein [Rhizobium etli 8C-3]
          Length = 78

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/78 (53%), Positives = 54/78 (69%)

Query: 1  MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
          M++L IE++  +L P Q IA +DLGTK IGL++SD GRRFA PRP + R K T  A  LL
Sbjct: 1  MTVLTIEEMAATLAPGQAIAGLDLGTKTIGLSMSDLGRRFATPRPVIRRAKFTIDAQALL 60

Query: 61 SFITTENIAAFIIGLPLN 78
           F   E +A F+IGLP+N
Sbjct: 61 DFAAKERVAGFVIGLPMN 78


>gi|157151461|ref|YP_001451289.1| Holliday junction resolvase-like protein [Streptococcus gordonii
           str. Challis substr. CH1]
 gi|189046109|sp|A8AZS9|RUVX_STRGC RecName: Full=Putative Holliday junction resolvase
 gi|157076255|gb|ABV10938.1| conserved hypothetical protein TIGR00250 [Streptococcus gordonii
           str. Challis substr. CH1]
          Length = 139

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 83/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + +   +   E L  +  E  +  F+IGLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEDQEEFGFERLGELVAEYKVDKFVIGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+   + +    +P  + DERLTTV+A+++LI+  +VSR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGAKVTEL-FGLPVEYQDERLTTVAAERMLIEQADVSRNKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|291559331|emb|CBL38131.1| conserved hypothetical protein TIGR00250 [butyrate-producing
           bacterium SSC/2]
          Length = 139

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 79/135 (58%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D GTK +G+A+SD     A P   + RK   K+ +T   +   +   ++   ++GL
Sbjct: 4   ILGLDYGTKTVGVALSDELHITAQPLETITRKDANKLRKTYARIEELVKEYDVEKIVLGL 63

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R   T +F   ++ R+  +  + WDERLTTV+++++L++  V R+ R + 
Sbjct: 64  PKNMNNTVGERGEDTLSFRDALV-RRTGLEVILWDERLTTVASEKVLMESGVRRENRKKV 122

Query: 136 VDSIAAALILQEVLD 150
           +D IAA++ILQ  LD
Sbjct: 123 IDQIAASMILQGYLD 137


>gi|330994858|ref|ZP_08318780.1| Putative Holliday junction resolvase [Gluconacetobacter sp. SXCC-1]
 gi|329758119|gb|EGG74641.1| Putative Holliday junction resolvase [Gluconacetobacter sp. SXCC-1]
          Length = 246

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 86/151 (56%), Gaps = 2/151 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +  I  L   L+ +Q +  +D G K IG+A+SD G   A P   L R K++  A ++ 
Sbjct: 84  MPLFNISHLRTLLRRDQRLLGLDPGRKTIGVALSDVGLMLASPHTGLKRAKLSVNAAQIS 143

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +    +++   ++GLPL+++GS GP   + R +  N+ +    +P   WDERL++ +  +
Sbjct: 144 TIARAQDVGGLVVGLPLSLDGSFGPAAQAARDWTLNLSE-LTGLPAAMWDERLSSSAVNR 202

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLD 150
            LI + +++R++R   VD +AAA ILQ  LD
Sbjct: 203 FLIAEADMTRQRRGAVVDQMAAAYILQAALD 233


>gi|251783469|ref|YP_002997774.1| Holliday junction resolvase-like protein [Streptococcus
           dysgalactiae subsp. equisimilis GGS_124]
 gi|242392101|dbj|BAH82560.1| Holliday junction resolvase-like protein [Streptococcus
           dysgalactiae subsp. equisimilis GGS_124]
 gi|322412847|gb|EFY03755.1| Holliday junction resolvase-like protein [Streptococcus
           dysgalactiae subsp. dysgalactiae ATCC 27957]
 gi|323128215|gb|ADX25512.1| Holliday junction resolvase-like protein [Streptococcus
           dysgalactiae subsp. equisimilis ATCC 12394]
          Length = 139

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 82/136 (60%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++  +   E L   +    +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIKIDEEKEEFGFERLGELVKQYQVDQFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+    I+    +P  + DERLTTV A+++LI+  +VSR KR + 
Sbjct: 63  KNMNNTSGPRVEASKAYGEK-IESLFSLPVHYQDERLTTVEAERMLIEQADVSRGKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|167040129|ref|YP_001663114.1| Holliday junction resolvase-like protein [Thermoanaerobacter sp.
           X514]
 gi|256752542|ref|ZP_05493398.1| Holliday junction resolvase YqgF [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300914213|ref|ZP_07131529.1| Holliday junction resolvase YqgF [Thermoanaerobacter sp. X561]
 gi|307724552|ref|YP_003904303.1| Holliday junction resolvase YqgF [Thermoanaerobacter sp. X513]
 gi|226695312|sp|B0K0Q3|RUVX_THEPX RecName: Full=Putative Holliday junction resolvase
 gi|166854369|gb|ABY92778.1| Holliday junction resolvase YqgF [Thermoanaerobacter sp. X514]
 gi|256748608|gb|EEU61656.1| Holliday junction resolvase YqgF [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300889148|gb|EFK84294.1| Holliday junction resolvase YqgF [Thermoanaerobacter sp. X561]
 gi|307581613|gb|ADN55012.1| Holliday junction resolvase YqgF [Thermoanaerobacter sp. X513]
          Length = 139

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 74/133 (55%), Gaps = 2/133 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+AISD     A     + R    +    +   I    +   I+GLP N
Sbjct: 3   IMGLDVGDKTIGIAISDLSGTIAQGLTTIKRSSNKKDFERIKQIINEYEVGMIIVGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKVD 137
           +NG+ GP+      FV ++    + +P + WDERLTTV A+++LI+  ++SR KR + +D
Sbjct: 63  LNGTLGPQGQKVVRFVEHL-KEAINIPIILWDERLTTVEAERVLIEKADISRAKRKEVID 121

Query: 138 SIAAALILQEVLD 150
            +AA LILQ  LD
Sbjct: 122 KLAAVLILQNYLD 134


>gi|153854408|ref|ZP_01995686.1| hypothetical protein DORLON_01681 [Dorea longicatena DSM 13814]
 gi|149752934|gb|EDM62865.1| hypothetical protein DORLON_01681 [Dorea longicatena DSM 13814]
          Length = 146

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 76/138 (55%), Gaps = 4/138 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+A+SDP    A     + RK   K+ +T   + + I    +   ++GL
Sbjct: 5   IMGLDYGSKTVGVAVSDPLGITAQGVETICRKDENKLRKTCARIEALIEEYQVTKIVLGL 64

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MN   G R   + AF   M+ R+  +  V WDERLTTV A++ LI+  V R+ R + 
Sbjct: 65  PKHMNNDIGDRAEKSMAF-GEMLKRRTGLEVVMWDERLTTVEAERTLIENKVRREDRKKY 123

Query: 136 VDSIAAALILQEVLDRIS 153
           +D IAA  ILQ  LD ++
Sbjct: 124 IDKIAAVFILQGYLDSLA 141


>gi|324989653|gb|EGC21597.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK353]
          Length = 139

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 83/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + +   +  LE L  +  E  +  F+IGLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEDKGEFGLERLGELVKEYKVDKFVIGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+    I     +P  + DERLTTV+A+++L++  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGQR-IAELFGLPVDYQDERLTTVAAERMLVEQADISRSKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|218899555|ref|YP_002447966.1| hypothetical protein TIGR00250 [Bacillus cereus G9842]
 gi|228902914|ref|ZP_04067055.1| Holliday junction resolvase [Bacillus thuringiensis IBL 4222]
 gi|228910222|ref|ZP_04074040.1| Holliday junction resolvase [Bacillus thuringiensis IBL 200]
 gi|228967461|ref|ZP_04128490.1| Holliday junction resolvase [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|229098858|ref|ZP_04229794.1| Holliday junction resolvase [Bacillus cereus Rock3-29]
 gi|229105020|ref|ZP_04235674.1| Holliday junction resolvase [Bacillus cereus Rock3-28]
 gi|226725485|sp|B7IYP0|RUVX_BACC2 RecName: Full=Putative Holliday junction resolvase
 gi|218541329|gb|ACK93723.1| conserved hypothetical protein TIGR00250 [Bacillus cereus G9842]
 gi|228678397|gb|EEL32620.1| Holliday junction resolvase [Bacillus cereus Rock3-28]
 gi|228684531|gb|EEL38473.1| Holliday junction resolvase [Bacillus cereus Rock3-29]
 gi|228792238|gb|EEM39811.1| Holliday junction resolvase [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228849386|gb|EEM94222.1| Holliday junction resolvase [Bacillus thuringiensis IBL 200]
 gi|228856698|gb|EEN01217.1| Holliday junction resolvase [Bacillus thuringiensis IBL 4222]
          Length = 137

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 80/134 (59%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+GTK +G+A+SD  G          + ++      + +S  +   N+   ++GLP
Sbjct: 3   ILGLDVGTKTVGVAMSDEMGWTAQGLETIKINEERGHFGFDRISELVKQYNVDKIVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  + + F  N+ +  + +  V WDERL+T++A+++LI  +VSRKKR Q +
Sbjct: 63  KNMNGTIGPRGEACQQFAENLREL-LQLDVVMWDERLSTMAAERLLISADVSRKKRKQVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKMAAVVILQGFLD 135


>gi|163942136|ref|YP_001647020.1| Holliday junction resolvase-like protein [Bacillus
           weihenstephanensis KBAB4]
 gi|229013604|ref|ZP_04170735.1| Holliday junction resolvase [Bacillus mycoides DSM 2048]
 gi|229032036|ref|ZP_04188019.1| Holliday junction resolvase [Bacillus cereus AH1271]
 gi|229062082|ref|ZP_04199407.1| Holliday junction resolvase [Bacillus cereus AH603]
 gi|229135209|ref|ZP_04264008.1| Holliday junction resolvase [Bacillus cereus BDRD-ST196]
 gi|229169130|ref|ZP_04296845.1| Holliday junction resolvase [Bacillus cereus AH621]
 gi|229175060|ref|ZP_04302578.1| Holliday junction resolvase [Bacillus cereus MM3]
 gi|226725488|sp|A9VI07|RUVX_BACWK RecName: Full=Putative Holliday junction resolvase
 gi|163864333|gb|ABY45392.1| Holliday junction resolvase YqgF [Bacillus weihenstephanensis
           KBAB4]
 gi|228608428|gb|EEK65732.1| Holliday junction resolvase [Bacillus cereus MM3]
 gi|228614358|gb|EEK71468.1| Holliday junction resolvase [Bacillus cereus AH621]
 gi|228648251|gb|EEL04287.1| Holliday junction resolvase [Bacillus cereus BDRD-ST196]
 gi|228717234|gb|EEL68909.1| Holliday junction resolvase [Bacillus cereus AH603]
 gi|228729281|gb|EEL80275.1| Holliday junction resolvase [Bacillus cereus AH1271]
 gi|228747663|gb|EEL97535.1| Holliday junction resolvase [Bacillus mycoides DSM 2048]
          Length = 137

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 80/134 (59%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+GTK +G+A+SD  G          + ++      + +S  +   N+   ++GLP
Sbjct: 3   ILGLDVGTKTVGVAMSDEMGWTAQGLETIRINEERGHFGFDRISELVKQYNVDKIVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  + + F  N+ +  + +  V WDERL+T++A+++LI  +VSRKKR Q +
Sbjct: 63  KNMNGTIGPRGEACQQFAENLRNL-LQLEVVMWDERLSTMAAERLLISADVSRKKRKQVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKMAAVVILQGFLD 135


>gi|317122056|ref|YP_004102059.1| Holliday junction resolvase YqgF [Thermaerobacter marianensis DSM
           12885]
 gi|315592036|gb|ADU51332.1| Holliday junction resolvase YqgF [Thermaerobacter marianensis DSM
           12885]
          Length = 326

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 79/140 (56%), Gaps = 9/140 (6%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLG++ IG+AISDP    A P   L R+   + A ++   +        ++G P  ++
Sbjct: 5   GLDLGSRVIGVAISDPEGIVARPLGSLPRRTDAENAAQVADLVRRHGAGGVVVGWPRRLD 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFV-FWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           G+ GP   +   F   +  R+  VP V  WDERL+TV A+++LI  ++SR++R Q +D +
Sbjct: 65  GTRGPEAEAAERFADAL--REAGVPRVTLWDERLSTVEAERVLIAADLSRRRRKQIIDRM 122

Query: 140 AAALILQEVLDRISFLESSK 159
           AA +ILQ      +FL+S +
Sbjct: 123 AATVILQ------AFLQSQR 136


>gi|291541678|emb|CBL14788.1| conserved hypothetical protein TIGR00250 [Ruminococcus bromii
           L2-63]
          Length = 141

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 71/134 (52%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII-GLPL 77
           I S+DLG  R G+A+ D     A P   +  K   Q  LE +S    E  A  I+ GLP 
Sbjct: 3   IMSVDLGKARTGIAVCDKTEFLASPYTVIFEKSPKQ-LLEKVSNTAKETKAELIVVGLPK 61

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NM+GSEG    + RAF  N+ + +  +  V  DER TT++A   L   N   KKR   VD
Sbjct: 62  NMDGSEGESAQNARAFAENLSN-ETGIECVMQDERGTTITAHNFLNTTNTRGKKRKNVVD 120

Query: 138 SIAAALILQEVLDR 151
            +AA +ILQ+ LD+
Sbjct: 121 EVAATIILQDYLDK 134


>gi|118597213|sp|Q1WT34|RUVX_LACS1 RecName: Full=Putative Holliday junction resolvase
          Length = 147

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 84/135 (62%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTEN-IAAFIIGLP 76
           +  +D+G++ +G+A+SD  G          + +   +  L+ ++ +  EN +  F++GLP
Sbjct: 4   LMGLDVGSRTVGVAVSDMLGWTAQGVEIVQINEDEQEFGLDRIAELVKENEVVGFVLGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV + +A+   +++ K  +P  F DERLTTV A+++L++  + SRKKR + 
Sbjct: 64  KNMNNTSGPRVEAAKAY-GELLEEKFNLPIDFIDERLTTVEAERMLVEQADASRKKRKKV 122

Query: 136 VDSIAAALILQEVLD 150
           +D +AA+LILQ  LD
Sbjct: 123 IDKLAASLILQNYLD 137


>gi|90962084|ref|YP_536000.1| Holliday junction resolvase-like protein [Lactobacillus salivarius
           UCC118]
 gi|90821278|gb|ABD99917.1| Endonuclease involved in recombination [Lactobacillus salivarius
           UCC118]
          Length = 143

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 83/133 (62%), Gaps = 4/133 (3%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTEN-IAAFIIGLPLN 78
            +D+G++ +G+A+SD  G          + +   +  L+ ++ +  EN +  F++GLP N
Sbjct: 2   GLDVGSRTVGVAVSDMLGWTAQGVEIVQINEDEQEFGLDRIAELVKENEVVGFVLGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKVD 137
           MN + GPRV + +A+   +++ K  +P  F DERLTTV A+++L++  + SRKKR + +D
Sbjct: 62  MNNTSGPRVEAAKAY-GELLEEKFNLPIDFIDERLTTVEAERMLVEQADASRKKRKKVID 120

Query: 138 SIAAALILQEVLD 150
            +AA+LILQ  LD
Sbjct: 121 KLAASLILQNYLD 133


>gi|229163335|ref|ZP_04291287.1| Holliday junction resolvase [Bacillus cereus R309803]
 gi|228620116|gb|EEK76990.1| Holliday junction resolvase [Bacillus cereus R309803]
          Length = 137

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 80/134 (59%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+GTK +G+A+SD  G          + ++      + +S  +   N+   ++GLP
Sbjct: 3   ILGLDVGTKTVGVAMSDEMGWTAQGLETIRINEERGHFGFDRISELVKQYNVDKIVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  + + F  N+ +  + +  V WDERL+T++A+++LI  +VSRKKR Q +
Sbjct: 63  KNMNGTIGPRGEACQQFAENLREL-LQLDVVMWDERLSTMAAERLLISADVSRKKRKQVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKMAAVVILQGFLD 135


>gi|331269728|ref|YP_004396220.1| Holliday junction resolvase YqgF [Clostridium botulinum BKT015925]
 gi|329126278|gb|AEB76223.1| Holliday junction resolvase YqgF [Clostridium botulinum BKT015925]
          Length = 135

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 75/134 (55%), Gaps = 1/134 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+A+SDP    A     + RK++ +   E+        I   I GLP N
Sbjct: 3   ILGLDIGNKTIGVAVSDPLGFTAQGITTIHRKELEKDIEEVGKICHEYKIELIISGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ G +      F  +++  K+ +P   WDERLTTV+A + +++ N+SR KR + VD 
Sbjct: 63  MNGTIGEQGEKVLEFC-DVLKDKLDIPIKMWDERLTTVAAHRAMLEANLSRAKRKKIVDK 121

Query: 139 IAAALILQEVLDRI 152
           IAA  ILQ  LD I
Sbjct: 122 IAATYILQGYLDSI 135


>gi|302380637|ref|ZP_07269102.1| Holliday junction resolvase-like protein [Finegoldia magna
           ACS-171-V-Col3]
 gi|303233893|ref|ZP_07320542.1| RNAse H domain protein, YqgF family [Finegoldia magna BVS033A4]
 gi|302311580|gb|EFK93596.1| Holliday junction resolvase-like protein [Finegoldia magna
           ACS-171-V-Col3]
 gi|302494818|gb|EFL54575.1| RNAse H domain protein, YqgF family [Finegoldia magna BVS033A4]
          Length = 137

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 74/130 (56%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+G + IG+AISDP    A     + RK   +    +   I  + ++  I+GLP NMN
Sbjct: 6   GLDVGDRTIGVAISDPFLLTAQSLMTIKRKSKIEDIEIINGIIKEKEVSKIIVGLPKNMN 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
            + GP+    + FV  +  +   +   + DERLTTVSA ++LI+ NVSRKKR   +DS+A
Sbjct: 66  NTIGPQAKKVKTFVKEL-RKHTDLDIEYVDERLTTVSATRVLIEQNVSRKKRKDVIDSVA 124

Query: 141 AALILQEVLD 150
           A  ILQ  LD
Sbjct: 125 ATYILQTYLD 134


>gi|56421089|ref|YP_148407.1| hypothetical protein GK2554 [Geobacillus kaustophilus HTA426]
 gi|261418430|ref|YP_003252112.1| Holliday junction resolvase YqgF [Geobacillus sp. Y412MC61]
 gi|297529282|ref|YP_003670557.1| Holliday junction resolvase YqgF [Geobacillus sp. C56-T3]
 gi|319767610|ref|YP_004133111.1| Holliday junction resolvase YqgF [Geobacillus sp. Y412MC52]
 gi|62900906|sp|Q5KWU7|RUVX_GEOKA RecName: Full=Putative Holliday junction resolvase
 gi|56380931|dbj|BAD76839.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
 gi|261374887|gb|ACX77630.1| Holliday junction resolvase YqgF [Geobacillus sp. Y412MC61]
 gi|297252534|gb|ADI25980.1| Holliday junction resolvase YqgF [Geobacillus sp. C56-T3]
 gi|317112476|gb|ADU94968.1| Holliday junction resolvase YqgF [Geobacillus sp. Y412MC52]
          Length = 138

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 78/132 (59%), Gaps = 3/132 (2%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +DLGTK +G+A+SD  G          +  +     L+ L  I  E  +   ++G P N
Sbjct: 5   GLDLGTKTLGVAVSDELGLTAQGLETIAIDTERGDYGLKRLRAIIDEYGVDTIVVGWPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GPR  ++  F   + + +  +P V WDERL+T++A+++LI  +VSRKKR + +D 
Sbjct: 65  MNGTLGPRAEASERFAAKLRE-EFSLPVVLWDERLSTMAAERMLIAADVSRKKRRKVIDK 123

Query: 139 IAAALILQEVLD 150
           +AAA+ILQ  LD
Sbjct: 124 MAAAVILQSYLD 135


>gi|325697277|gb|EGD39163.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK160]
          Length = 139

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 84/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + +   +  LE L  +  E  +  F+IGLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEDKGEFGLERLGELVKEYKVDKFVIGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+   + +    +P  + DERLTTV+A+++L++  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGQRVAEL-FGLPVDYQDERLTTVAAERMLVEQADISRSKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|238924257|ref|YP_002937773.1| hypothetical protein EUBREC_1895 [Eubacterium rectale ATCC 33656]
 gi|259495705|sp|C4ZAY4|RUVX_EUBR3 RecName: Full=Putative Holliday junction resolvase
 gi|238875932|gb|ACR75639.1| hypothetical protein EUBREC_1895 [Eubacterium rectale ATCC 33656]
          Length = 143

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 77/138 (55%), Gaps = 4/138 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+A+SD     A     + RK   K+ QT   +   I    +   ++G 
Sbjct: 3   ILGLDFGSKTVGVAVSDELLITAQGVEIVRRKSPSKLRQTLARIEEIIAEYKVDRIVLGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN +EG R   T+ F  +M+ R+  +  ++WDERLTTV+A + +++  + R+ R + 
Sbjct: 63  PKNMNNTEGERCEKTKEF-GDMLARRTGLEVIYWDERLTTVAADRSMMETGIRRENRKEF 121

Query: 136 VDSIAAALILQEVLDRIS 153
           VD IAA  ILQ  LD +S
Sbjct: 122 VDEIAAIFILQGYLDYLS 139


>gi|71083767|ref|YP_266487.1| putative Holliday junction resolvase [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|91763197|ref|ZP_01265161.1| Putative Holliday junction resolvase [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|146325587|sp|Q4FLQ5|RUVX_PELUB RecName: Full=Putative Holliday junction resolvase
 gi|71062880|gb|AAZ21883.1| Putative Holliday junction resolvase [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|91717610|gb|EAS84261.1| Putative Holliday junction resolvase [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 151

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLG+KRIG++I D  +  A P   + +    +   EL   I   NI   I+G P+NM+
Sbjct: 19  GLDLGSKRIGVSICDERQSIATPFKTINKTNTNELIDELKIIIKDNNIGGIIVGNPVNMD 78

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQI--LIDMNVSRKKRIQKVDS 138
           GS G    S      N I + + +P + WDERL+TV A  +  L+D+NVS  KR++ +D 
Sbjct: 79  GSLGRSAQSVNDVASN-ISKSIDLPVILWDERLSTVGAFNLSSLLDVNVS--KRVKTIDQ 135

Query: 139 IAAALILQEVLD 150
            AAA ILQ  +D
Sbjct: 136 NAAAFILQGAID 147


>gi|312870461|ref|ZP_07730581.1| RNAse H domain protein, YqgF family [Lactobacillus oris PB013-T2-3]
 gi|311094018|gb|EFQ52342.1| RNAse H domain protein, YqgF family [Lactobacillus oris PB013-T2-3]
          Length = 147

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 82/134 (61%), Gaps = 3/134 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLPLN 78
            +D+G+K +G+A+SDP    A     + + +      L+ ++  +  E +A F++GLP N
Sbjct: 5   GLDVGSKTVGIAVSDPLGWTAQAVEIIPIDEDEEVFGLDRVAELVDKEQVAGFVLGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQKVD 137
           MN +EGPRV +++ +   + +R   +P  F DERLTTV A ++L+ + ++SR K+ + +D
Sbjct: 65  MNNTEGPRVAASKHYGELLQERFPQIPIDFQDERLTTVEAHRMLVEEADISRAKQKKVID 124

Query: 138 SIAAALILQEVLDR 151
            +AA  ILQ  LDR
Sbjct: 125 EVAATFILQSYLDR 138


>gi|292670704|ref|ZP_06604130.1| YqgF family crossover junction endodeoxyribonuclease [Selenomonas
           noxia ATCC 43541]
 gi|292647650|gb|EFF65622.1| YqgF family crossover junction endodeoxyribonuclease [Selenomonas
           noxia ATCC 43541]
          Length = 137

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 76/136 (55%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           S+D+G   IG+A+SD     A     + R+ ++     L   I      A + GLP +MN
Sbjct: 2   SLDIGDATIGVAVSDLLGLTAQGVETIRRRDLSDDLNRLGVLIQEYEADALVAGLPKHMN 61

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EG R    RAF+ +  +R   +   +WDERL+TV+A + L++ +VSRKKR + +D +A
Sbjct: 62  GQEGERCALVRAFMADAAERFPMMEIHYWDERLSTVAASRTLLEGDVSRKKRRKVIDKMA 121

Query: 141 AALILQEVLDRISFLE 156
           A  ILQ  LDR   L+
Sbjct: 122 AVYILQGFLDRQQHLK 137


>gi|258511991|ref|YP_003185425.1| Holliday junction resolvase YqgF [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257478717|gb|ACV59036.1| Holliday junction resolvase YqgF [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 144

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 73/129 (56%), Gaps = 1/129 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID G +RIG+A+SDP    A P   + R+   Q A E+      E +   ++G PL+M+
Sbjct: 2   AIDFGERRIGVALSDPMGLIAQPYGVIERQSDRQAADEVADLARREEVGRIVVGRPLHMS 61

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G           F   M+  +  +P   +DERLTTVSA++ILI+ NV R++R   VD+ A
Sbjct: 62  GQPSEMTSRAEKFAR-MLAARTGLPVDLYDERLTTVSAERILIEQNVRRRERRATVDAAA 120

Query: 141 AALILQEVL 149
           A ++L++ L
Sbjct: 121 AQVLLEDYL 129


>gi|288574978|ref|ZP_06393335.1| Holliday junction resolvase YqgF [Dethiosulfovibrio peptidovorans
           DSM 11002]
 gi|288570719|gb|EFC92276.1| Holliday junction resolvase YqgF [Dethiosulfovibrio peptidovorans
           DSM 11002]
          Length = 138

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 76/132 (57%), Gaps = 2/132 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D+GT RIG+A+SDP   FA      V         +L   +T+ +++  ++GLP+ 
Sbjct: 5   IVALDMGTVRIGVAMSDPLGSFAQG--VAVWDAEGDWLSDLRDLVTSRDVSTVVVGLPIR 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
            NG++GP   +  A    + +    +  V WDER T+  A ++LI+ +VSRKKR  +VD 
Sbjct: 63  ENGTKGPSAENVEAKTEAVREAFPDLEIVMWDERYTSTIANRVLIEGDVSRKKRKGQVDK 122

Query: 139 IAAALILQEVLD 150
           +AA +ILQ  LD
Sbjct: 123 VAATVILQGYLD 134


>gi|153815342|ref|ZP_01968010.1| hypothetical protein RUMTOR_01576 [Ruminococcus torques ATCC 27756]
 gi|317501696|ref|ZP_07959887.1| hypothetical protein HMPREF1026_01831 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331088419|ref|ZP_08337334.1| Holliday junction resolvase [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145847404|gb|EDK24322.1| hypothetical protein RUMTOR_01576 [Ruminococcus torques ATCC 27756]
 gi|316896947|gb|EFV19027.1| hypothetical protein HMPREF1026_01831 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330408186|gb|EGG87674.1| Holliday junction resolvase [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 145

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 73/135 (54%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+AISD  R  A     + RK   K+ +T   +   I   ++   ++G 
Sbjct: 3   IMGLDYGSKTVGVAISDALRLTAQAVETIERKEENKLRRTCARIEELIKKYDVEKIVLGF 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MN   G R   +  F   M+ R+  +  + WDERLTTV A++ LI+ NV R+ R + 
Sbjct: 63  PKHMNNDIGERAQQSMEF-GEMLKRRTGLEVILWDERLTTVEAERTLIESNVRRENRKKH 121

Query: 136 VDSIAAALILQEVLD 150
           +D IAA  ILQ  LD
Sbjct: 122 IDQIAAVFILQGYLD 136


>gi|168186829|ref|ZP_02621464.1| conserved hypothetical protein [Clostridium botulinum C str.
           Eklund]
 gi|169295213|gb|EDS77346.1| conserved hypothetical protein [Clostridium botulinum C str.
           Eklund]
          Length = 135

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 74/134 (55%), Gaps = 1/134 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G + IG+A+SDP    A     + RK V +   EL        +   I GLP N
Sbjct: 3   ILGLDVGDRTIGVAVSDPLGFTAQGVTTIHRKNVEEDIDELKKICKEYAVELIISGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ G +      F  +++  K+ +P   WDERLTTV+A + +++ N+SR KR + VD 
Sbjct: 63  MNGTVGEQGEKVIEFC-DILKTKLEIPIKMWDERLTTVAAHKAMLEANLSRAKRKKIVDK 121

Query: 139 IAAALILQEVLDRI 152
           +AA  ILQ  LD I
Sbjct: 122 MAATYILQGYLDSI 135


>gi|319651656|ref|ZP_08005783.1| Holliday junction resolvase [Bacillus sp. 2_A_57_CT2]
 gi|317396723|gb|EFV77434.1| Holliday junction resolvase [Bacillus sp. 2_A_57_CT2]
          Length = 135

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 85/132 (64%), Gaps = 3/132 (2%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTEN-IAAFIIGLPLN 78
            +D+G+K +G+A+SD  G          + ++  +   E +S I  E+ ++  ++GLP N
Sbjct: 2   GLDVGSKTVGVALSDAFGWTAQGLETIKISEEEKEFGFERISEIIKEHEVSKIVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GPR  +++ F  + +++   +P V WDERL+T++A+++L++ +VSRKKR + +D 
Sbjct: 62  MNGTIGPRGEASQ-FYASELEKLFGLPVVLWDERLSTMAAERVLLEADVSRKKRKKVIDK 120

Query: 139 IAAALILQEVLD 150
           +AA +ILQ  L+
Sbjct: 121 MAAVMILQGFLN 132


>gi|52081220|ref|YP_080011.1| Holliday junction resolvase-like protein [Bacillus licheniformis
           ATCC 14580]
 gi|52786601|ref|YP_092430.1| Holliday junction resolvase-like protein [Bacillus licheniformis
           ATCC 14580]
 gi|319644812|ref|ZP_07999045.1| Holliday junction resolvase [Bacillus sp. BT1B_CT2]
 gi|62900959|sp|Q65GS7|RUVX_BACLD RecName: Full=Putative Holliday junction resolvase
 gi|52004431|gb|AAU24373.1| conserved protein YrrK [Bacillus licheniformis ATCC 14580]
 gi|52349103|gb|AAU41737.1| YrrK [Bacillus licheniformis ATCC 14580]
 gi|317392621|gb|EFV73415.1| Holliday junction resolvase [Bacillus sp. BT1B_CT2]
          Length = 139

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 82/137 (59%), Gaps = 3/137 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTEN-IAAFIIGLP 76
           I  +DLG+K +G+A+SD  G          + +      L  L+ +T +  I   ++G P
Sbjct: 3   ILGLDLGSKTLGVALSDEMGWTAQGIETIKIDEAGGDYGLNRLAELTKDYVIDKIVLGFP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  +++ F   +++    VP V WDERL+T++A+++LI  +VSR+KR + +
Sbjct: 63  KNMNGTVGPRGEASQKFAE-VLEETFQVPVVLWDERLSTMAAERMLISADVSRQKRKKVI 121

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA +ILQ  LD ++
Sbjct: 122 DKMAAVMILQGYLDSLN 138


>gi|332365435|gb|EGJ43196.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK355]
          Length = 139

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 84/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + +   +  LE L  +  E  +  F+IGLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEDKGEFGLERLGELVKEYKVDKFVIGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+   + +    +P  + DERLTTV+A+++L++  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGQRVAEL-FGLPVDYQDERLTTVAAERMLVEQADISRSKRRKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|78044200|ref|YP_359400.1| hypothetical protein CHY_0542 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|146325559|sp|Q3AEN4|RUVX_CARHZ RecName: Full=Putative Holliday junction resolvase
 gi|77996315|gb|ABB15214.1| conserved hypothetical protein TIGR00250 [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 138

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 74/132 (56%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +D+G K+IG+A+SD     A     + R  + +   E+   I   ++   +IG P N
Sbjct: 3   VLGLDVGDKKIGVALSDELGLTAQGLTVIYRTSLKKDLEEIKKIIDLHHVTEVVIGYPRN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GPR    + F   +       P VFWDERL+TV A+++LI  ++SR+KR + +D 
Sbjct: 63  MNGTAGPRAELVKRFARELYKFTGIKP-VFWDERLSTVEAEKLLISGDISRRKRKKVIDK 121

Query: 139 IAAALILQEVLD 150
           +AA LIL   L+
Sbjct: 122 LAATLILSGYLN 133


>gi|23099462|ref|NP_692928.1| hypothetical protein OB2007 [Oceanobacillus iheyensis HTE831]
 gi|32130032|sp|Q8EPT1|RUVX_OCEIH RecName: Full=Putative Holliday junction resolvase
 gi|22777691|dbj|BAC13963.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831]
          Length = 137

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 83/135 (61%), Gaps = 3/135 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTEN-IAAFIIGLP 76
           I  +D+G+K IG+A+SD  G      +     +    +A E L  I +E+ I   IIGLP
Sbjct: 3   IIGLDVGSKTIGVAVSDALGWTAQGVKTIRWDENDLSSADEELEKIISEHEIGKAIIGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ G R  +++ +  N I++   +P   WDERLTT++A+++L++ ++SR KR + +
Sbjct: 63  KNMNGTIGERGEASQRYA-NHIEKVFQIPVDLWDERLTTMAAERVLLEADMSRSKRKKVI 121

Query: 137 DSIAAALILQEVLDR 151
           D +AA +ILQ  LD+
Sbjct: 122 DKMAAVMILQGYLDQ 136


>gi|254519280|ref|ZP_05131336.1| conserved hypothetical protein [Clostridium sp. 7_2_43FAA]
 gi|226913029|gb|EEH98230.1| conserved hypothetical protein [Clostridium sp. 7_2_43FAA]
          Length = 138

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 75/139 (53%), Gaps = 7/139 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G+K IG+AISDP    A     + R K  Q   E+       ++   +IGLP N
Sbjct: 3   ILGLDVGSKTIGVAISDPLGWTAQGITTIRRSKKEQDIEEIKKLCKEYSVETIVIGLPKN 62

Query: 79  MNGS---EGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           MNG+    G RV      +  +I     +    WDERLTTV+A + +++ ++SR KR + 
Sbjct: 63  MNGTIGESGERVLE----LSEIIKEATGIKVEMWDERLTTVAAHKAMLEADLSRGKRKKI 118

Query: 136 VDSIAAALILQEVLDRISF 154
           VD IAA  ILQ  LDR+S 
Sbjct: 119 VDKIAATYILQGYLDRLSM 137


>gi|259502866|ref|ZP_05745768.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
 gi|259169233|gb|EEW53728.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
          Length = 147

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 82/134 (61%), Gaps = 3/134 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLPLN 78
            +D+G+K +G+A+SDP    A     + + +      L+ ++  +  E +A F++GLP N
Sbjct: 5   GLDVGSKTVGVAVSDPLGWTAQAVEIIPIDEDAEVFGLDRVAELVHKEQVAGFVLGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQKVD 137
           MN +EGPRV +++ +   + +R   +P  F DERLTTV A ++L+ + ++SR K+ + +D
Sbjct: 65  MNNTEGPRVAASKHYGELLQERFPQLPIDFQDERLTTVEAHRMLVEEADISRAKQKKVID 124

Query: 138 SIAAALILQEVLDR 151
            +AA  ILQ  LDR
Sbjct: 125 EVAATFILQSYLDR 138


>gi|328944731|gb|EGG38892.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK1087]
          Length = 139

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 83/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++     LE L  +  E  +  F+IGLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEEKGGFGLERLGELVKEYKVDKFVIGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+    I     +P  + DERLTTV+A+++L++  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGQR-IAELFGLPVDYQDERLTTVAAERMLVEQADISRSKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|229198513|ref|ZP_04325217.1| Holliday junction resolvase [Bacillus cereus m1293]
 gi|228585016|gb|EEK43130.1| Holliday junction resolvase [Bacillus cereus m1293]
          Length = 137

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 80/134 (59%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+GTK +G+AISD  G          + ++      + +S  +   ++   ++GLP
Sbjct: 3   ILGLDVGTKTVGVAISDEMGWTAQGLETIKINEERGHFGFDRISELVKQYDVDKIVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  + + F  N+ +  + +  V WDERL+T++A+++LI  +VSRKKR Q +
Sbjct: 63  KNMNGTIGPRGEACQQFAENLREL-LQLDVVMWDERLSTMAAERLLISADVSRKKRKQVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKMAAVVILQGFLD 135


>gi|194398342|ref|YP_002036896.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           G54]
 gi|226695305|sp|B5E6E1|RUVX_STRP4 RecName: Full=Putative Holliday junction resolvase
 gi|194358009|gb|ACF56457.1| conserved hypothetical protein [Streptococcus pneumoniae G54]
          Length = 139

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 84/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++  Q   + +   + T  +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGXEIIQINEEQGQFGFDRVKELVDTYKVERFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+   + +    +P  + DERLTTV+A+++LI+  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGAKL-EEFFGLPVDYQDERLTTVAAERMLIEQADISRNKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|225869409|ref|YP_002745357.1| Holliday junction resolvase [Streptococcus equi subsp.
           zooepidemicus]
 gi|259495714|sp|C0MGB3|RUVX_STRS7 RecName: Full=Putative Holliday junction resolvase
 gi|225702685|emb|CAX00789.1| putative Holliday junction resolvase [Streptococcus equi subsp.
           zooepidemicus]
          Length = 139

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 82/138 (59%), Gaps = 10/138 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFII 73
           I  +D+G+K +G+AISDP    A     +   K+ +   +     L   +    +  F+I
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEII---KINEDKQDFGFDRLAELVKQYQVDRFVI 59

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
           GLP NMN + GPRV +++A+  + I+   ++P  + DERLTTV A+++LI+  ++SR KR
Sbjct: 60  GLPKNMNNTSGPRVEASKAY-GDRIEELFHIPVSYQDERLTTVEAERMLIEQADISRGKR 118

Query: 133 IQKVDSIAAALILQEVLD 150
            + +D +AA LILQ  LD
Sbjct: 119 KKVIDKLAAQLILQNYLD 136


>gi|254456227|ref|ZP_05069656.1| conserved hypothetical protein TIGR00250 [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207083229|gb|EDZ60655.1| conserved hypothetical protein TIGR00250 [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 151

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 77/148 (52%), Gaps = 1/148 (0%)

Query: 3   ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSF 62
           ++ IEDL K       +  +DLG+KRIG++I D  +  A P   + +    +   EL   
Sbjct: 1   MITIEDLKKKQSETSRLIGLDLGSKRIGVSICDEKQSIATPFKTINKTNTNELINELKKI 60

Query: 63  ITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL 122
           I   +I   ++G P+NM+G+ G    S      N ID+ + +    WDERL+TV A  + 
Sbjct: 61  IEEYDIKGIVVGNPINMDGTLGRSSQSVNDVSDN-IDKAIDIDVCLWDERLSTVGAFNLS 119

Query: 123 IDMNVSRKKRIQKVDSIAAALILQEVLD 150
             ++V+  KR + +D  AAA ILQ  +D
Sbjct: 120 SQLDVNVSKREKNIDQNAAAFILQGAID 147


>gi|295109588|emb|CBL23541.1| conserved hypothetical protein TIGR00250 [Ruminococcus obeum
           A2-162]
          Length = 140

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 72/138 (52%), Gaps = 4/138 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+A+SDP    A     + RK   K+ QT   +   I    +   ++G 
Sbjct: 3   ILGLDYGSKTVGVAVSDPLGLTAQKVETIWRKQENKLRQTLARIEELIAEYEVEKIVLGF 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R      F   M+ ++  +  + WDERLTTV A + LI+  V R+ R Q 
Sbjct: 63  PKNMNNTVGERAEKALEF-GEMLKKRTGLEVIMWDERLTTVEADRTLIEAGVRRENRKQY 121

Query: 136 VDSIAAALILQEVLDRIS 153
           +D IAA  ILQ  LD +S
Sbjct: 122 LDGIAAVFILQGYLDSLS 139


>gi|225871407|ref|YP_002747354.1| Holliday junction resolvase [Streptococcus equi subsp. equi 4047]
 gi|254767526|sp|C0MAR3|RUVX_STRE4 RecName: Full=Putative Holliday junction resolvase
 gi|225700811|emb|CAW95508.1| putative Holliday junction resolvase [Streptococcus equi subsp.
           equi 4047]
          Length = 139

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 81/136 (59%), Gaps = 6/136 (4%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL---ELLSFITTENIAAFIIGL 75
           I  +D+G+K +G+AISDP   F      ++R    +       L   +    +  F+IGL
Sbjct: 3   IMGLDVGSKTVGVAISDP-LGFTAQGLEIIRINEDKQDFGFDRLAELVKQYQVDRFVIGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQ 134
           P NMN + GPRV +++A+  + I+   ++P  + DERLTTV A+++LI+  ++SR KR +
Sbjct: 62  PKNMNNTSGPRVEASKAY-GDKIEELFHIPVSYQDERLTTVEAERMLIEQADISRGKRKK 120

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA LILQ  LD
Sbjct: 121 VIDKLAAQLILQNYLD 136


>gi|289168746|ref|YP_003447015.1| holiday junction resolvase [Streptococcus mitis B6]
 gi|288908313|emb|CBJ23155.1| holiday junction resolvase [Streptococcus mitis B6]
          Length = 139

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 84/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++  Q   + +   + T  +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRVKELVDTYKVERFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+   + +    +P  + DERLTTV+A+++LI+  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGAKL-EELFSLPVDYQDERLTTVAAERMLIEQADISRNKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|269792642|ref|YP_003317546.1| Holliday junction resolvase YqgF [Thermanaerovibrio acidaminovorans
           DSM 6589]
 gi|269100277|gb|ACZ19264.1| Holliday junction resolvase YqgF [Thermanaerovibrio acidaminovorans
           DSM 6589]
          Length = 142

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 75/132 (56%), Gaps = 2/132 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + ++DLG  RIG+A+SDP R FA P   L  K      L++   +   ++   ++GLP+ 
Sbjct: 8   VMALDLGEVRIGVALSDPSRSFASPLEVL--KMEEGWPLKVKELVERNSVTLIVVGLPIR 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
            +GS GP V     ++  +      V  V  DER TT  AQ+ L++ +V R+KR  KVD 
Sbjct: 66  TDGSSGPEVQRVMGWLEELKAVVQQVEIVTVDERFTTSIAQRFLLEGDVRREKRKGKVDK 125

Query: 139 IAAALILQEVLD 150
           +AAAL+LQ+ L+
Sbjct: 126 VAAALMLQDYLN 137


>gi|322388593|ref|ZP_08062193.1| crossover junction endodeoxyribonuclease [Streptococcus infantis
           ATCC 700779]
 gi|321140513|gb|EFX36018.1| crossover junction endodeoxyribonuclease [Streptococcus infantis
           ATCC 700779]
          Length = 136

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 82/134 (61%), Gaps = 4/134 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLPLN 78
            +D+G+K +G+AISDP    A     + + +   +   E L   + T  +  F++GLP N
Sbjct: 2   GLDVGSKTVGVAISDPLGFTAQGLEIIQINEDQGEFGFERLKELVDTYKVERFVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKVD 137
           MN + GPRV +++A+   + +    +P  + DERLTTV+A+++LI+  ++SR KR + +D
Sbjct: 62  MNNTSGPRVEASQAYGAKL-EELFGLPVEYQDERLTTVAAERMLIEQADISRNKRKKVID 120

Query: 138 SIAAALILQEVLDR 151
            +AA LILQ  LDR
Sbjct: 121 KLAAQLILQNYLDR 134


>gi|225375409|ref|ZP_03752630.1| hypothetical protein ROSEINA2194_01034 [Roseburia inulinivorans DSM
           16841]
 gi|225212745|gb|EEG95099.1| hypothetical protein ROSEINA2194_01034 [Roseburia inulinivorans DSM
           16841]
          Length = 145

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 77/139 (55%), Gaps = 4/139 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+A+SD     A     + R+   K+ Q+   +   I   N+   ++G 
Sbjct: 3   ILGLDYGSKTVGVAVSDELLFTAQGLEIVRRQSPNKLRQSLARIEEIIKEYNVERIVLGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN +EG R   T+ F   M++R+  +  + WDERLTTVSA + +++  + R+ R + 
Sbjct: 63  PKNMNNTEGERCEKTKEF-KEMLERRTGLNVILWDERLTTVSADKHMMESGIRREDRKKF 121

Query: 136 VDSIAAALILQEVLDRISF 154
           VD IAA  ILQ  LD ++ 
Sbjct: 122 VDEIAAVFILQGYLDYLAM 140


>gi|160880429|ref|YP_001559397.1| Holliday junction resolvase YqgF [Clostridium phytofermentans ISDg]
 gi|189046094|sp|A9KKS6|RUVX_CLOPH RecName: Full=Putative Holliday junction resolvase
 gi|160429095|gb|ABX42658.1| Holliday junction resolvase YqgF [Clostridium phytofermentans ISDg]
          Length = 150

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 75/138 (54%), Gaps = 4/138 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+  +G+AISD  +  A     + RK   K+ QT   +   I    +   ++G 
Sbjct: 3   IMGLDYGSVTVGVAISDSLKLTAQGIEVIRRKSETKLRQTLARIEELIKEYEVEEIVLGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R   +  F  ++  R+  +P V WDERLTTV+A Q+L    VS KK+++ 
Sbjct: 63  PKNMNNTIGERAEKSEEFAEHL-RRRTGLPVVLWDERLTTVAAHQVLNAGEVSLKKKMEV 121

Query: 136 VDSIAAALILQEVLDRIS 153
           VD +AA  ILQ  LD +S
Sbjct: 122 VDKLAAVFILQGYLDYLS 139


>gi|116333831|ref|YP_795358.1| Holliday junction resolvase-like protein [Lactobacillus brevis ATCC
           367]
 gi|122269482|sp|Q03R45|RUVX_LACBA RecName: Full=Putative Holliday junction resolvase
 gi|116099178|gb|ABJ64327.1| RNase H-like ribonuclease [Lactobacillus brevis ATCC 367]
          Length = 145

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 84/144 (58%), Gaps = 4/144 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           +  +D+G++ +G+A+SD  G          + +   Q  L+ +   I + ++  F++GLP
Sbjct: 3   LMGLDVGSRTVGVAVSDALGWTAQGVEIIRINEDEEQFGLDRVGELIASHDVQGFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN S GPR  +++ +  +M+  +  +P  F DERLTTV A+++L++  + SR+KR Q 
Sbjct: 63  KNMNNSLGPRAEASKRY-GDMLTARFNLPVDFEDERLTTVEAERMLVEQADTSRRKRKQV 121

Query: 136 VDSIAAALILQEVLDRISFLESSK 159
           +D +AA LILQ  LDR   L   K
Sbjct: 122 IDKLAAGLILQNYLDRHGKLTREK 145


>gi|184154999|ref|YP_001843339.1| endonuclease [Lactobacillus fermentum IFO 3956]
 gi|226731625|sp|B2GB27|RUVX_LACF3 RecName: Full=Putative Holliday junction resolvase
 gi|183226343|dbj|BAG26859.1| endonuclease [Lactobacillus fermentum IFO 3956]
          Length = 145

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 83/133 (62%), Gaps = 4/133 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLPLN 78
            +D+G+K +G+A SDP    A     + + ++     LE ++  + +  +A F++GLP N
Sbjct: 5   GLDVGSKTVGVAESDPLGWTAQAVEIIPIDEEAEVFGLERVAELVKSRQVAGFVLGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQKVD 137
           MN +EGPRV + R +   +++ +  +P  + DERLTTV A ++L+ + +VSR+K+ + +D
Sbjct: 65  MNNTEGPRVEAARHY-GELLEERFGLPIDYQDERLTTVQAHRMLVEEADVSRRKQKKVID 123

Query: 138 SIAAALILQEVLD 150
            +AA LILQ  LD
Sbjct: 124 ELAATLILQNYLD 136


>gi|34580618|ref|ZP_00142098.1| hypothetical protein [Rickettsia sibirica 246]
 gi|238651062|ref|YP_002916919.1| Holliday junction resolvase-like protein [Rickettsia peacockii str.
           Rustic]
 gi|259495713|sp|C4K2S0|RUVX_RICPU RecName: Full=Putative Holliday junction resolvase
 gi|28262003|gb|EAA25507.1| unknown [Rickettsia sibirica 246]
 gi|238625160|gb|ACR47866.1| Holliday junction resolvase-like protein [Rickettsia peacockii str.
           Rustic]
          Length = 154

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 85/149 (57%), Gaps = 5/149 (3%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFL--VRKKVTQTALELLSFI 63
           +++  + L PN P+ +ID G+K++G+A+S+  R  A P   +  + KK+  T+L  L+ I
Sbjct: 6   LQEFYRLLIPNAPLIAIDYGSKKLGIALSNQERSIAMPLNTITEINKKIVITSL--LNII 63

Query: 64  TTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI 123
               +   IIGLP++M+G+   + +    F   +  + + +P    DERLTT +A  +L 
Sbjct: 64  EKYKVCGVIIGLPIDMSGAVTEQTNIVMKFAEELA-KSINLPIYLQDERLTTKAANNLLK 122

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLDRI 152
              V RK R    D++AA++IL+ VLD I
Sbjct: 123 SFGVKRKDRNNNDDAVAASMILETVLDSI 151


>gi|157964411|ref|YP_001499235.1| Holliday junction resolvase-like protein [Rickettsia massiliae
           MTU5]
 gi|157844187|gb|ABV84688.1| Putative endonuclease involved in recombination [Rickettsia
           massiliae MTU5]
          Length = 165

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 84/155 (54%), Gaps = 4/155 (2%)

Query: 1   MSILLIEDL---VKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL 57
           ++I++I++L    + L PN P+ +ID G+K++G+A+S+  R  A P   +          
Sbjct: 9   ITIMIIKNLQEFYRLLIPNAPLIAIDYGSKKLGIALSNQERSIAMPLNTITEINTKIVIT 68

Query: 58  ELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVS 117
            LL+ I    +   IIGLP+NM+G+   + +    F   +  + + +P    DERLTT +
Sbjct: 69  SLLNIIEKYKVCGVIIGLPINMSGAVTEQTNIVMQFAEEL-AKSINLPIYLQDERLTTKA 127

Query: 118 AQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRI 152
           A   L    V RK R    D++AA++IL+ VLD I
Sbjct: 128 ANNFLKSFGVKRKDRNNNDDAVAASMILETVLDSI 162


>gi|307708049|ref|ZP_07644517.1| conserved hypothetical protein [Streptococcus mitis NCTC 12261]
 gi|322377241|ref|ZP_08051733.1| putative Holliday junction resolvase [Streptococcus sp. M334]
 gi|307615834|gb|EFN95039.1| conserved hypothetical protein [Streptococcus mitis NCTC 12261]
 gi|321281954|gb|EFX58962.1| putative Holliday junction resolvase [Streptococcus sp. M334]
          Length = 139

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 84/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++  Q   + +   + T  +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRVKELVDTYKVERFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+   + +    +P  + DERLTTV+A+++LI+  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGAKL-EELFGLPVDYQDERLTTVAAERMLIEQADISRNKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|307265209|ref|ZP_07546768.1| Holliday junction resolvase YqgF [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306919831|gb|EFN50046.1| Holliday junction resolvase YqgF [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 139

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 73/133 (54%), Gaps = 2/133 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+AISD     A     + R    +    +   I    +   I+GLP N
Sbjct: 3   IMGLDVGDKTIGVAISDLSGTIAQGLTTIKRSSNKKDFERIKQIINEYEVGMIIVGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKVD 137
           M+G+ GP+      FV ++      +P + WDERLTTV AQ++LI+  ++SR KR + +D
Sbjct: 63  MSGTLGPQGQKVVRFVEHL-KEAFSIPIILWDERLTTVEAQRVLIEKADISRAKRKEVID 121

Query: 138 SIAAALILQEVLD 150
            +AA LILQ  LD
Sbjct: 122 KLAAVLILQNYLD 134


>gi|301300898|ref|ZP_07207070.1| RNAse YqgF [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|300851497|gb|EFK79209.1| RNAse YqgF [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 147

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 83/135 (61%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTEN-IAAFIIGLP 76
           +  +D+G++ +G+A+SD  G          + +   +  L+ ++ +  EN +  F++GLP
Sbjct: 4   LMGLDVGSRTVGVAVSDMLGWTAQGVEIVQINEDEQEFGLDRIAELVKENEVVGFVLGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV + +A+   ++  K  +P  F DERLTTV A+++L++  + SRKKR + 
Sbjct: 64  KNMNNTSGPRVEAAKAY-GELLKEKFNLPIDFIDERLTTVEAERMLVEQADASRKKRKKV 122

Query: 136 VDSIAAALILQEVLD 150
           +D +AA+LILQ  LD
Sbjct: 123 IDKLAASLILQNYLD 137


>gi|154482585|ref|ZP_02025033.1| hypothetical protein EUBVEN_00252 [Eubacterium ventriosum ATCC
           27560]
 gi|149736610|gb|EDM52496.1| hypothetical protein EUBVEN_00252 [Eubacterium ventriosum ATCC
           27560]
          Length = 142

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVR---KKVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+A++DP    A     + R    K+ +T   +   +   NI   ++G 
Sbjct: 3   ILGLDFGSKTVGVAVTDPLGYTAQGVEIIRRDSPNKLRKTLARIEQLVEQYNIEKIVLGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P+ ++G+EG RV  T+ F   M++R+  +  VF DERLTTV A +I+ +  + ++ R + 
Sbjct: 63  PVMLSGTEGERVKKTKEF-GAMLERRTGLEIVFQDERLTTVEAYEIMDEAGIKKQDRYKY 121

Query: 136 VDSIAAALILQEVLDRIS 153
           VD IAA +IL++ ++RI 
Sbjct: 122 VDQIAATIILEDYINRIE 139


>gi|196233674|ref|ZP_03132515.1| Holliday junction resolvase YqgF [Chthoniobacter flavus Ellin428]
 gi|196222344|gb|EDY16873.1| Holliday junction resolvase YqgF [Chthoniobacter flavus Ellin428]
          Length = 140

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 71/135 (52%), Gaps = 1/135 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            ID G  RIG+A+SD     AHP   +  K+V      + + +T++++   I+GLP NM+
Sbjct: 6   GIDHGDARIGVAVSDDLGMLAHPLETIHVKEVADPVARIATLVTSKDVGHIILGLPRNMD 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GS GP     RAF   +           WDERLT+V+AQ+ L +     K   + +D +A
Sbjct: 66  GSYGPAAEKVRAFAEKL-RAACGCEVKLWDERLTSVAAQRSLHEAGRKVKDSREVIDQVA 124

Query: 141 AALILQEVLDRISFL 155
           A LILQ  LD  + L
Sbjct: 125 AQLILQGWLDSQALL 139


>gi|15902220|ref|NP_357770.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           R6]
 gi|116515819|ref|YP_815700.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           D39]
 gi|148983593|ref|ZP_01816912.1| hypothetical protein CGSSp3BS71_05664 [Streptococcus pneumoniae
           SP3-BS71]
 gi|148987930|ref|ZP_01819393.1| hypothetical protein CGSSp6BS73_10471 [Streptococcus pneumoniae
           SP6-BS73]
 gi|148992772|ref|ZP_01822415.1| hypothetical protein CGSSp9BS68_03488 [Streptococcus pneumoniae
           SP9-BS68]
 gi|148996617|ref|ZP_01824335.1| hypothetical protein CGSSp11BS70_07975 [Streptococcus pneumoniae
           SP11-BS70]
 gi|149001702|ref|ZP_01826675.1| anaerobic ribonucleoside triphosphate reductase [Streptococcus
           pneumoniae SP14-BS69]
 gi|149005945|ref|ZP_01829674.1| hypothetical protein CGSSp18BS74_07200 [Streptococcus pneumoniae
           SP18-BS74]
 gi|149011064|ref|ZP_01832369.1| hypothetical protein CGSSp19BS75_11428 [Streptococcus pneumoniae
           SP19-BS75]
 gi|168483832|ref|ZP_02708784.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1873-00]
 gi|168490343|ref|ZP_02714542.1| conserved hypothetical protein [Streptococcus pneumoniae SP195]
 gi|168492149|ref|ZP_02716292.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC0288-04]
 gi|168576377|ref|ZP_02722260.1| conserved hypothetical protein [Streptococcus pneumoniae MLV-016]
 gi|169834458|ref|YP_001693728.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           Hungary19A-6]
 gi|182683176|ref|YP_001834923.1| hypothetical protein SPCG_0206 [Streptococcus pneumoniae CGSP14]
 gi|225853803|ref|YP_002735315.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           JJA]
 gi|225855961|ref|YP_002737472.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           P1031]
 gi|225858051|ref|YP_002739561.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           70585]
 gi|225860238|ref|YP_002741747.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|237649736|ref|ZP_04523988.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           CCRI 1974]
 gi|237821434|ref|ZP_04597279.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           CCRI 1974M2]
 gi|298255974|ref|ZP_06979560.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           str. Canada MDR_19A]
 gi|303255107|ref|ZP_07341183.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           BS455]
 gi|303259248|ref|ZP_07345226.1| hypothetical protein CGSSp9vBS293_02607 [Streptococcus pneumoniae
           SP-BS293]
 gi|303263331|ref|ZP_07349254.1| hypothetical protein CGSSpBS397_03156 [Streptococcus pneumoniae
           BS397]
 gi|307066873|ref|YP_003875839.1| putative endonuclease [Streptococcus pneumoniae AP200]
 gi|32130028|sp|Q8DRE2|RUVX_STRR6 RecName: Full=Putative Holliday junction resolvase
 gi|122279414|sp|Q04MP8|RUVX_STRP2 RecName: Full=Putative Holliday junction resolvase
 gi|226695306|sp|B1I8I5|RUVX_STRPI RecName: Full=Putative Holliday junction resolvase
 gi|226695307|sp|B2IS28|RUVX_STRPS RecName: Full=Putative Holliday junction resolvase
 gi|254767527|sp|C1CAK0|RUVX_STRP7 RecName: Full=Putative Holliday junction resolvase
 gi|254767529|sp|C1CBZ4|RUVX_STRZJ RecName: Full=Putative Holliday junction resolvase
 gi|254767530|sp|C1CI84|RUVX_STRZP RecName: Full=Putative Holliday junction resolvase
 gi|254767531|sp|C1CP75|RUVX_STRZT RecName: Full=Putative Holliday junction resolvase
 gi|15457719|gb|AAK98980.1| Conserved hypothetical protein [Streptococcus pneumoniae R6]
 gi|116076395|gb|ABJ54115.1| conserved hypothetical protein TIGR00250 [Streptococcus pneumoniae
           D39]
 gi|147757192|gb|EDK64231.1| hypothetical protein CGSSp11BS70_07975 [Streptococcus pneumoniae
           SP11-BS70]
 gi|147760160|gb|EDK67149.1| anaerobic ribonucleoside triphosphate reductase [Streptococcus
           pneumoniae SP14-BS69]
 gi|147762301|gb|EDK69262.1| hypothetical protein CGSSp18BS74_07200 [Streptococcus pneumoniae
           SP18-BS74]
 gi|147764700|gb|EDK71630.1| hypothetical protein CGSSp19BS75_11428 [Streptococcus pneumoniae
           SP19-BS75]
 gi|147923740|gb|EDK74852.1| hypothetical protein CGSSp3BS71_05664 [Streptococcus pneumoniae
           SP3-BS71]
 gi|147926394|gb|EDK77467.1| hypothetical protein CGSSp6BS73_10471 [Streptococcus pneumoniae
           SP6-BS73]
 gi|147928498|gb|EDK79513.1| hypothetical protein CGSSp9BS68_03488 [Streptococcus pneumoniae
           SP9-BS68]
 gi|168996960|gb|ACA37572.1| conserved hypothetical protein [Streptococcus pneumoniae
           Hungary19A-6]
 gi|172042909|gb|EDT50955.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1873-00]
 gi|182628510|gb|ACB89458.1| hypothetical protein SPCG_0206 [Streptococcus pneumoniae CGSP14]
 gi|183571311|gb|EDT91839.1| conserved hypothetical protein [Streptococcus pneumoniae SP195]
 gi|183573647|gb|EDT94175.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC0288-04]
 gi|183577826|gb|EDT98354.1| conserved hypothetical protein [Streptococcus pneumoniae MLV-016]
 gi|225721840|gb|ACO17694.1| conserved hypothetical protein [Streptococcus pneumoniae 70585]
 gi|225722223|gb|ACO18076.1| conserved hypothetical protein [Streptococcus pneumoniae JJA]
 gi|225725306|gb|ACO21158.1| conserved hypothetical protein [Streptococcus pneumoniae P1031]
 gi|225727488|gb|ACO23339.1| conserved hypothetical protein [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|302597937|gb|EFL65007.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           BS455]
 gi|302639666|gb|EFL70123.1| hypothetical protein CGSSpBS293_02607 [Streptococcus pneumoniae
           SP-BS293]
 gi|302647104|gb|EFL77328.1| hypothetical protein CGSSpBS397_03156 [Streptococcus pneumoniae
           BS397]
 gi|306408410|gb|ADM83837.1| predicted endonuclease [Streptococcus pneumoniae AP200]
          Length = 139

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 84/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++  Q   + +   + T  +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRVKELVDTYKVERFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+   + +    +P  + DERLTTV+A+++LI+  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGAKL-EEFFGLPVDYQDERLTTVAAERMLIEQADISRNKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|227891105|ref|ZP_04008910.1| crossover junction endodeoxyribonuclease [Lactobacillus salivarius
           ATCC 11741]
 gi|227866979|gb|EEJ74400.1| crossover junction endodeoxyribonuclease [Lactobacillus salivarius
           ATCC 11741]
          Length = 147

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 83/135 (61%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTEN-IAAFIIGLP 76
           +  +D+G++ +G+A+SD  G          + +   +  L+ ++ +  EN +  F++GLP
Sbjct: 4   LMGLDVGSRTVGVAVSDMLGWTAQGVEIVQINEDEQEFGLDRIAELVKENEVVGFVLGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV + +A+   ++  K  +P  F DERLTTV A+++L++  + SRKKR + 
Sbjct: 64  KNMNNTSGPRVEAAKAY-GELLKEKFNLPIDFIDERLTTVEAERMLVEQADASRKKRKKV 122

Query: 136 VDSIAAALILQEVLD 150
           +D +AA+LILQ  LD
Sbjct: 123 IDKLAASLILQNYLD 137


>gi|169824325|ref|YP_001691936.1| putative endonuclease involved in recombination [Finegoldia magna
           ATCC 29328]
 gi|297588302|ref|ZP_06946945.1| crossover junction endodeoxyribonuclease [Finegoldia magna ATCC
           53516]
 gi|167831130|dbj|BAG08046.1| putative endonuclease involved in recombination [Finegoldia magna
           ATCC 29328]
 gi|297573675|gb|EFH92396.1| crossover junction endodeoxyribonuclease [Finegoldia magna ATCC
           53516]
          Length = 137

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 74/130 (56%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+G + IG+AISDP    A     + RK   +    +   I  + ++  I+GLP NMN
Sbjct: 6   GLDVGDRTIGVAISDPFLLTAQSLMTIKRKSKIEDIEIINDIIKEKEVSKIIVGLPKNMN 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
            + GP+    + FV  +  +   +   + DERLTTVSA ++LI+ NVSRKKR   +DS+A
Sbjct: 66  NTIGPQAKKVKTFVKEL-RKHTDLDIEYVDERLTTVSATRVLIEQNVSRKKRKDVIDSVA 124

Query: 141 AALILQEVLD 150
           A  ILQ  LD
Sbjct: 125 ATYILQTYLD 134


>gi|188586393|ref|YP_001917938.1| Holliday junction resolvase YqgF [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|226731632|sp|B2A5J5|RUVX_NATTJ RecName: Full=Putative Holliday junction resolvase
 gi|179351080|gb|ACB85350.1| Holliday junction resolvase YqgF [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 141

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 76/133 (57%), Gaps = 1/133 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I   DLG   IG+A+SD  +  A  +  + R+ + +   ++   I    ++  I+GLP N
Sbjct: 3   IMGFDLGEATIGVAVSDALQLTAQGKTVIKRQSLEKDIEQVTKLIEDYQVSKLIVGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNGS G        F+ ++ +++V +P    DERLT+  A+Q L++ +VSRKKR Q +D 
Sbjct: 63  MNGSLGQMADQIMDFIKSL-EQEVDIPIETVDERLTSRMAEQTLLEADVSRKKRKQVIDK 121

Query: 139 IAAALILQEVLDR 151
           +AA  ILQ  LDR
Sbjct: 122 LAAVNILQTYLDR 134


>gi|166031235|ref|ZP_02234064.1| hypothetical protein DORFOR_00922 [Dorea formicigenerans ATCC
           27755]
 gi|166029082|gb|EDR47839.1| hypothetical protein DORFOR_00922 [Dorea formicigenerans ATCC
           27755]
          Length = 144

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 73/135 (54%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G++ +G+A+SDP    A     + RK   K+ +T   +   +    +   ++GL
Sbjct: 3   IMGLDYGSRTVGVAVSDPLGITAQAVETICRKDENKLRKTCARIEELVAEYEVEKIVLGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MN   G R   +  F   MI R+  +  V WDERLTTVSA++ LI+  V R+ R + 
Sbjct: 63  PKHMNNDIGDRAEKSMQF-GEMIGRRTGLEVVMWDERLTTVSAERTLIENKVRREDRKKY 121

Query: 136 VDSIAAALILQEVLD 150
           +D IAA  ILQ  LD
Sbjct: 122 IDQIAAVFILQGYLD 136


>gi|20807699|ref|NP_622870.1| endonuclease [Thermoanaerobacter tengcongensis MB4]
 gi|32130041|sp|Q8R5S9|RUVX_THETN RecName: Full=Putative Holliday junction resolvase
 gi|20516249|gb|AAM24474.1| predicted endonuclease involved in recombination
           [Thermoanaerobacter tengcongensis MB4]
          Length = 139

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 77/134 (57%), Gaps = 4/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +D+G K IG+AISD     A     + RK   +    +   +   ++   ++GLP N
Sbjct: 3   VLGLDVGDKTIGVAISDVSSTIAQGITTIRRKSFVEDVKAIEEIVKKYSVEKVVVGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVY-VPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           MNGS GP+      F   +  R+V  +P VFWDERLTT+ A++ LI+ +++SR KR + +
Sbjct: 63  MNGSIGPQGEKVIKFGEKL--REVLRIPVVFWDERLTTLQAERFLIEGVDMSRGKRKKVI 120

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 121 DKLAATIILQSYLD 134


>gi|167757700|ref|ZP_02429827.1| hypothetical protein CLOSCI_00030 [Clostridium scindens ATCC 35704]
 gi|167664582|gb|EDS08712.1| hypothetical protein CLOSCI_00030 [Clostridium scindens ATCC 35704]
          Length = 141

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 74/138 (53%), Gaps = 4/138 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+AISDP    A     + RK   K+ +T   + + I    +   ++GL
Sbjct: 3   IMGLDYGSKTVGVAISDPLGITAQAIETICRKDENKLRKTCARIETLIEEYKVERIVLGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MN   G R   +  F   M+ R+  +  V WDERLTTV A++ LI+  V R+ R + 
Sbjct: 63  PKHMNNDIGDRAERSLEF-GKMLSRRTGLEVVMWDERLTTVEAERTLIENKVRREDRKKY 121

Query: 136 VDSIAAALILQEVLDRIS 153
           +D IAA  ILQ  LD I 
Sbjct: 122 IDKIAAVFILQGYLDSIC 139


>gi|291519256|emb|CBK74477.1| conserved hypothetical protein TIGR00250 [Butyrivibrio fibrisolvens
           16/4]
          Length = 142

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVT---QTALELLSFITTENIAAFIIGL 75
           I  +D GTK +G+AISDP    A     + R++ +    T + +        +   I+G 
Sbjct: 4   ILGLDYGTKTVGVAISDPLLLTAQEFETITRERASALRHTLVRIKEICEEYQVEKIILGY 63

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NM+ SEG R   T  F   +++++V +P    DERLTTV A +IL +  V++K R + 
Sbjct: 64  PRNMDDSEGFRCEDTLEF-KKLLEKRVDIPIELVDERLTTVYADEILEESGVAKKDRKKV 122

Query: 136 VDSIAAALILQEVLD 150
           +D IAAA+ILQ+ LD
Sbjct: 123 IDQIAAAIILQDYLD 137


>gi|189485524|ref|YP_001956465.1| putative Holliday junction resolvase RuvX [uncultured Termite group
           1 bacterium phylotype Rs-D17]
 gi|226695313|sp|B1H0H2|RUVX_UNCTG RecName: Full=Putative Holliday junction resolvase
 gi|170287483|dbj|BAG14004.1| putative Holliday junction resolvase RuvX [uncultured Termite group
           1 bacterium phylotype Rs-D17]
          Length = 140

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 53/133 (39%), Positives = 77/133 (57%), Gaps = 2/133 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  ID G KRIG+AI+D  R  A P   +    + + AL++L      +++  ++GLPLN
Sbjct: 4   IMGIDYGLKRIGIAITDFLRITASPFDTVKNVSLKKNALKILEIAKNRDVSIIVLGLPLN 63

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQKVD 137
           MNG+EG    + R F+   I     +     DERLTTV A+++LI + ++SR+KR    D
Sbjct: 64  MNGTEGGMAETVRKFIEK-IKFLSDIEVTTVDERLTTVQAERMLIEEADISREKRKGIKD 122

Query: 138 SIAAALILQEVLD 150
            + AALILQ  LD
Sbjct: 123 KVVAALILQTYLD 135


>gi|322392530|ref|ZP_08065990.1| crossover junction endodeoxyribonuclease [Streptococcus peroris
           ATCC 700780]
 gi|321144522|gb|EFX39923.1| crossover junction endodeoxyribonuclease [Streptococcus peroris
           ATCC 700780]
          Length = 136

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 82/134 (61%), Gaps = 4/134 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLPLN 78
            +D+G+K +G+AISDP    A     + + +   Q   + L   + +  +  F++GLP N
Sbjct: 2   GLDVGSKTVGVAISDPLGFTAQGLEIIQINEDQGQFGFDRLKELVESYKVEHFVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKVD 137
           MN + GPRV +++A+   + +    +P  + DERLTTV+A+++LI+  +VSR KR + +D
Sbjct: 62  MNNTSGPRVEASQAYGAKL-EELFGLPVEYQDERLTTVAAERMLIEQADVSRNKRKKVID 120

Query: 138 SIAAALILQEVLDR 151
            +AA LILQ  LDR
Sbjct: 121 KLAAQLILQNYLDR 134


>gi|260663394|ref|ZP_05864285.1| conserved hypothetical protein [Lactobacillus fermentum 28-3-CHN]
 gi|260552246|gb|EEX25298.1| conserved hypothetical protein [Lactobacillus fermentum 28-3-CHN]
          Length = 145

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 83/134 (61%), Gaps = 4/134 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLPLN 78
            +D+G+K +G+A SDP    A     + + ++     LE ++  + +  +A  ++GLP N
Sbjct: 5   GLDVGSKTVGVAESDPLGWTAQAVEIIPIDEEAEVFGLERVAELVKSRQVAGIVLGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQKVD 137
           MN +EGPRV + R +   +++ +  +P  + DERLTTV A ++L+ + +VSR+K+ + +D
Sbjct: 65  MNNTEGPRVEAARHY-GELLEERFGLPIDYQDERLTTVQAHRMLVEEADVSRRKQKKVID 123

Query: 138 SIAAALILQEVLDR 151
            +AA LILQ  LDR
Sbjct: 124 ELAATLILQNYLDR 137


>gi|301793470|emb|CBW35843.1| putative Holliday junction resolvase [Streptococcus pneumoniae
           INV104]
          Length = 136

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 83/134 (61%), Gaps = 4/134 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLPLN 78
            +D+G+K +G+AISDP    A     + + ++  Q   + +   + T  +  F++GLP N
Sbjct: 2   GLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRVKELVDTYKVERFVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKVD 137
           MN + GPRV +++A+   + +    +P  + DERLTTV+A+++LI+  ++SR KR + +D
Sbjct: 62  MNNTSGPRVEASQAYGAKL-EEFFGLPLDYQDERLTTVAAERMLIEQADISRNKRKKVID 120

Query: 138 SIAAALILQEVLDR 151
            +AA LILQ  LDR
Sbjct: 121 KLAAQLILQNYLDR 134


>gi|299535708|ref|ZP_07049029.1| putative Holliday junction resolvase [Lysinibacillus fusiformis
           ZC1]
 gi|298728908|gb|EFI69462.1| putative Holliday junction resolvase [Lysinibacillus fusiformis
           ZC1]
          Length = 138

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 80/134 (59%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+A+SD  G          + +   +  ++ ++ +  E  I  F++G P
Sbjct: 3   IMGLDVGSKTVGVAVSDALGWTAQGIETVKIDEANGEFGIDRIAELVKEYTITEFVVGFP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMN + GPR  ++  +   +++    +P   WDERLTT++A+++LI+ +VSRKKR Q +
Sbjct: 63  KNMNNTVGPRGEASENY-KKLLEEHFSLPVKLWDERLTTMAAERMLIEADVSRKKRKQVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKMAAVMILQGYLD 135


>gi|297616549|ref|YP_003701708.1| Holliday junction resolvase YqgF [Syntrophothermus lipocalidus DSM
           12680]
 gi|297144386|gb|ADI01143.1| Holliday junction resolvase YqgF [Syntrophothermus lipocalidus DSM
           12680]
          Length = 144

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 72/135 (53%), Gaps = 1/135 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D G KRIG+AISD     A P   + R  +      +     T  +   ++GLPLN
Sbjct: 3   ILGLDPGEKRIGVAISDALGITAQPLTSIQRSSLKADIEAIRQICETYQVEHIVLGLPLN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           +NGS G +   +      + +  + +    WDERL+T + Q +L++ + SR+KR + VD 
Sbjct: 63  LNGSRGEKAAQSAKLAQELKEH-LSLEVTLWDERLSTKAVQGVLLEADTSRRKRKRVVDK 121

Query: 139 IAAALILQEVLDRIS 153
           +AAA ILQ  LDRI 
Sbjct: 122 LAAAYILQGYLDRIG 136


>gi|291458552|ref|ZP_06597942.1| putative Holliday junction resolvase [Oribacterium sp. oral taxon
           078 str. F0262]
 gi|291419085|gb|EFE92804.1| putative Holliday junction resolvase [Oribacterium sp. oral taxon
           078 str. F0262]
          Length = 254

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 81/131 (61%), Gaps = 4/131 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G K IG+A++DP    A P   + R+   K+ ++  E+ + ++  ++   +IGL
Sbjct: 3   IMGLDYGAKTIGVAVTDPSGLIAQPLRTIFREREGKLRRSLQEIAALVSELSVERIVIGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+ +EG R    R F   ++ ++V VP  + DERLTT++A++IL +  V R+++ + 
Sbjct: 63  PLNMDETEGERAEKAREFAA-LLAKRVLVPIEWVDERLTTIAAREILDESGVPREEQKRM 121

Query: 136 VDSIAAALILQ 146
           +D +AA LIL+
Sbjct: 122 IDQVAAQLILE 132


>gi|253580719|ref|ZP_04857983.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848090|gb|EES76056.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 140

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 77/138 (55%), Gaps = 4/138 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK---VTQTALELLSFITTENIAAFIIGL 75
           +  +D G+K +G+AISDP    A     + RK+   + QT   +   ++  ++   ++G 
Sbjct: 3   VLGLDYGSKTVGVAISDPLGITAQGVETIWRKQENHLRQTLARIEELVSEYHVEKIVLGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R   +  F   M++R+  +  + WDERLTTV A + L++ +V R+ R Q 
Sbjct: 63  PKNMNNTIGERAQKSLEF-KEMLERRTGLEVIMWDERLTTVEANRTLMEASVRRENRKQY 121

Query: 136 VDSIAAALILQEVLDRIS 153
           +D +AA  ILQ  LD +S
Sbjct: 122 LDQLAAVFILQGYLDSLS 139


>gi|307711065|ref|ZP_07647487.1| conserved hypothetical protein [Streptococcus mitis SK321]
 gi|307617027|gb|EFN96205.1| conserved hypothetical protein [Streptococcus mitis SK321]
          Length = 136

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 84/137 (61%), Gaps = 10/137 (7%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLPLN 78
            +D+G+K +G+AISDP    A     + + ++  Q   + +   + T  +  F++GLP N
Sbjct: 2   GLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRVKELVDTYKVERFVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAF---VHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQ 134
           MN + GPRV +++A+   +  + D    +P  + DERLTTV+A+++LI+  ++SR KR +
Sbjct: 62  MNNTSGPRVEASQAYGAKLEELFD----LPVDYQDERLTTVAAERMLIEQADISRNKRKK 117

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA LILQ  LDR
Sbjct: 118 VIDKLAAQLILQNYLDR 134


>gi|195978958|ref|YP_002124202.1| putative Holliday junction resolvase RvuC-like [Streptococcus equi
           subsp. zooepidemicus MGCS10565]
 gi|195975663|gb|ACG63189.1| putative Holliday junction resolvase RvuC-like [Streptococcus equi
           subsp. zooepidemicus MGCS10565]
          Length = 136

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 81/136 (59%), Gaps = 10/136 (7%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFIIGL 75
            +D+G+K +G+AISDP    A     +   K+ +   +     L   +    +  F+IGL
Sbjct: 2   GLDVGSKTVGVAISDPLGFTAQGLEII---KINEDKQDFGFDRLAELVKQYQVDRFVIGL 58

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQ 134
           P NMN + GPRV +++A+  + I+   ++P  + DERLTTV A+++LI+  ++SR KR +
Sbjct: 59  PKNMNNTSGPRVEASKAY-GDRIEELFHIPVSYQDERLTTVEAERMLIEQADISRGKRKK 117

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA LILQ  LD
Sbjct: 118 VIDKLAAQLILQNYLD 133


>gi|260438499|ref|ZP_05792315.1| putative holliday junction resolvase [Butyrivibrio crossotus DSM
           2876]
 gi|292809088|gb|EFF68293.1| putative holliday junction resolvase [Butyrivibrio crossotus DSM
           2876]
          Length = 144

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 74/138 (53%), Gaps = 4/138 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G++ +G+A+ DP    A     + RK   K+ QT   +       N    ++GL
Sbjct: 3   IIGLDFGSRTVGVAVCDPLMITAQGVEIIRRKEENKLRQTYARIEELCAEYNAERIVLGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G RV  T  F    ++R+  +  V WDERLTTV+A   +++  + R+ R + 
Sbjct: 63  PKNMNNTSGDRVDKTMDF-KAALERRTGLEVVMWDERLTTVAADNAMMEAGIRRENRKEY 121

Query: 136 VDSIAAALILQEVLDRIS 153
           VD IAA LILQ  LD ++
Sbjct: 122 VDMIAAQLILQGYLDSLA 139


>gi|172058081|ref|YP_001814541.1| Holliday junction resolvase YqgF [Exiguobacterium sibiricum 255-15]
 gi|171990602|gb|ACB61524.1| Holliday junction resolvase YqgF [Exiguobacterium sibiricum 255-15]
          Length = 140

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 78/140 (55%), Gaps = 17/140 (12%)

Query: 21  SIDLGTKRIGLAISD---------PGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAF 71
            +D+G+K IG+A+SD            ++  P   +  K+       L + I    +   
Sbjct: 6   GLDVGSKTIGVAVSDLMGWTAQGVETIKWTEPEYPVAFKR-------LEAIIKEYGVEII 58

Query: 72  IIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           +IG P NMNGS GPR  ++ AF    I+ +  +  V  DERLTT+ A+++LID +VSRKK
Sbjct: 59  VIGHPKNMNGSIGPRAEASEAFARE-IETQTGLSTVLVDERLTTMQAERMLIDADVSRKK 117

Query: 132 RIQKVDSIAAALILQEVLDR 151
           R Q +D +AA +ILQ  LDR
Sbjct: 118 RKQVIDKMAAVMILQSYLDR 137


>gi|260886204|ref|ZP_05897467.1| putative holliday junction resolvase [Selenomonas sputigena ATCC
           35185]
 gi|330838890|ref|YP_004413470.1| Holliday junction resolvase [Selenomonas sputigena ATCC 35185]
 gi|260864067|gb|EEX78567.1| putative holliday junction resolvase [Selenomonas sputigena ATCC
           35185]
 gi|329746654|gb|AEC00011.1| Holliday junction resolvase [Selenomonas sputigena ATCC 35185]
          Length = 149

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 72/136 (52%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + ++D+G + IG+A SD     A     + RK   +    L   +       FI+GLP N
Sbjct: 5   VLALDVGDRTIGVAASDGLGLTAQGVETIRRKSWDKDFARLKELMELYETDTFIVGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG++G R    R F   +  +      VFWDERL+TV+A++ LI  +VSR KR + +D 
Sbjct: 65  MNGTQGERCDVVRDFAQRLQKKFKGSQVVFWDERLSTVAAERSLIAADVSRAKRRKVIDK 124

Query: 139 IAAALILQEVLDRISF 154
           +AA  ILQ  LD +  
Sbjct: 125 MAAVFILQGYLDNLGM 140


>gi|325107974|ref|YP_004269042.1| Holliday junction resolvase [Planctomyces brasiliensis DSM 5305]
 gi|324968242|gb|ADY59020.1| Holliday junction resolvase [Planctomyces brasiliensis DSM 5305]
          Length = 155

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 70/130 (53%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            ID GTKR+GLAIS P +  A P   + R +  Q + ++        +   ++GLP++M+
Sbjct: 13  GIDFGTKRVGLAISTPDQSIASPLEIIHRSQPAQDSKKICKICNEFRVKGLVVGLPVHMS 72

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSEG +    R F  +       +P ++WDER T+  A   L    +S+ KR + +D +A
Sbjct: 73  GSEGGKAKEARVF-GDWCGEITQLPVIYWDERFTSALADNHLRQSTMSQAKRKKHLDKLA 131

Query: 141 AALILQEVLD 150
           A ++LQ  L+
Sbjct: 132 AQVMLQSFLE 141


>gi|307704051|ref|ZP_07640982.1| Holliday junction resolvase, putative [Streptococcus mitis SK597]
 gi|307709897|ref|ZP_07646344.1| Holliday junction resolvase, putative [Streptococcus mitis SK564]
 gi|307619268|gb|EFN98397.1| Holliday junction resolvase, putative [Streptococcus mitis SK564]
 gi|307622402|gb|EFO01408.1| Holliday junction resolvase, putative [Streptococcus mitis SK597]
          Length = 136

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 83/134 (61%), Gaps = 4/134 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLPLN 78
            +D+G+K +G+AISDP    A     + + ++  Q   + +   + T  +  F++GLP N
Sbjct: 2   GLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRVKELVDTYKVERFVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKVD 137
           MN + GPRV +++A+   + +    +P  + DERLTTV+A+++LI+  ++SR KR + +D
Sbjct: 62  MNNTSGPRVEASQAYGAKL-EELFGLPVDYQDERLTTVAAERMLIEQADISRNKRKKVID 120

Query: 138 SIAAALILQEVLDR 151
            +AA LILQ  LDR
Sbjct: 121 KLAAQLILQNYLDR 134


>gi|25012082|ref|NP_736477.1| Holliday junction resolvase-like protein [Streptococcus agalactiae
           NEM316]
 gi|54039588|sp|P67493|RUVX_STRA5 RecName: Full=Putative Holliday junction resolvase
 gi|54042292|sp|P67492|RUVX_STRA3 RecName: Full=Putative Holliday junction resolvase
 gi|118597222|sp|Q3JYN4|RUVX_STRA1 RecName: Full=Putative Holliday junction resolvase
 gi|24413626|emb|CAD47703.1| Unknown [Streptococcus agalactiae NEM316]
          Length = 139

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 84/137 (61%), Gaps = 4/137 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + ++      + L+ +  E  +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIKIDEESGNFGFDRLAELVKEYKVDKFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+  + I     +P  + DERLTTV A+++L++  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAY-GDKITELFNLPVEYQDERLTTVQAERMLVEQADISRGKRKKV 121

Query: 136 VDSIAAALILQEVLDRI 152
           +D +AA LILQ  LDR+
Sbjct: 122 IDKLAAQLILQNYLDRM 138


>gi|332981265|ref|YP_004462706.1| Holliday junction resolvase YqgF [Mahella australiensis 50-1 BON]
 gi|332698943|gb|AEE95884.1| Holliday junction resolvase YqgF [Mahella australiensis 50-1 BON]
          Length = 144

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 70/133 (52%), Gaps = 1/133 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G   IG+AISD     A       RK+       ++       +   +IGLP N
Sbjct: 3   ILGLDVGDNTIGIAISDELGWTAQGLETWRRKQPEADMQHIVDICQKSGVQCIVIGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVY-VPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           MNGS GP+     AF   + D     +  V WDERL+TV+AQ+ LI+ +VSR KR + +D
Sbjct: 63  MNGSIGPQGKKVIAFKQRLADYMADDIDIVLWDERLSTVAAQRSLIEADVSRAKRKKVID 122

Query: 138 SIAAALILQEVLD 150
            +AA  ILQ  LD
Sbjct: 123 KMAAVYILQGYLD 135


>gi|126653902|ref|ZP_01725749.1| Holliday junction resolvase-like protein [Bacillus sp. B14905]
 gi|126589627|gb|EAZ83766.1| Holliday junction resolvase-like protein [Bacillus sp. B14905]
          Length = 138

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 80/134 (59%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+A+SD  G          + +   +  ++ ++ +  E  I  F++G P
Sbjct: 3   IMGLDVGSKTVGVAVSDALGWTAQGIETVKIDEANGEFGIDRIAELVKEYAITEFVVGFP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMN + GPR  ++  +   +++    +P   WDERLTT++A+++LI+ +VSRKKR Q +
Sbjct: 63  KNMNNTVGPRGEASENY-KTLLEETFSLPVKLWDERLTTMAAERMLIEADVSRKKRKQVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKMAAVMILQGYLD 135


>gi|331091336|ref|ZP_08340176.1| Holliday junction resolvase [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330404497|gb|EGG84041.1| Holliday junction resolvase [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 142

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+AISD     A     + RK   K+ +T   + + I    +   ++G 
Sbjct: 3   IMGLDYGSKTVGVAISDALCLTAQGIETIQRKEENKLRKTLARIETLIKEYEVDKIVLGF 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MN   G R   + AF  +M++R+  +  + WDERLTTV A++ LI+ NV R++R + 
Sbjct: 63  PKHMNNDIGDRAEKSLAF-KDMLERRTGLEVIMWDERLTTVEAERTLIESNVRREERKKY 121

Query: 136 VDSIAAALILQEVLDRI 152
           VD IAA  ILQ  LD +
Sbjct: 122 VDKIAAIFILQGYLDSV 138


>gi|256847958|ref|ZP_05553402.1| Holliday junction resolvase YqgF [Lactobacillus coleohominis
           101-4-CHN]
 gi|256715018|gb|EEU29995.1| Holliday junction resolvase YqgF [Lactobacillus coleohominis
           101-4-CHN]
          Length = 146

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 79/134 (58%), Gaps = 3/134 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQ--TALELLSFITTENIAAFIIGLPLN 78
            +D+G+K +G+A SDP    A     +   +  +      +   +    +A F++GLP N
Sbjct: 5   GLDVGSKTVGVAESDPLGWTAQAVEIIPIDEENEIFGIDRIAELVQARQVAGFVLGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQKVD 137
           MN +EGPRV ++R +   +  R   +P  F DERLTTV A ++L+ + +VSR+K+ + +D
Sbjct: 65  MNNTEGPRVEASRHYGELLRQRFPKLPIDFQDERLTTVQAHRMLVEEADVSRRKQKKVID 124

Query: 138 SIAAALILQEVLDR 151
            +AA+LILQ  LDR
Sbjct: 125 ELAASLILQNYLDR 138


>gi|229019608|ref|ZP_04176421.1| Holliday junction resolvase [Bacillus cereus AH1273]
 gi|229025846|ref|ZP_04182244.1| Holliday junction resolvase [Bacillus cereus AH1272]
 gi|228735457|gb|EEL86054.1| Holliday junction resolvase [Bacillus cereus AH1272]
 gi|228741688|gb|EEL91875.1| Holliday junction resolvase [Bacillus cereus AH1273]
          Length = 137

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 79/134 (58%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+GTK +G+A+SD  G          + ++      + +S  +    +   ++GLP
Sbjct: 3   ILGLDVGTKTVGVAMSDEMGWTAQGLETIKINEERGHFGFDRISELVKQYGVDKIVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  + + F  N+ +  + +  V WDERL+T++A+++LI  +VSRKKR Q +
Sbjct: 63  KNMNGTIGPRGEACQQFAENLREL-LQLDVVMWDERLSTMAAERLLISADVSRKKRKQVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKMAAVVILQGFLD 135


>gi|15892378|ref|NP_360092.1| Holliday junction resolvase-like protein [Rickettsia conorii str.
           Malish 7]
 gi|32130054|sp|Q92IG5|RUVX_RICCN RecName: Full=Putative Holliday junction resolvase
 gi|15619527|gb|AAL02993.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 154

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 84/149 (56%), Gaps = 5/149 (3%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFL--VRKKVTQTALELLSFI 63
           +++  + L PN P+ +ID G K++G+A+S+  R  A P   +  + KK+  T+L  L+ I
Sbjct: 6   LQEFYRLLIPNVPLIAIDYGNKKLGIALSNQERSIAMPLNTITEINKKIVITSL--LNII 63

Query: 64  TTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI 123
               +   IIGLP++M+G+   + +    F   +  + + +P    DERLTT +A  +L 
Sbjct: 64  EKYKVCGVIIGLPIDMSGAVTEQTNIVMKFAEEL-AKSINLPIYLQDERLTTKAANNLLK 122

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLDRI 152
              V RK R    D++AA++IL+ VLD I
Sbjct: 123 SFGVKRKDRNNNDDAVAASMILETVLDSI 151


>gi|290581344|ref|YP_003485736.1| hypothetical protein SmuNN2025_1818 [Streptococcus mutans NN2025]
 gi|254998243|dbj|BAH88844.1| hypothetical protein [Streptococcus mutans NN2025]
          Length = 139

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 84/140 (60%), Gaps = 10/140 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+G+K +G+A+SDP    A     + + +   +   E L+  +    +  F++GLP
Sbjct: 3   IIGLDVGSKTVGVAVSDPLGFTAQGLEIIPINEAKGEFGFERLADLVKDYKVEKFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAF---VHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
            NMN + GPRV +++A+   +  + D    +P  + DERLTTV A+++L++  +VSR KR
Sbjct: 63  KNMNNTSGPRVEASQAYGKKIKELFD----LPVEYQDERLTTVQAERMLVEQADVSRGKR 118

Query: 133 IQKVDSIAAALILQEVLDRI 152
            + +D +AA LILQ  LDR+
Sbjct: 119 KKVIDKLAAQLILQNYLDRM 138


>gi|94967587|ref|YP_589635.1| Holliday junction resolvase YqgF [Candidatus Koribacter versatilis
           Ellin345]
 gi|124107438|sp|Q1IU89|RUVX_ACIBL RecName: Full=Putative Holliday junction resolvase
 gi|94549637|gb|ABF39561.1| Holliday junction resolvase YqgF [Candidatus Koribacter versatilis
           Ellin345]
          Length = 153

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 74/133 (55%), Gaps = 1/133 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D GT+RIGLA+SDP    A     L+RK        L S I    I   ++GLPL 
Sbjct: 11  ILALDFGTRRIGLAVSDPLGITAQGLQTLLRKNKRTDLAALRSVIEQNEIREIVVGLPLR 70

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           ++G++       R F    ++++  +P   WDER T+V A ++L +  +S KKR + VD 
Sbjct: 71  LSGADSSSTEKAREFAA-WLEKEFALPVHMWDERFTSVEANRVLRESEMSIKKRGEAVDR 129

Query: 139 IAAALILQEVLDR 151
           ++A LILQ  L+R
Sbjct: 130 LSAVLILQAFLER 142


>gi|111658812|ref|ZP_01409443.1| hypothetical protein SpneT_02000110 [Streptococcus pneumoniae
           TIGR4]
 gi|149017883|ref|ZP_01834342.1| hypothetical protein CGSSp23BS72_11110 [Streptococcus pneumoniae
           SP23-BS72]
 gi|183603171|ref|ZP_02710544.2| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1087-00]
 gi|183603568|ref|ZP_02718032.2| conserved hypothetical protein [Streptococcus pneumoniae
           CDC3059-06]
 gi|221231101|ref|YP_002510253.1| Holliday junction resolvase [Streptococcus pneumoniae ATCC 700669]
 gi|298230981|ref|ZP_06964662.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           str. Canada MDR_19F]
 gi|298502010|ref|YP_003723950.1| crossover junction endodeoxyribonuclease [Streptococcus pneumoniae
           TCH8431/19A]
 gi|303265496|ref|ZP_07351396.1| hypothetical protein CGSSpBS457_01582 [Streptococcus pneumoniae
           BS457]
 gi|303267946|ref|ZP_07353748.1| hypothetical protein CGSSpBS458_10928 [Streptococcus pneumoniae
           BS458]
 gi|307126416|ref|YP_003878447.1| hypothetical protein SP670_0270 [Streptococcus pneumoniae 670-6B]
 gi|147931447|gb|EDK82425.1| hypothetical protein CGSSp23BS72_11110 [Streptococcus pneumoniae
           SP23-BS72]
 gi|183570834|gb|EDT91362.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1087-00]
 gi|183576182|gb|EDT96710.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC3059-06]
 gi|220673561|emb|CAR68047.1| putative Holliday junction resolvase [Streptococcus pneumoniae ATCC
           700669]
 gi|298237605|gb|ADI68736.1| crossover junction endodeoxyribonuclease [Streptococcus pneumoniae
           TCH8431/19A]
 gi|301799346|emb|CBW31881.1| putative Holliday junction resolvase [Streptococcus pneumoniae
           OXC141]
 gi|301801141|emb|CBW33814.1| putative Holliday junction resolvase [Streptococcus pneumoniae
           INV200]
 gi|302642642|gb|EFL72987.1| hypothetical protein CGSSpBS458_10928 [Streptococcus pneumoniae
           BS458]
 gi|302644936|gb|EFL75183.1| hypothetical protein CGSSpBS457_01582 [Streptococcus pneumoniae
           BS457]
 gi|306483478|gb|ADM90347.1| conserved hypothetical protein [Streptococcus pneumoniae 670-6B]
 gi|327390615|gb|EGE88955.1| hypothetical protein SPAR5_0192 [Streptococcus pneumoniae GA04375]
 gi|332075862|gb|EGI86329.1| uncharacterized family protein [Streptococcus pneumoniae GA17570]
 gi|332076642|gb|EGI87104.1| hypothetical protein SPAR148_0175 [Streptococcus pneumoniae
           GA17545]
 gi|332077498|gb|EGI87959.1| hypothetical protein SPAR68_0240 [Streptococcus pneumoniae GA41301]
 gi|332202111|gb|EGJ16180.1| hypothetical protein SPAR69_0222 [Streptococcus pneumoniae GA41317]
 gi|332203361|gb|EGJ17428.1| hypothetical protein SPAR93_0231 [Streptococcus pneumoniae GA47368]
 gi|332204204|gb|EGJ18269.1| hypothetical protein SPAR120_0169 [Streptococcus pneumoniae
           GA47901]
          Length = 136

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 83/134 (61%), Gaps = 4/134 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLPLN 78
            +D+G+K +G+AISDP    A     + + ++  Q   + +   + T  +  F++GLP N
Sbjct: 2   GLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRVKELVDTYKVERFVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKVD 137
           MN + GPRV +++A+   + +    +P  + DERLTTV+A+++LI+  ++SR KR + +D
Sbjct: 62  MNNTSGPRVEASQAYGAKL-EEFFGLPVDYQDERLTTVAAERMLIEQADISRNKRKKVID 120

Query: 138 SIAAALILQEVLDR 151
            +AA LILQ  LDR
Sbjct: 121 KLAAQLILQNYLDR 134


>gi|152976801|ref|YP_001376318.1| Holliday junction resolvase-like protein [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|189046085|sp|A7GT65|RUVX_BACCN RecName: Full=Putative Holliday junction resolvase
 gi|152025553|gb|ABS23323.1| Holliday junction resolvase YqgF [Bacillus cytotoxicus NVH 391-98]
          Length = 137

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 80/138 (57%), Gaps = 11/138 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSF------ITTENIAAFI 72
           I  +D+GTK +G+AISD           L   K+ +   E+  F      +   N+   +
Sbjct: 3   ILGLDVGTKTVGVAISDE---MGWTAQGLETIKINEER-EIFGFDRVSELVKQYNVDKIV 58

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLP NMNG+ GPR  + + +  ++ +  + +  + WDERL+T++A+++LI  +VSRKKR
Sbjct: 59  VGLPKNMNGTIGPRGEACQRYAESLREL-LQLEVILWDERLSTMAAERLLISADVSRKKR 117

Query: 133 IQKVDSIAAALILQEVLD 150
            Q VD +AA +ILQ  LD
Sbjct: 118 KQVVDKMAAVVILQGYLD 135


>gi|212638590|ref|YP_002315110.1| RNase H-like ribonuclease [Anoxybacillus flavithermus WK1]
 gi|212560070|gb|ACJ33125.1| RNase H-like ribonuclease [Anoxybacillus flavithermus WK1]
          Length = 145

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 77/134 (57%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELL-SFITTENIAAFIIGLP 76
           I  +D GTK +G+A+SD  G          + ++  +   + L   I    +   ++G P
Sbjct: 8   ILGLDFGTKTLGVAVSDELGWTAQGIETIRIDEEHGEYGFDRLRQLIEQYAVEEIVVGFP 67

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  +T+ F    + +   +P V WDERL+T++A+++LI  +VSRKKR + +
Sbjct: 68  KNMNGTIGPRGEATQRFAEQ-VKQTFSLPVVLWDERLSTMAAERMLIAADVSRKKRKKVI 126

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 127 DKMAAVMILQSYLD 140


>gi|225568728|ref|ZP_03777753.1| hypothetical protein CLOHYLEM_04807 [Clostridium hylemonae DSM
           15053]
 gi|225162227|gb|EEG74846.1| hypothetical protein CLOHYLEM_04807 [Clostridium hylemonae DSM
           15053]
          Length = 145

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 72/137 (52%), Gaps = 4/137 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G K +G+A+SDP    A     + RK   K+ QT   +   I    +   ++GL
Sbjct: 5   IMGLDYGEKTVGVAVSDPLGLTAQGIETIFRKEENKLRQTCARIEELIREYEVERIVLGL 64

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MN   G R   +  F   M+ R+  +  V WDERLTTV A++ LI+  V R+ R + 
Sbjct: 65  PKHMNNDIGDRAEQSLEF-GEMLKRRTGLEVVMWDERLTTVEAERTLIENKVRREDRKKY 123

Query: 136 VDSIAAALILQEVLDRI 152
           +D IAA  ILQ  LD I
Sbjct: 124 IDKIAAVFILQGYLDSI 140


>gi|164688537|ref|ZP_02212565.1| hypothetical protein CLOBAR_02182 [Clostridium bartlettii DSM
           16795]
 gi|164602950|gb|EDQ96415.1| hypothetical protein CLOBAR_02182 [Clostridium bartlettii DSM
           16795]
          Length = 141

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 74/132 (56%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+A+SD     A     + R+   +   EL + I    +   + GLP N
Sbjct: 6   IMGLDIGDKTIGVAVSDIMGITAQGVKTIRRESKKKDIEELKNIIKERQVNKIVSGLPKN 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP+          +I  +  +   FWDERLTTV+A++ LI+ +VSRKKR + +D 
Sbjct: 66  MNGTLGPQGEKVLKLCE-LIKEETGLEIDFWDERLTTVAAERSLIEGDVSRKKRKKVIDM 124

Query: 139 IAAALILQEVLD 150
           +AA +ILQ  LD
Sbjct: 125 LAAVIILQGYLD 136


>gi|325680097|ref|ZP_08159663.1| RNAse H domain protein, YqgF family [Ruminococcus albus 8]
 gi|324108172|gb|EGC02422.1| RNAse H domain protein, YqgF family [Ruminococcus albus 8]
          Length = 140

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 67/131 (51%), Gaps = 1/131 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D G  R G+AISD     A P   +      + A ++            ++GLP+N
Sbjct: 3   ILAVDYGDARTGIAISDNSEFLASPVCTITEYHADRLAQKVADIAKERGAGEIVVGLPIN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG++G R     AF   M+   V V    WDER TTV+A Q L + NV  KKR   VD+
Sbjct: 63  MNGTKGERAEKCEAFAE-MLRGLVDVEVKMWDERSTTVTAHQYLNETNVRGKKRKAVVDT 121

Query: 139 IAAALILQEVL 149
           +AA +IL+  L
Sbjct: 122 VAATIILESYL 132


>gi|311114976|ref|YP_003986197.1| putative Holliday junction resolvase [Gardnerella vaginalis ATCC
           14019]
 gi|310946470|gb|ADP39174.1| possible Holliday junction resolvase [Gardnerella vaginalis ATCC
           14019]
          Length = 166

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 78/143 (54%), Gaps = 13/143 (9%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-LLSFITTENIAAFIIGLPLNM 79
            IDLG  R+G A+SDP   FAHP   +     +  A+E +L+ I   +++  +IGLPL +
Sbjct: 15  GIDLGDARVGTALSDPELTFAHPAGNVQSYGDSFNAIEDVLNIIEDNSVSRVVIGLPLQL 74

Query: 80  NGSEGPRVHSTRAFVHNMIDRKV-----------YVPFVFW-DERLTTVSAQQILIDMNV 127
           +G+EG      R +  N++ R             ++P V W DERLTTV+A + L+D + 
Sbjct: 75  DGTEGKSAKKARRWGTNLVKRMKSLFDYGDWSLDFIPEVVWKDERLTTVTAHKQLLDADF 134

Query: 128 SRKKRIQKVDSIAAALILQEVLD 150
           S +K    VD  +A LILQ  +D
Sbjct: 135 STRKHRPMVDQQSAVLILQSAID 157


>gi|290968330|ref|ZP_06559871.1| RNAse YqgF [Megasphaera genomosp. type_1 str. 28L]
 gi|290781605|gb|EFD94192.1| RNAse YqgF [Megasphaera genomosp. type_1 str. 28L]
          Length = 143

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 71/132 (53%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G+K IG+A SD     A     + RK        L +  T   +   ++G P +
Sbjct: 5   ILGLDIGSKTIGVACSDALGITAQGITTIQRKTAQDDWQRLQALATERRVTRMVVGRPRH 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG +   V    AF+  +  +   + FV+WDERLTT+ A+Q+L+   V R+KR Q VD 
Sbjct: 65  MNGEDSENVKQIEAFITYLKRQMPAMEFVYWDERLTTMMARQVLMAGGVRREKRKQFVDK 124

Query: 139 IAAALILQEVLD 150
           +AA LILQ  LD
Sbjct: 125 MAAILILQNYLD 136


>gi|331002893|ref|ZP_08326406.1| hypothetical protein HMPREF0491_01268 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330413186|gb|EGG92560.1| hypothetical protein HMPREF0491_01268 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 143

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 78/139 (56%), Gaps = 4/139 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVR---KKVTQTALELLSFITTENIAAFI 72
            + I  +D G+K IG+AISD     A P   + R    K+ ++   +   +  ++I   +
Sbjct: 2   KERIMGLDYGSKTIGVAISDALGLTAQPLETIERSGENKLRRSLARIAEIVREKDIKKIV 61

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLP+NM+G  G R   T  FV  +  R V +P V  DERLTTV A +IL +  V ++ R
Sbjct: 62  VGLPINMDGRSGERAALTLEFVEKLKLR-VDIPIVMQDERLTTVEADEILDESGVKKQDR 120

Query: 133 IQKVDSIAAALILQEVLDR 151
            Q +D IAA +IL+E +++
Sbjct: 121 KQFIDQIAAGIILKEYMEK 139


>gi|67458927|ref|YP_246551.1| Holliday junction resolvase-like protein [Rickettsia felis
           URRWXCal2]
 gi|75536635|sp|Q4UM37|RUVX_RICFE RecName: Full=Putative Holliday junction resolvase
 gi|67004460|gb|AAY61386.1| Conserved hypothetical protein [Rickettsia felis URRWXCal2]
          Length = 154

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 81/145 (55%), Gaps = 5/145 (3%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVR--KKVTQTALELLSFITTENIAA 70
           L PN P+ +ID G+K++G+A+S+  R  A P   ++   KK+  T+L  LS I    +  
Sbjct: 13  LIPNAPLIAIDYGSKKLGIALSNQERNIAMPLNTIIEINKKIVITSL--LSIIEKYKVCG 70

Query: 71  FIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRK 130
            +IGLP++M+G+   + +    F   +  + + +P    DERLTT +A   L    V RK
Sbjct: 71  VVIGLPIDMSGAVTEQTNIVMKFAEELA-KSINLPIYLQDERLTTKAANNFLKSFGVKRK 129

Query: 131 KRIQKVDSIAAALILQEVLDRISFL 155
            R    D++AA++IL+ VLD +  L
Sbjct: 130 DRNNNDDAVAASMILETVLDSMKKL 154


>gi|270291980|ref|ZP_06198195.1| putative Holliday junction resolvase [Streptococcus sp. M143]
 gi|270279508|gb|EFA25350.1| putative Holliday junction resolvase [Streptococcus sp. M143]
          Length = 139

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 83/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + +   Q   + +   + +  +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEDQGQFGFDRIKELVDSYKVERFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+   + +    +P  + DERLTTV+A+++LI+  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGAKL-EELFGLPVDYQDERLTTVAAERMLIEQADISRNKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|148543770|ref|YP_001271140.1| Holliday junction resolvase-like protein [Lactobacillus reuteri DSM
           20016]
 gi|184153176|ref|YP_001841517.1| hypothetical protein LAR_0521 [Lactobacillus reuteri JCM 1112]
 gi|194468335|ref|ZP_03074321.1| Holliday junction resolvase YqgF [Lactobacillus reuteri 100-23]
 gi|227363250|ref|ZP_03847382.1| crossover junction endodeoxyribonuclease [Lactobacillus reuteri
           MM2-3]
 gi|227544202|ref|ZP_03974251.1| crossover junction endodeoxyribonuclease [Lactobacillus reuteri
           CF48-3A]
 gi|300908197|ref|ZP_07125663.1| crossover junction endodeoxyribonuclease [Lactobacillus reuteri
           SD2112]
 gi|325682142|ref|ZP_08161660.1| crossover junction endodeoxyribonuclease [Lactobacillus reuteri
           MM4-1A]
 gi|167012733|sp|A5VIX9|RUVX_LACRD RecName: Full=Putative Holliday junction resolvase
 gi|226731626|sp|B2G6F5|RUVX_LACRJ RecName: Full=Putative Holliday junction resolvase
 gi|148530804|gb|ABQ82803.1| Holliday junction resolvase YqgF [Lactobacillus reuteri DSM 20016]
 gi|154705538|gb|ABS84195.1| holliday junction resolvase-like protein [Lactobacillus reuteri]
 gi|183224520|dbj|BAG25037.1| conserved hypothetical protein [Lactobacillus reuteri JCM 1112]
 gi|194453188|gb|EDX42086.1| Holliday junction resolvase YqgF [Lactobacillus reuteri 100-23]
 gi|227071706|gb|EEI09997.1| crossover junction endodeoxyribonuclease [Lactobacillus reuteri
           MM2-3]
 gi|227185838|gb|EEI65909.1| crossover junction endodeoxyribonuclease [Lactobacillus reuteri
           CF48-3A]
 gi|300894624|gb|EFK87980.1| crossover junction endodeoxyribonuclease [Lactobacillus reuteri
           SD2112]
 gi|324978786|gb|EGC15735.1| crossover junction endodeoxyribonuclease [Lactobacillus reuteri
           MM4-1A]
          Length = 147

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 79/136 (58%), Gaps = 3/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQ--TALELLSFITTENIAAFIIGLP 76
           +  +D+G+K +G+++SDP    A     +   +  +      +   +  E +A F+IGLP
Sbjct: 3   LMGLDVGSKTVGISVSDPLGWTAQAVEIIPIDEENEIFGIDRVAELVKKEQVAGFVIGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQK 135
            NMN +EGPRV +++ +   +  R   +P  F DERLTTV A ++L+ + ++SR K+ + 
Sbjct: 63  KNMNNTEGPRVEASQHYGKLLQQRFPDIPIDFQDERLTTVEAHRMLVEEADISRAKQKKV 122

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA  ILQ  LDR
Sbjct: 123 IDEVAATFILQSYLDR 138


>gi|308235923|ref|ZP_07666660.1| putative Holliday junction resolvase [Gardnerella vaginalis ATCC
           14018]
          Length = 156

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 78/143 (54%), Gaps = 13/143 (9%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-LLSFITTENIAAFIIGLPLNM 79
            IDLG  R+G A+SDP   FAHP   +     +  A+E +L+ I   +++  +IGLPL +
Sbjct: 5   GIDLGDARVGTALSDPELTFAHPAGNVQSYGDSFNAIEDVLNIIEDNSVSRVVIGLPLQL 64

Query: 80  NGSEGPRVHSTRAFVHNMIDRKV-----------YVPFVFW-DERLTTVSAQQILIDMNV 127
           +G+EG      R +  N++ R             ++P V W DERLTTV+A + L+D + 
Sbjct: 65  DGTEGKSAKKARRWGTNLVKRMKSLFDYGDWSLDFIPEVVWKDERLTTVTAHKQLLDADF 124

Query: 128 SRKKRIQKVDSIAAALILQEVLD 150
           S +K    VD  +A LILQ  +D
Sbjct: 125 STRKHRPMVDQQSAVLILQSAID 147


>gi|322375055|ref|ZP_08049569.1| putative Holliday junction resolvase [Streptococcus sp. C300]
 gi|321280555|gb|EFX57594.1| putative Holliday junction resolvase [Streptococcus sp. C300]
          Length = 139

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 83/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + +   Q   + +   + +  +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIHINEDQGQFGFDRIKELVDSYKVERFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+   + +    +P  + DERLTTV+A+++LI+  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGAKL-EELFGLPVDYQDERLTTVAAERMLIEQADISRNKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|22538225|ref|NP_689076.1| Holliday junction resolvase-like protein [Streptococcus agalactiae
           2603V/R]
 gi|76788469|ref|YP_330619.1| Holliday junction resolvase-like protein [Streptococcus agalactiae
           A909]
 gi|76799707|ref|ZP_00781806.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           18RS21]
 gi|77406617|ref|ZP_00783663.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           H36B]
 gi|77410840|ref|ZP_00787197.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           CJB111]
 gi|77412943|ref|ZP_00789146.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           515]
 gi|22535137|gb|AAN00949.1|AE014286_12 conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           2603V/R]
 gi|76563526|gb|ABA46110.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           A909]
 gi|76584940|gb|EAO61599.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           18RS21]
 gi|77160955|gb|EAO72063.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           515]
 gi|77163058|gb|EAO74012.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           CJB111]
 gi|77174776|gb|EAO77599.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           H36B]
 gi|319745985|gb|EFV98267.1| crossover junction endodeoxyribonuclease [Streptococcus agalactiae
           ATCC 13813]
          Length = 136

 Score = 85.9 bits (211), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 83/135 (61%), Gaps = 4/135 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +D+G+K +G+AISDP    A     + + ++      + L+ +  E  +  F++GLP N
Sbjct: 2   GLDVGSKTVGVAISDPLGFTAQGLEIIKIDEESGNFGFDRLAELVKEYKVDKFVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKVD 137
           MN + GPRV +++A+  + I     +P  + DERLTTV A+++L++  ++SR KR + +D
Sbjct: 62  MNNTSGPRVEASQAY-GDKITELFNLPVEYQDERLTTVQAERMLVEQADISRGKRKKVID 120

Query: 138 SIAAALILQEVLDRI 152
            +AA LILQ  LDR+
Sbjct: 121 KLAAQLILQNYLDRM 135


>gi|302671971|ref|YP_003831931.1| holliday junction resolvase YqgF [Butyrivibrio proteoclasticus
           B316]
 gi|302396444|gb|ADL35349.1| holliday junction resolvase YqgF [Butyrivibrio proteoclasticus
           B316]
          Length = 145

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 74/135 (54%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+AISD     A  R  + RK   K+ +T   +   I    +   ++GL
Sbjct: 3   IMGLDYGSKTVGVAISDELLLTAQGREIIRRKEENKLRRTLARIEELIVEYGVTKIVLGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+ +   R      F  + I+R+  +P V WDERLTTV A +I+ +  +  + R + 
Sbjct: 63  PLNMDQTPSERSQLCLEF-KDKIERRTGIPVVMWDERLTTVEADEIMDEAGIRGRDRKEY 121

Query: 136 VDSIAAALILQEVLD 150
           VD IAA +ILQ+ LD
Sbjct: 122 VDMIAAQIILQDYLD 136


>gi|238926881|ref|ZP_04658641.1| YqgF family crossover junction endodeoxyribonuclease [Selenomonas
           flueggei ATCC 43531]
 gi|238885413|gb|EEQ49051.1| YqgF family crossover junction endodeoxyribonuclease [Selenomonas
           flueggei ATCC 43531]
          Length = 143

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 70/131 (53%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           S+DLG   IG+A+SD     A     + R  +      L   +    + A + GLP +MN
Sbjct: 6   SLDLGDATIGIAVSDLLGLTAQGVETVRRTNIEADLAHLGQLMQEYEVDALVAGLPKHMN 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EG R    RAF+  + +        +WDERL+TV+A + LI  +VSRKKR + +D +A
Sbjct: 66  GDEGERCSIVRAFMAEVEEHFPGTEVHYWDERLSTVAASRALIAGDVSRKKRRKVIDKMA 125

Query: 141 AALILQEVLDR 151
           A  ILQ  LDR
Sbjct: 126 AVYILQGFLDR 136


>gi|229117883|ref|ZP_04247245.1| Holliday junction resolvase [Bacillus cereus Rock1-3]
 gi|228665540|gb|EEL21020.1| Holliday junction resolvase [Bacillus cereus Rock1-3]
          Length = 130

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 77/129 (59%), Gaps = 3/129 (2%)

Query: 24  LGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLPLNMNG 81
           +GTK +G+A+SD  G          + ++      + +S  +   N+   ++GLP NMNG
Sbjct: 1   MGTKTVGVAMSDEMGWTAQGLETIKINEERGHFGFDRISELVKQYNVDKIVVGLPKNMNG 60

Query: 82  SEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAA 141
           + GPR  + + F  N+ +  + +  V WDERL+T++A+++LI  +VSRKKR Q +D +AA
Sbjct: 61  TIGPRGEACQQFAENLREL-LQLDVVMWDERLSTMAAERLLISADVSRKKRKQVIDKMAA 119

Query: 142 ALILQEVLD 150
            +ILQ  LD
Sbjct: 120 VVILQGFLD 128


>gi|114799411|ref|YP_760995.1| hypothetical protein HNE_2300 [Hyphomonas neptunium ATCC 15444]
 gi|123128643|sp|Q0BZU8|RUVX_HYPNA RecName: Full=Putative Holliday junction resolvase
 gi|114739585|gb|ABI77710.1| conserved hypothetical protein TIGR00250 [Hyphomonas neptunium ATCC
           15444]
          Length = 151

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 73/132 (55%), Gaps = 1/132 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            ID GT  IG+A +D  R  A P   +++KK+  +   LL           I+GLPLN++
Sbjct: 17  GIDPGTATIGVAATDRIRMMASPVETILKKKLAPSLERLLHIYDERAAVGLIVGLPLNVD 76

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GS GPR  S R  V +++  +  +P  F DER ++  A  I+     +R+ R  ++D+ A
Sbjct: 77  GSMGPRAQSVRTLVSSLLKVR-DLPVTFQDERYSSAEAGDIMRAAGATRRNREARIDASA 135

Query: 141 AALILQEVLDRI 152
           AA+ILQ+ L R+
Sbjct: 136 AAVILQDALSRL 147


>gi|28210758|ref|NP_781702.1| Holliday junction resolvase-like protein [Clostridium tetani E88]
 gi|32130019|sp|Q896F1|RUVX_CLOTE RecName: Full=Putative Holliday junction resolvase
 gi|28203196|gb|AAO35639.1| DNA integration/recombination protein [Clostridium tetani E88]
          Length = 138

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 73/134 (54%), Gaps = 1/134 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G + IG+AISDP    A     + R  +     E+        +   + GLP N
Sbjct: 3   ILGLDVGDRTIGVAISDPLGWTAQGVKTIKRSNLKNDIKEIEDICNEYKVDKIVSGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP+      F  +++ +++    + WDERLTTV+A + +I+ ++SR KR + VD 
Sbjct: 63  MNGTLGPQSEKVTEFC-DILKKELEKEIIMWDERLTTVAAHKAMIEGDLSRAKRKKIVDK 121

Query: 139 IAAALILQEVLDRI 152
           IAA  ILQ  LD +
Sbjct: 122 IAAIYILQGYLDSV 135


>gi|302037044|ref|YP_003797366.1| putative holliday junction resolvase [Candidatus Nitrospira
           defluvii]
 gi|300605108|emb|CBK41441.1| predicted Holliday junction resolvase (modular protein) [Candidatus
           Nitrospira defluvii]
          Length = 203

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 72/134 (53%), Gaps = 1/134 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            Q I +ID G+KRIG A+SD     A P     R+        +   +    +   ++G+
Sbjct: 3   GQRILAIDHGSKRIGFALSDELGWTAQPLETFYRRNPDADIRHIQDLVREHEVGQVLVGM 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PL ++G  GP       F+  +++  + VP + WDER+TT +A+ +LI  +V R+KR   
Sbjct: 63  PLRLDGEIGPAAKVVAEFIQ-LLEPALSVPVITWDERMTTCAAEDLLIAADVGRRKRKGI 121

Query: 136 VDSIAAALILQEVL 149
           VD IAAA++LQ  L
Sbjct: 122 VDRIAAAILLQSYL 135


>gi|40889964|pdb|1VHX|A Chain A, Crystal Structure Of Putative Holliday Junction Resolvase
 gi|40889965|pdb|1VHX|B Chain B, Crystal Structure Of Putative Holliday Junction Resolvase
          Length = 150

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 75/137 (54%), Gaps = 3/137 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +DLGTK +G+A+SD     A       + +      L  LS  I    I   ++G P
Sbjct: 5   ILGLDLGTKTLGVALSDEXGWTAQGIETIKINEAEGDYGLSRLSELIKDYTIDKIVLGFP 64

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            N NG+ GPR  +++ F   +++    VP V WDERLTT +A++ LI  +VSR+KR + +
Sbjct: 65  KNXNGTVGPRGEASQTFAK-VLETTYNVPVVLWDERLTTXAAEKXLIAADVSRQKRKKVI 123

Query: 137 DSIAAALILQEVLDRIS 153
           D  AA  ILQ  LD ++
Sbjct: 124 DKXAAVXILQGYLDSLN 140


>gi|307243223|ref|ZP_07525394.1| RNAse H domain protein, YqgF family [Peptostreptococcus stomatis
           DSM 17678]
 gi|306493351|gb|EFM65333.1| RNAse H domain protein, YqgF family [Peptostreptococcus stomatis
           DSM 17678]
          Length = 138

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 72/134 (53%), Gaps = 1/134 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G   IG+A+SD     A     + R         L   I    +   + GLP N
Sbjct: 6   IMGLDIGDNTIGVAVSDLMGMTAQGITTIKRSSKKNDIEALKKIIEERQVNLIVSGLPKN 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP+      F  ++I  ++ +   FWDERLTTVSA+++LI+ +V RK R + +D 
Sbjct: 66  MNGTIGPQAEKVIKFC-DLIKEELGMEIKFWDERLTTVSAEKMLIEGDVRRKNRKKVIDK 124

Query: 139 IAAALILQEVLDRI 152
           +AA LILQ  LD I
Sbjct: 125 LAAVLILQGYLDSI 138


>gi|251798321|ref|YP_003013052.1| Holliday junction resolvase YqgF [Paenibacillus sp. JDR-2]
 gi|247545947|gb|ACT02966.1| Holliday junction resolvase YqgF [Paenibacillus sp. JDR-2]
          Length = 138

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 72/130 (55%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D G + IG+A+SD     A     + +++       +   +    +   ++GLP NMN
Sbjct: 5   GLDYGDRNIGVAVSDAFGWTAQGLETVHKRRDGGEMDRIAELVKEHEVTEIVVGLPKNMN 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
            + GPR   + AF   +  + + +P   WDERLTTVSA++ L++ +VSRKKR   +D +A
Sbjct: 65  NTIGPRGEISMAFAEQL-QQTLNLPVHLWDERLTTVSAERTLLEADVSRKKRKLVIDKMA 123

Query: 141 AALILQEVLD 150
           A LILQ  LD
Sbjct: 124 ATLILQNYLD 133


>gi|89895164|ref|YP_518651.1| hypothetical protein DSY2418 [Desulfitobacterium hafniense Y51]
 gi|219669581|ref|YP_002460016.1| Holliday junction resolvase-like protein [Desulfitobacterium
           hafniense DCB-2]
 gi|146325570|sp|Q24UT5|RUVX_DESHY RecName: Full=Putative Holliday junction resolvase
 gi|254767513|sp|B8FQB9|RUVX_DESHD RecName: Full=Putative Holliday junction resolvase
 gi|89334612|dbj|BAE84207.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219539841|gb|ACL21580.1| Holliday junction resolvase YqgF [Desulfitobacterium hafniense
           DCB-2]
          Length = 142

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 73/134 (54%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D G + IG+A+SD     A     + R    +   EL + +    +   ++G P N
Sbjct: 3   IMGLDFGERTIGVAVSDAMLLTAQGVKTIRRS--PKELEELKTMLQDYEVDHIVLGYPKN 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GPR  +T  F   ++  +  +P   WDERL+T+ AQ+ L++ +VSR KR Q +D 
Sbjct: 61  MNGTLGPRAQATEEFAQ-ILKEEFGLPVTLWDERLSTMGAQRSLLEADVSRAKRKQVIDK 119

Query: 139 IAAALILQEVLDRI 152
           +AA  ILQ  LD I
Sbjct: 120 MAAVFILQGYLDYI 133


>gi|229086950|ref|ZP_04219107.1| Holliday junction resolvase [Bacillus cereus Rock3-44]
 gi|228696326|gb|EEL49154.1| Holliday junction resolvase [Bacillus cereus Rock3-44]
          Length = 137

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 80/134 (59%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+GTK +G+AISD  G          + ++      + +S  +   N+   ++GLP
Sbjct: 3   ILGLDVGTKTVGVAISDEMGWTAQGLETIKINEERGIFGFDRVSELVKQYNVDKIVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  + + +  ++ +  + +  + WDERL+T++A+++LI  +VSRKKR Q +
Sbjct: 63  KNMNGTIGPRGEACQQYAESLREL-LQLEVILWDERLSTMAAERLLISADVSRKKRKQVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 122 DKMAAVVILQGYLD 135


>gi|229918437|ref|YP_002887083.1| Holliday junction resolvase YqgF [Exiguobacterium sp. AT1b]
 gi|229469866|gb|ACQ71638.1| Holliday junction resolvase YqgF [Exiguobacterium sp. AT1b]
          Length = 140

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 75/135 (55%), Gaps = 3/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAH--PRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           +  +D+G+K IG+A+SD     A      +       +    L  FI   ++   ++G P
Sbjct: 4   VMGLDVGSKTIGVAVSDLMGWTAQGVETVYWTEPDFDEAVRLLRPFIEQYDVKEVVVGHP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  ++ AF     + +  +P V  DERLTT+ A+++LI  +VSRKKR   +
Sbjct: 64  KNMNGTVGPRGEASEAFAEAFTE-QTGLPCVLVDERLTTMQAERMLISADVSRKKRKAVI 122

Query: 137 DSIAAALILQEVLDR 151
           D +AA +ILQ  LDR
Sbjct: 123 DKMAAVMILQNYLDR 137


>gi|24380413|ref|NP_722368.1| Holliday junction resolvase-like protein [Streptococcus mutans
           UA159]
 gi|32130029|sp|Q8DRX8|RUVX_STRMU RecName: Full=Putative Holliday junction resolvase
 gi|24378438|gb|AAN59674.1|AE015030_4 conserved hypothetical protein [Streptococcus mutans UA159]
          Length = 139

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 84/140 (60%), Gaps = 10/140 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +D+G+K +G+A+SDP    A     + + +   +   + L+  +    +  F++GLP
Sbjct: 3   IIGLDVGSKTVGVAVSDPLGFTAQGLEIIPINEAKGEFGFDRLADLVKDYKVEKFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAF---VHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
            NMN + GPRV +++A+   +  + D    +P  + DERLTTV A+++L++  +VSR KR
Sbjct: 63  KNMNNTSGPRVEASQAYGKKIKELFD----LPVEYQDERLTTVQAERMLVEQADVSRGKR 118

Query: 133 IQKVDSIAAALILQEVLDRI 152
            + +D +AA LILQ  LDR+
Sbjct: 119 KKVIDKLAAQLILQNYLDRM 138


>gi|306826005|ref|ZP_07459341.1| crossover junction endodeoxyribonuclease [Streptococcus sp. oral
           taxon 071 str. 73H25AP]
 gi|306828767|ref|ZP_07461959.1| crossover junction endodeoxyribonuclease [Streptococcus mitis ATCC
           6249]
 gi|315612311|ref|ZP_07887225.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           ATCC 49296]
 gi|331267155|ref|YP_004326785.1| Holliday junction resolvase-like protein,putative ribonuclease
           [Streptococcus oralis Uo5]
 gi|304428945|gb|EFM32033.1| crossover junction endodeoxyribonuclease [Streptococcus mitis ATCC
           6249]
 gi|304431721|gb|EFM34701.1| crossover junction endodeoxyribonuclease [Streptococcus sp. oral
           taxon 071 str. 73H25AP]
 gi|315315704|gb|EFU63742.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           ATCC 49296]
 gi|326683827|emb|CBZ01445.1| Holliday junction resolvase-like protein,putative ribonuclease
           [Streptococcus oralis Uo5]
          Length = 136

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 82/134 (61%), Gaps = 4/134 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLPLN 78
            +D+G+K +G+AISDP    A     + + +   Q   + +   + +  +  F++GLP N
Sbjct: 2   GLDVGSKTVGVAISDPLGFTAQGLEIIQINEDQGQFGFDRIKELVDSYKVERFVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKVD 137
           MN + GPRV +++A+   + +    +P  + DERLTTV+A+++LI+  ++SR KR + +D
Sbjct: 62  MNNTSGPRVEASQAYGAKL-EELFGLPVDYQDERLTTVAAERMLIEQADISRNKRKKVID 120

Query: 138 SIAAALILQEVLDR 151
            +AA LILQ  LDR
Sbjct: 121 KLAAQLILQNYLDR 134


>gi|239947537|ref|ZP_04699290.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921813|gb|EER21837.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 156

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 85/153 (55%), Gaps = 5/153 (3%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFL--VRKKVTQTALELLSFI 63
           +++  + L PN P+ +ID G+K++G+A+S+  R  A P   +  + KK+  T+L  L+ I
Sbjct: 6   LQEFYRLLIPNAPLIAIDYGSKKLGIALSNQERSIAMPLNTITEINKKIVITSL--LNII 63

Query: 64  TTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDR-KVYVPFVFWDERLTTVSAQQIL 122
               +   +IGLP++M+G+   + +    F   + +   + +P    DERLTT +A   L
Sbjct: 64  EKYKVCGVVIGLPIDMSGAVTEQTNIVMKFAEELAESINLPIPVYLQDERLTTKAANNFL 123

Query: 123 IDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
               V RK R    D++AA++IL+ VLD I  L
Sbjct: 124 KSFGVKRKDRNNNDDAVAASMILETVLDSIKKL 156


>gi|317057236|ref|YP_004105703.1| Holliday junction resolvase YqgF [Ruminococcus albus 7]
 gi|315449505|gb|ADU23069.1| Holliday junction resolvase YqgF [Ruminococcus albus 7]
          Length = 140

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 72/142 (50%), Gaps = 4/142 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D G  R G+A+SD     A P   +      + A ++      +     I+GLP+N
Sbjct: 3   ILAVDYGDARTGIAVSDNSEMLASPVCTITEYHADRLAQKIADIAKEQGAGEIIVGLPIN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG++G R      F  +M+   V V    WDER TTV+A + L + NV  KKR   VD+
Sbjct: 63  MNGTKGVRAEKCEEFA-DMLRALVSVEVRMWDERSTTVTAHRFLNETNVRGKKRKAVVDT 121

Query: 139 IAAALILQEVLDRISFLESSKG 160
           +AA +IL+  L   +F    KG
Sbjct: 122 VAATIILESYL---AFRSKHKG 140


>gi|118442957|ref|YP_878351.1| Holliday junction resolvase-like protein [Clostridium novyi NT]
 gi|167012715|sp|A0Q149|RUVX_CLONN RecName: Full=Putative Holliday junction resolvase
 gi|118133413|gb|ABK60457.1| Putative Holliday junction resolvase [Clostridium novyi NT]
          Length = 135

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 73/134 (54%), Gaps = 1/134 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +D+G + IG+A+SDP    A     + RK V +   EL        +   I GLP N
Sbjct: 3   VLGLDVGDRTIGVAVSDPLGFTAQGITTVHRKSVKEDIDELKKICKEYAVELIISGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ G +      F   ++  ++ +P   WDERLTTV+A + +++ N+SR KR + VD 
Sbjct: 63  MNGTVGEQGEKVIEFCE-LLKSELKMPIKMWDERLTTVAAHRAMLEANLSRAKRKKIVDK 121

Query: 139 IAAALILQEVLDRI 152
           +AA  ILQ  LD I
Sbjct: 122 MAATYILQGYLDSI 135


>gi|293364362|ref|ZP_06611088.1| crossover junction endodeoxyribonuclease [Streptococcus oralis ATCC
           35037]
 gi|291317208|gb|EFE57635.1| crossover junction endodeoxyribonuclease [Streptococcus oralis ATCC
           35037]
          Length = 139

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 82/136 (60%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLP 76
           I  +D+G+K +G+AISDP    A     + + +   Q   + +   +    +  F++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEDQGQFGFDRIKELVDIYKVERFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPRV +++A+   + +    +P  + DERLTTV+A+++LI+  ++SR KR + 
Sbjct: 63  KNMNNTSGPRVEASQAYGAKL-EELFGLPVDYQDERLTTVAAERMLIEQADISRNKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAQLILQNYLDR 137


>gi|229586597|ref|YP_002845098.1| Holliday junction resolvase-like protein [Rickettsia africae ESF-5]
 gi|259495712|sp|C3PN45|RUVX_RICAE RecName: Full=Putative Holliday junction resolvase
 gi|228021647|gb|ACP53355.1| Putative endonuclease involved in recombination [Rickettsia africae
           ESF-5]
          Length = 154

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 84/149 (56%), Gaps = 5/149 (3%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFL--VRKKVTQTALELLSFI 63
           +++  + L PN P+ +ID G+K++G+A+S+     A P   +  + KK+  T+L  L+ I
Sbjct: 6   LQEFYRLLIPNAPLIAIDYGSKKLGIALSNQELSIAMPLNTITEINKKIVITSL--LNII 63

Query: 64  TTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI 123
               +   IIGLP++M+G+   + +    F   +  + + +P    DERLTT +A  +L 
Sbjct: 64  EKYKVCGVIIGLPIDMSGAVTEQTNIVMKFAEEL-AKSINLPIYLQDERLTTKAANNLLK 122

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLDRI 152
              V RK R    D++AA++IL+ VLD I
Sbjct: 123 SFGVKRKDRNNNDDAVAASMILETVLDSI 151


>gi|227510199|ref|ZP_03940248.1| crossover junction endodeoxyribonuclease [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
 gi|227513127|ref|ZP_03943176.1| crossover junction endodeoxyribonuclease [Lactobacillus buchneri
           ATCC 11577]
 gi|227524342|ref|ZP_03954391.1| crossover junction endodeoxyribonuclease [Lactobacillus hilgardii
           ATCC 8290]
 gi|227083702|gb|EEI19014.1| crossover junction endodeoxyribonuclease [Lactobacillus buchneri
           ATCC 11577]
 gi|227088573|gb|EEI23885.1| crossover junction endodeoxyribonuclease [Lactobacillus hilgardii
           ATCC 8290]
 gi|227190404|gb|EEI70471.1| crossover junction endodeoxyribonuclease [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
          Length = 144

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 82/136 (60%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           +  +D+G+K +G+A+SD  G          + ++  +  LE ++  +    +  F++GLP
Sbjct: 3   LMGLDVGSKTVGVAVSDSLGWTSQGVEIIPIDEENGEFGLERVAQLVDKYEVDGFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQK 135
            NMN S GPR  ++  +  + +++K  +P  F DERLTTV AQ++L +  ++SR+KR + 
Sbjct: 63  KNMNNSLGPRAEASEQY-GDRLEKKFKLPVDFEDERLTTVEAQRMLTEEADISRRKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAGLILQNYLDR 137


>gi|258538956|ref|YP_003173455.1| Holliday junction resolvase-like protein [Lactobacillus rhamnosus
           Lc 705]
 gi|257150632|emb|CAR89604.1| Holliday junction resolvase [Lactobacillus rhamnosus Lc 705]
 gi|328469825|gb|EGF40739.1| Holliday junction resolvase-like protein [Lactobacillus rhamnosus
           MTCC 5462]
          Length = 144

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 81/135 (60%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLP 76
           +  +D+G++ +G+A+SDP    A     + + +   Q  L+ L   +T   + AF++GLP
Sbjct: 3   LMGLDVGSRTVGVAVSDPLGWTAQGLEIIRINEDKQQFGLKRLKELVTQYEVTAFVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQK 135
            NMN S GPR   ++A+  +++     +P  F DERLTTV A ++LI + + SRK++ Q 
Sbjct: 63  KNMNNSIGPRAEKSQAY-GDLLKETFGLPVDFIDERLTTVEASRMLIEEADASRKRQKQV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA +ILQ  LD
Sbjct: 122 IDKLAAQMILQNYLD 136


>gi|260881084|ref|ZP_05403565.2| putative holliday junction resolvase [Mitsuokella multacida DSM
           20544]
 gi|260849464|gb|EEX69471.1| putative holliday junction resolvase [Mitsuokella multacida DSM
           20544]
          Length = 138

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 74/132 (56%), Gaps = 4/132 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           S+D+G + IG+A+SD     A     + RK +      L   +      + + GLP NM+
Sbjct: 6   SLDIGDRTIGIAVSDLLGLTAQGVETIRRKSLADDLKRLGELMQAYETKSLVSGLPKNMD 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVY--VPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           G+EG R    + F+  +  +K Y  V   FWDERL+TV+A + LI+ +VSR+KR + +D 
Sbjct: 66  GTEGDRCAIVKEFMAEV--KKAYPDVEVFFWDERLSTVAATRSLIEADVSRRKRKKVIDK 123

Query: 139 IAAALILQEVLD 150
           +AA  ILQ  LD
Sbjct: 124 MAAVFILQGFLD 135


>gi|282856373|ref|ZP_06265652.1| RNAse YqgF [Pyramidobacter piscolens W5455]
 gi|282585744|gb|EFB91033.1| RNAse YqgF [Pyramidobacter piscolens W5455]
          Length = 140

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 70/132 (53%), Gaps = 2/132 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+GT RIG+A+SDP   FA      V K       EL       +    ++GLP+ 
Sbjct: 4   IICLDVGTVRIGVAVSDPLGMFAQG--IAVWKADGPWLDELERAFERYDTGCLLVGLPIR 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
            +G+ GP     +  V  +  R   V   +WDER +T +A   L++ NVSR+KR Q VD 
Sbjct: 62  EDGTIGPSAQHVQDVVKEIQRRFPMVTVRYWDERYSTCTATSYLLEGNVSRRKRKQSVDK 121

Query: 139 IAAALILQEVLD 150
           IAAA+ILQ  +D
Sbjct: 122 IAAAVILQSYMD 133


>gi|199598089|ref|ZP_03211512.1| Holliday junction resolvase-like protein [Lactobacillus rhamnosus
           HN001]
 gi|258507765|ref|YP_003170516.1| Holliday junction resolvase-like protein [Lactobacillus rhamnosus
           GG]
 gi|199591015|gb|EDY99098.1| Holliday junction resolvase-like protein [Lactobacillus rhamnosus
           HN001]
 gi|257147692|emb|CAR86665.1| Holliday junction resolvase [Lactobacillus rhamnosus GG]
 gi|259649112|dbj|BAI41274.1| holliday junction resolvase-like protein [Lactobacillus rhamnosus
           GG]
          Length = 144

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 81/135 (60%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLP 76
           +  +D+G++ +G+A+SDP    A     + + +   Q  L+ L   +T   + AF++GLP
Sbjct: 3   LMGLDVGSRTVGVAVSDPLGWTAQGLEIIRINEDKQQFGLKRLKELVTQYEVTAFVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQK 135
            NMN S GPR   ++A+  +++     +P  F DERLTTV A ++LI + + SRK++ Q 
Sbjct: 63  KNMNNSIGPRAEKSQAY-GDLLKETFGLPVDFIDERLTTVEASRMLIEEADASRKRQKQV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA +ILQ  LD
Sbjct: 122 IDKLAAQMILQNYLD 136


>gi|313896256|ref|ZP_07829809.1| RNAse H domain protein, YqgF family [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|312975055|gb|EFR40517.1| RNAse H domain protein, YqgF family [Selenomonas sp. oral taxon 137
           str. F0430]
          Length = 142

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 71/131 (54%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           S+D+G   IG+A+SD     A     + R         L + +    + A + GLP +MN
Sbjct: 6   SLDIGDVTIGIAVSDLLGLTAQGVETIRRTTPAADFERLGTLMRDYEVDALVAGLPKHMN 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EG R    RAF+     R   V   +WDERL+TV+A + L++ +VSRKKR + +D +A
Sbjct: 66  GDEGTRCEMVRAFMAEAAQRFPGVKIHYWDERLSTVAATRTLLEGDVSRKKRRKVIDKMA 125

Query: 141 AALILQEVLDR 151
           A  ILQ  LDR
Sbjct: 126 AVYILQGFLDR 136


>gi|282889573|ref|ZP_06298114.1| hypothetical protein pah_c002o006 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281500496|gb|EFB42774.1| hypothetical protein pah_c002o006 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 155

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (54%), Gaps = 8/139 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLSFITTEN------IAAF 71
           I S+D G  RIG+AISD  +  A   +     KKV +T  +L+  I          I   
Sbjct: 9   IVSLDYGLARIGIAISDESQTIASSLKTVAAEKKVERTVAKLVEEINAHQQRLACEIEEI 68

Query: 72  IIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           ++GLPL M+G +G +      FV  +      +P V WDERLTTV A++ L + + +RKK
Sbjct: 69  VVGLPLLMSGKKGFQADEVLHFVE-LFKAATPIPIVTWDERLTTVQAERALREGSFNRKK 127

Query: 132 RIQKVDSIAAALILQEVLD 150
           R + +D++AA LILQ  LD
Sbjct: 128 RSKVIDAVAAVLILQNYLD 146


>gi|332704470|ref|ZP_08424558.1| Holliday junction resolvase [Desulfovibrio africanus str. Walvis
           Bay]
 gi|332554619|gb|EGJ51663.1| Holliday junction resolvase [Desulfovibrio africanus str. Walvis
           Bay]
          Length = 163

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 67/136 (49%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           N  +  ID G KR+GLA++D G R A PRP L R        E+      E + A ++GL
Sbjct: 28  NVRLLGIDFGLKRVGLALTDEGGRMAFPRPALARTSNDALIAEIGRMAAEEKVEAVVLGL 87

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P+ M+G E       R      I  K  +     DERLT+  AQ  L +  VS KK   K
Sbjct: 88  PIAMDGEETDLSRQVRNLARK-ITSKTGLKVHLMDERLTSAEAQARLREAGVSSKKMKGK 146

Query: 136 VDSIAAALILQEVLDR 151
           +DS AA LIL+  L R
Sbjct: 147 LDSGAAVLILEAYLGR 162


>gi|317471885|ref|ZP_07931220.1| hypothetical protein HMPREF1011_01569 [Anaerostipes sp. 3_2_56FAA]
 gi|316900658|gb|EFV22637.1| hypothetical protein HMPREF1011_01569 [Anaerostipes sp. 3_2_56FAA]
          Length = 138

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 78/135 (57%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D GTK +G+A+SD     A P   + RK   K+ +T   +   +    +   ++G 
Sbjct: 3   ILGLDYGTKTVGVALSDELGITAQPFETITRKDENKLRKTYARIEEIVAEYKVEKIVLGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R  +T AF  +++ R+  +  + WDERL+TV++ ++L++  V R+ R + 
Sbjct: 63  PKNMNNTIGERGMATEAFRDSLV-RRTGLDVILWDERLSTVASNKVLMESGVRREHRKKV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA++ILQ  LD
Sbjct: 122 IDQVAASMILQGYLD 136


>gi|89101195|ref|ZP_01174025.1| Holliday junction resolvase-like protein [Bacillus sp. NRRL
           B-14911]
 gi|89084081|gb|EAR63252.1| Holliday junction resolvase-like protein [Bacillus sp. NRRL
           B-14911]
          Length = 111

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/93 (41%), Positives = 65/93 (69%), Gaps = 1/93 (1%)

Query: 58  ELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVS 117
           +L   I   +++  ++GLP NMNG+ GPR  +++ F   + +R   +P V WDERLTT++
Sbjct: 17  QLGKIIKEYDVSTIVVGLPKNMNGTIGPRGEASQFFAGEL-ERLFGLPVVLWDERLTTMA 75

Query: 118 AQQILIDMNVSRKKRIQKVDSIAAALILQEVLD 150
           A+++L++ +VSRKKR + +D +AA++ILQ  LD
Sbjct: 76  AERVLLEADVSRKKRKKVIDKMAASMILQGYLD 108


>gi|169829318|ref|YP_001699476.1| putative Holliday junction resolvase [Lysinibacillus sphaericus
           C3-41]
 gi|168993806|gb|ACA41346.1| Putative Holliday junction resolvase [Lysinibacillus sphaericus
           C3-41]
          Length = 135

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 79/132 (59%), Gaps = 3/132 (2%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +D+G+K +G+A+SD  G          + +   +  ++ ++ +  E  I  F++G P N
Sbjct: 2   GLDVGSKTVGVAVSDALGWTAQGIETVKIDEANGEFGIDRIAELVKEYAITQFVVGFPTN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MN + GPR  ++  +   +++    +P   WDERLTT++A+++LI+ +VSR+KR Q +D 
Sbjct: 62  MNNTVGPRGEASENY-KKLLEETFSLPVTLWDERLTTMAAERMLIEADVSRRKRKQVIDK 120

Query: 139 IAAALILQEVLD 150
           +AA +I+Q  LD
Sbjct: 121 MAAVMIVQGYLD 132


>gi|291548156|emb|CBL21264.1| conserved hypothetical protein TIGR00250 [Ruminococcus sp. SR1/5]
          Length = 150

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           +  +D G+K +G+A+SDP    A     + RK   K+ +T   +   I+   +   ++G 
Sbjct: 3   VLGLDYGSKTVGVAVSDPLGLTAQGVETVWRKQENKLRRTLARIEEIISEYQVTEIVLGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R   +  F   M++++  +P V WDERLTT++A + L +  V ++ R Q 
Sbjct: 63  PKNMNNTVGERAEKSLEF-KEMLEKRTGLPVVMWDERLTTMAADRTLEETGVHKEDRKQY 121

Query: 136 VDSIAAALILQEVLDRISF 154
           +D +AA  ILQ  LD  ++
Sbjct: 122 LDQVAAVFILQGYLDAAAY 140


>gi|148380517|ref|YP_001255058.1| hypothetical protein CBO2562 [Clostridium botulinum A str. ATCC
           3502]
 gi|153933531|ref|YP_001384804.1| Holliday junction resolvase-like protein [Clostridium botulinum A
           str. ATCC 19397]
 gi|153935898|ref|YP_001388274.1| Holliday junction resolvase-like protein [Clostridium botulinum A
           str. Hall]
 gi|153940927|ref|YP_001391859.1| Holliday junction resolvase-like protein [Clostridium botulinum F
           str. Langeland]
 gi|168180549|ref|ZP_02615213.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum
           NCTC 2916]
 gi|168182640|ref|ZP_02617304.1| RNAse H-fold protein YqgF [Clostridium botulinum Bf]
 gi|170757368|ref|YP_001782177.1| Holliday junction resolvase-like protein [Clostridium botulinum B1
           str. Okra]
 gi|170760496|ref|YP_001787880.1| Holliday junction resolvase-like protein [Clostridium botulinum A3
           str. Loch Maree]
 gi|226949917|ref|YP_002805008.1| hypothetical protein TIGR00250 [Clostridium botulinum A2 str.
           Kyoto]
 gi|237796000|ref|YP_002863552.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum Ba4
           str. 657]
 gi|167012712|sp|A7FWJ3|RUVX_CLOB1 RecName: Full=Putative Holliday junction resolvase
 gi|167012713|sp|A5I4Z3|RUVX_CLOBH RecName: Full=Putative Holliday junction resolvase
 gi|167012714|sp|A7GGE9|RUVX_CLOBL RecName: Full=Putative Holliday junction resolvase
 gi|226725504|sp|B1IJG5|RUVX_CLOBK RecName: Full=Putative Holliday junction resolvase
 gi|226725505|sp|B1KXB5|RUVX_CLOBM RecName: Full=Putative Holliday junction resolvase
 gi|254767507|sp|C1FTB8|RUVX_CLOBJ RecName: Full=Putative Holliday junction resolvase
 gi|259495699|sp|C3L148|RUVX_CLOB6 RecName: Full=Putative Holliday junction resolvase
 gi|148290001|emb|CAL84120.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC
           3502]
 gi|152929575|gb|ABS35075.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum A
           str. ATCC 19397]
 gi|152931812|gb|ABS37311.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum A
           str. Hall]
 gi|152936823|gb|ABS42321.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum F
           str. Langeland]
 gi|169122580|gb|ACA46416.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum B1
           str. Okra]
 gi|169407485|gb|ACA55896.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum A3
           str. Loch Maree]
 gi|182668482|gb|EDT80461.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum
           NCTC 2916]
 gi|182674156|gb|EDT86117.1| RNAse H-fold protein YqgF [Clostridium botulinum Bf]
 gi|226841351|gb|ACO84017.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum A2
           str. Kyoto]
 gi|229261948|gb|ACQ52981.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum Ba4
           str. 657]
 gi|295319884|gb|ADG00262.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum F
           str. 230613]
          Length = 137

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 76/136 (55%), Gaps = 3/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPL 77
           I  +D+G + IG+AISDP   F       +R+K     LE +  I  +  +   + GLP 
Sbjct: 3   ILGLDIGDRTIGIAISDP-LGFTAQGITTIRRKSEAYDLEEIKKICDKYEVDTIVSGLPK 61

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMNG+ GP+      F  ++I   + +    WDERLTTV+A + +++ ++SR KR + VD
Sbjct: 62  NMNGTLGPQSEKVLEFC-DLIKEHLNIEIKMWDERLTTVAATRAMLEADLSRSKRKKIVD 120

Query: 138 SIAAALILQEVLDRIS 153
            +AA  ILQ  LD +S
Sbjct: 121 KVAATYILQGYLDSLS 136


>gi|91205622|ref|YP_537977.1| Holliday junction resolvase-like protein [Rickettsia bellii
           RML369-C]
 gi|157827335|ref|YP_001496399.1| Holliday junction resolvase-like protein [Rickettsia bellii OSU
           85-389]
 gi|146325604|sp|Q1RIC6|RUVX_RICBR RecName: Full=Putative Holliday junction resolvase
 gi|167012755|sp|A8GU80|RUVX_RICB8 RecName: Full=Putative Holliday junction resolvase
 gi|91069166|gb|ABE04888.1| Putative endonuclease [Rickettsia bellii RML369-C]
 gi|157802639|gb|ABV79362.1| Holliday junction resolvase-like protein [Rickettsia bellii OSU
           85-389]
          Length = 154

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 78/150 (52%), Gaps = 1/150 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           +++  + L PN P+ SID G+K+IG+AIS+  R  A P   +           LL  I  
Sbjct: 6   LQEFYRLLLPNAPLISIDYGSKKIGIAISNQERNIAMPLNIITEASKKAIIASLLEKIEQ 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
                 +IGLP++M+G +  +      F   +  + + +P    DERLTT +A   L   
Sbjct: 66  YKACGIVIGLPIDMSGMQTEQSAIVIKFAEEL-TKSINLPIYLQDERLTTKAANNFLKSF 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            + RK+R    D++AA++IL+ VL+ I+ L
Sbjct: 125 GIKRKERNNNDDAVAASMILETVLNSINKL 154


>gi|227529702|ref|ZP_03959751.1| crossover junction endodeoxyribonuclease [Lactobacillus vaginalis
           ATCC 49540]
 gi|227350368|gb|EEJ40659.1| crossover junction endodeoxyribonuclease [Lactobacillus vaginalis
           ATCC 49540]
          Length = 147

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 80/134 (59%), Gaps = 3/134 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +D+G+K +G+A+SDP    A     + + +      ++ ++ I  +  +A F++GLP N
Sbjct: 5   GLDVGSKTVGIAVSDPLGWTAQAVEIIPINEDEEIFGIDRVAEIVKQRQVAGFVVGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQKVD 137
           MN +EGPRV ++  +   +  R   +P  F DERLTTV A ++L+ + ++SR K+ + +D
Sbjct: 65  MNNTEGPRVEASHHYGELLKKRFPSIPVDFQDERLTTVEAHRMLVEEADISRAKQKKVID 124

Query: 138 SIAAALILQEVLDR 151
            +AA  ILQ  LDR
Sbjct: 125 EVAATFILQSYLDR 138


>gi|332654093|ref|ZP_08419837.1| putative Holliday junction resolvase [Ruminococcaceae bacterium
           D16]
 gi|332517179|gb|EGJ46784.1| putative Holliday junction resolvase [Ruminococcaceae bacterium
           D16]
          Length = 140

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 68/132 (51%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + +ID G    G+AISDP    A     +  +K      EL   +    +   ++G P N
Sbjct: 3   VMAIDYGDAHTGVAISDPTGFLAGMTTTIHSRKAEVVLSELARLVKEHQVDQLVMGFPRN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+G+EGPR    R F   +       P V WDER TTV A +IL +   + KKR + VD+
Sbjct: 63  MDGTEGPRAQLYRDFAAQVAQATGLEP-VLWDERRTTVDAHRILAEGGKNAKKRKKTVDA 121

Query: 139 IAAALILQEVLD 150
           +AA+LIL+  LD
Sbjct: 122 VAASLILEGYLD 133


>gi|322806899|emb|CBZ04469.1| putative Holliday junction resolvase [Clostridium botulinum H04402
           065]
          Length = 137

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 76/136 (55%), Gaps = 3/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPL 77
           I  +D+G + IG+AISDP   F       +R+K     LE +  I  +  +   + GLP 
Sbjct: 3   ILGLDIGDRTIGIAISDP-LGFTAQGITTIRRKSEAYDLEEIKKICDKYEVDTIVSGLPK 61

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMNG+ GP+      F  ++I   + +    WDERLTTV+A + +++ ++SR KR + VD
Sbjct: 62  NMNGTLGPQSEKVLEFC-DLIKEHLNIEIKMWDERLTTVAATRAMLEADLSRSKRKKIVD 120

Query: 138 SIAAALILQEVLDRIS 153
            +AA  ILQ  LD +S
Sbjct: 121 KVAATYILQGYLDSLS 136


>gi|229553800|ref|ZP_04442525.1| crossover junction endodeoxyribonuclease [Lactobacillus rhamnosus
           LMS2-1]
 gi|229312823|gb|EEN78796.1| crossover junction endodeoxyribonuclease [Lactobacillus rhamnosus
           LMS2-1]
          Length = 144

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 80/135 (59%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTAL-ELLSFITTENIAAFIIGLP 76
           +  +D+G++ +G+A+SDP    A     + + +   Q  L  L   +T   + AF++GLP
Sbjct: 3   LMGLDVGSRTVGVAVSDPLGWTAQGLEIIRINEDKQQFGLTRLKELVTQYEVTAFVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQK 135
            NMN S GPR   ++A+  +++     +P  F DERLTTV A ++LI + + SRK++ Q 
Sbjct: 63  KNMNNSIGPRAEKSQAY-GDLLKETFGLPVDFIDERLTTVEASRMLIEEADASRKRQKQV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA +ILQ  LD
Sbjct: 122 IDKLAAQMILQNYLD 136


>gi|227874508|ref|ZP_03992680.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Oribacterium sinus F0268]
 gi|227839652|gb|EEJ50110.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Oribacterium sinus F0268]
          Length = 141

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 78/134 (58%), Gaps = 4/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I ++D G+K +GLAI+DP      P   + R+   K+ +T  E+        +   ++G 
Sbjct: 3   ILALDYGSKTVGLAITDPLGIIVQPLKTIWREREGKLRKTVEEIQETCKEYQVEELVLGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +M+GSEG RV    AF   M+ +K+ +P   +DERL+T+ A++IL +  V + ++ + 
Sbjct: 63  PCHMDGSEGERVERVLAF-QEMLKKKIELPIHLYDERLSTMEAEEILRENGVPKDRQKEV 121

Query: 136 VDSIAAALILQEVL 149
           +D +AA +IL++ L
Sbjct: 122 LDQVAAQVILEDYL 135


>gi|255655297|ref|ZP_05400706.1| putative holliday junction resolvase [Clostridium difficile
           QCD-23m63]
 gi|296451281|ref|ZP_06893021.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Clostridium difficile NAP08]
 gi|296880367|ref|ZP_06904330.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Clostridium difficile NAP07]
 gi|296259887|gb|EFH06742.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Clostridium difficile NAP08]
 gi|296428608|gb|EFH14492.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Clostridium difficile NAP07]
          Length = 141

 Score = 84.3 bits (207), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+A+SD     A     + R    +   EL + I  + +   + GLP N
Sbjct: 6   IMGLDVGDKTIGVAVSDLMGLTAQGVKTIKRVGKKKDIEELKAIIKEKQVNKIVSGLPKN 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP+      F   ++  +  +   FWDERL+TV+A++ L++ +VSR+KR + +D 
Sbjct: 66  MNGTLGPQGEKVIKFCE-LVKEETGIDVEFWDERLSTVAAERSLLEADVSRQKRKKVIDM 124

Query: 139 IAAALILQEVLD 150
           +AA +ILQ  LD
Sbjct: 125 LAAVIILQGYLD 136


>gi|317495258|ref|ZP_07953628.1| hypothetical protein HMPREF0432_00230 [Gemella moribillum M424]
 gi|316914680|gb|EFV36156.1| hypothetical protein HMPREF0432_00230 [Gemella moribillum M424]
          Length = 141

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 79/138 (57%), Gaps = 2/138 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFII 73
           ++ I  +D G+K IG+A+SD  G          + ++V    ++ +  +  E NI   ++
Sbjct: 3   DKRIMGLDYGSKTIGVAVSDLLGMTAQGVETININEQVKDFKIKRIKELVNEYNIGKIVV 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NM+ S G R  +T  FV  +  +   V  +  DERLTT+ A+++L++ NVSRKKR 
Sbjct: 63  GLPKNMDNSIGFRGEATLYFVEVLKKKIKSVEVILQDERLTTMGAERVLLEANVSRKKRK 122

Query: 134 QKVDSIAAALILQEVLDR 151
             +D +AA LILQ  LD+
Sbjct: 123 DVIDKMAAVLILQTYLDK 140


>gi|19746980|ref|NP_608116.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS8232]
 gi|28896707|ref|NP_803057.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           SSI-1]
 gi|50915141|ref|YP_061113.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS10394]
 gi|71904442|ref|YP_281245.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS6180]
 gi|94989437|ref|YP_597538.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS9429]
 gi|94993326|ref|YP_601425.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS2096]
 gi|94995284|ref|YP_603382.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS10750]
 gi|139474553|ref|YP_001129269.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           str. Manfredo]
 gi|306826480|ref|ZP_07459791.1| crossover junction endodeoxyribonuclease [Streptococcus pyogenes
           ATCC 10782]
 gi|54039589|sp|P67495|RUVX_STRP8 RecName: Full=Putative Holliday junction resolvase
 gi|54042293|sp|P67494|RUVX_STRP3 RecName: Full=Putative Holliday junction resolvase
 gi|62900945|sp|Q5X9I3|RUVX_STRP6 RecName: Full=Putative Holliday junction resolvase
 gi|118597224|sp|Q1J498|RUVX_STRPF RecName: Full=Putative Holliday junction resolvase
 gi|146325612|sp|Q1J9D0|RUVX_STRPB RecName: Full=Putative Holliday junction resolvase
 gi|146325613|sp|Q1JJH9|RUVX_STRPC RecName: Full=Putative Holliday junction resolvase
 gi|146325614|sp|Q48QX0|RUVX_STRPM RecName: Full=Putative Holliday junction resolvase
 gi|167016512|sp|A2RGU5|RUVX_STRPG RecName: Full=Putative Holliday junction resolvase
 gi|19749234|gb|AAL98615.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232]
 gi|28811961|dbj|BAC64890.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1]
 gi|50904215|gb|AAT87930.1| Endonuclease involved in recombination [Streptococcus pyogenes
           MGAS10394]
 gi|71803537|gb|AAX72890.1| hypothetical protein M28_Spy1780 [Streptococcus pyogenes MGAS6180]
 gi|94542945|gb|ABF32994.1| endonuclease involved in recombination [Streptococcus pyogenes
           MGAS9429]
 gi|94546834|gb|ABF36881.1| Endonuclease involved in recombination [Streptococcus pyogenes
           MGAS2096]
 gi|94548792|gb|ABF38838.1| Endonuclease involved in recombination [Streptococcus pyogenes
           MGAS10750]
 gi|134272800|emb|CAM31077.1| putative Holliday junction resolvase [Streptococcus pyogenes str.
           Manfredo]
 gi|304431339|gb|EFM34337.1| crossover junction endodeoxyribonuclease [Streptococcus pyogenes
           ATCC 10782]
          Length = 139

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 80/139 (57%), Gaps = 10/139 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFII 73
           I  +D+G+K +G+AISDP    A     +   K+ +   E     L   +    +  F+I
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEII---KIDEEKAEFGFTRLEELVKQYQVEQFVI 59

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
           GLP NMN + GPRV ++  +  N I+    +P  + DERLTTV A+++LI+  ++SR KR
Sbjct: 60  GLPKNMNNTNGPRVDASITY-GNHIEHLFGLPVHYQDERLTTVEAERMLIEQADISRGKR 118

Query: 133 IQKVDSIAAALILQEVLDR 151
            + +D +AA LILQ  L+R
Sbjct: 119 KKVIDKLAAQLILQNYLNR 137


>gi|304436654|ref|ZP_07396623.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304370350|gb|EFM24006.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 143

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 70/131 (53%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           S+DLG   IG+A+SD     A     + R  +      L   +    + A + GLP +MN
Sbjct: 6   SLDLGDATIGVAVSDLLGLTAQGVETVRRTTLEADIARLGQLMQEYEVDALVAGLPKHMN 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EG R    RAF+  + +        +WDERL+TV+A + LI  +VSRKKR + +D +A
Sbjct: 66  GDEGERCSIVRAFMAKVEEHFPRTEVHYWDERLSTVAASRALIAGDVSRKKRRKVIDKMA 125

Query: 141 AALILQEVLDR 151
           A  ILQ  LDR
Sbjct: 126 AVYILQGFLDR 136


>gi|307702671|ref|ZP_07639623.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037]
 gi|307623787|gb|EFO02772.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037]
          Length = 136

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 81/134 (60%), Gaps = 4/134 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLPLN 78
            +D+G+K +G+AISDP    A     + + +   Q   + +   +    +  F++GLP N
Sbjct: 2   GLDVGSKTVGVAISDPLGFTAQGLEIIQINEDQGQFGFDRIKELVDIYKVERFVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKVD 137
           MN + GPRV +++A+   + +    +P  + DERLTTV+A+++LI+  ++SR KR + +D
Sbjct: 62  MNNTSGPRVEASQAYGAKL-EELFGLPVDYQDERLTTVAAERMLIEQADISRNKRKKVID 120

Query: 138 SIAAALILQEVLDR 151
            +AA LILQ  LDR
Sbjct: 121 KLAAQLILQNYLDR 134


>gi|297621335|ref|YP_003709472.1| Putative Holliday junction resolvase [Waddlia chondrophila WSU
           86-1044]
 gi|297376636|gb|ADI38466.1| Putative Holliday junction resolvase [Waddlia chondrophila WSU
           86-1044]
          Length = 148

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 73/139 (52%), Gaps = 8/139 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLSFITTEN------IAAF 71
           I  ID G KRIGLAISD     A     F   KK+ +T   L+  +          +   
Sbjct: 5   IIGIDYGMKRIGLAISDETHLIASAIETFEASKKMEETVAALVKRLEEHQKEKGYELKEI 64

Query: 72  IIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           ++G PL MNG  G        F   +  + + +P + WDERLT+V A++ +++ + +RKK
Sbjct: 65  VVGFPLKMNGKAGFISDEVTLFAETL-SKALSIPIIKWDERLTSVQAERAMMEGSYNRKK 123

Query: 132 RIQKVDSIAAALILQEVLD 150
           R +K+D I+A +ILQ  LD
Sbjct: 124 RTKKLDQISAVIILQNYLD 142


>gi|241890070|ref|ZP_04777368.1| putative Holliday junction resolvase [Gemella haemolysans ATCC
           10379]
 gi|241863692|gb|EER68076.1| putative Holliday junction resolvase [Gemella haemolysans ATCC
           10379]
          Length = 142

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 81/140 (57%), Gaps = 2/140 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFII 73
           ++ I  +D G+K IG+A+SD  G          + ++V    ++ +  +  E N+   ++
Sbjct: 3   DKRIMGLDYGSKTIGVAVSDLLGFTAQGIETININEQVKDFKIKRIKELVQEHNVGTIVV 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NM+ S G R  +T  FV  +  +   V  +  DERLTT+ A+++L++ NVSRKKR 
Sbjct: 63  GLPKNMDNSVGFRGEATLYFVEVLKKKIKNVEIILQDERLTTMGAERVLLEANVSRKKRK 122

Query: 134 QKVDSIAAALILQEVLDRIS 153
             +D +AA LILQ  LD+++
Sbjct: 123 NVIDKMAAVLILQTYLDKLN 142


>gi|302385313|ref|YP_003821135.1| Holliday junction resolvase YqgF [Clostridium saccharolyticum WM1]
 gi|302195941|gb|ADL03512.1| Holliday junction resolvase YqgF [Clostridium saccharolyticum WM1]
          Length = 146

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 72/135 (53%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+A+SD     A     + R+   K+ +T   +   I    I   I+G 
Sbjct: 3   IMGLDYGSKTVGVAVSDLLGITAQGVETITREEENKLRKTCARIEELIREYEIETIILGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN S G R   T  F   M+ R+  +  + WDERLTTV++++IL +  V R+ R   
Sbjct: 63  PKNMNNSAGQRAEKTEQF-KEMLIRRTGLNVILWDERLTTVASERILQESGVRREHRKAV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA LILQ  LD
Sbjct: 122 IDQVAAGLILQGYLD 136


>gi|154500404|ref|ZP_02038442.1| hypothetical protein BACCAP_04071 [Bacteroides capillosus ATCC
           29799]
 gi|150270909|gb|EDM98192.1| hypothetical protein BACCAP_04071 [Bacteroides capillosus ATCC
           29799]
          Length = 139

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 66/133 (49%), Gaps = 1/133 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G  R G+AISDP    A     +  +K    A E+   +    +   ++G P N
Sbjct: 3   IMAIDYGDARTGIAISDPTGLLAGYTTVIHSRKSEVVAEEIARLVKEHGVEELVMGFPRN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+G+EGPR    RAF   +       P V WDER TTV A  IL       K+  + VD+
Sbjct: 63  MDGTEGPRAELYRAFAQQVGQVTGLTP-VLWDERRTTVEAHNILHASGKRMKQHKKTVDA 121

Query: 139 IAAALILQEVLDR 151
           +AA LIL+  L R
Sbjct: 122 VAATLILEGYLTR 134


>gi|187778852|ref|ZP_02995325.1| hypothetical protein CLOSPO_02447 [Clostridium sporogenes ATCC
           15579]
 gi|187772477|gb|EDU36279.1| hypothetical protein CLOSPO_02447 [Clostridium sporogenes ATCC
           15579]
          Length = 137

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 76/136 (55%), Gaps = 3/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPL 77
           I  +D+G + IG+A+SDP   F       +R+K     LE +  I  +  +   + GLP 
Sbjct: 3   ILGLDIGDRTIGVALSDP-LGFTAQGITTIRRKSEAYDLEEIKKICDKYEVDTIVSGLPK 61

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMNG+ GP+      F  ++I   V +    WDERLTTV+A + +++ ++SR KR + VD
Sbjct: 62  NMNGTLGPQSEKVLEFC-DLIKEHVNIEIKMWDERLTTVAATRAMLEADLSRSKRKKIVD 120

Query: 138 SIAAALILQEVLDRIS 153
            +AA  ILQ  LD +S
Sbjct: 121 KMAATYILQGYLDSLS 136


>gi|77408149|ref|ZP_00784895.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           COH1]
 gi|77173249|gb|EAO76372.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           COH1]
          Length = 136

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 82/135 (60%), Gaps = 4/135 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +D+G+K +G+AISDP    A     + + ++      + L+ +  E  +  F++GLP N
Sbjct: 2   GLDVGSKTVGVAISDPLGFTAQGLEIIKIDEESGNFGFDRLAELVKEYKVDKFVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKVD 137
           MN + GPRV +++ +  + I     +P  + DERLTTV A+++L++  ++SR KR + +D
Sbjct: 62  MNNTSGPRVEASQVY-GDKITELFNLPVEYQDERLTTVQAERMLVEQADISRGKRKKVID 120

Query: 138 SIAAALILQEVLDRI 152
            +AA LILQ  LDR+
Sbjct: 121 KLAAQLILQNYLDRM 135


>gi|317131029|ref|YP_004090343.1| Holliday junction resolvase YqgF [Ethanoligenens harbinense YUAN-3]
 gi|315469008|gb|ADU25612.1| Holliday junction resolvase YqgF [Ethanoligenens harbinense YUAN-3]
          Length = 143

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 68/134 (50%), Gaps = 1/134 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + ++D G  R G+A+SDP    A P   +     TQ   +    +        ++GLP N
Sbjct: 3   VMAVDYGDARTGIALSDPSGFLASPVCVIHETDETQILAKTAEQVARTGAERVVVGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GPR    +AF    ++    VP + +DER TT++AQ      N   KKR   +D+
Sbjct: 63  MNGTLGPRAEKAQAFAK-ALEAACGVPVLLFDERRTTLTAQVYFNATNTRGKKRKNSIDA 121

Query: 139 IAAALILQEVLDRI 152
            AA +ILQ+ LD +
Sbjct: 122 AAATIILQDYLDSV 135


>gi|205374237|ref|ZP_03227036.1| Holliday junction resolvase-like protein [Bacillus coahuilensis
           m4-4]
          Length = 138

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 81/135 (60%), Gaps = 3/135 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+GT+ +G+A+SD  G          + +++     E +  +  E  ++  ++GLP
Sbjct: 3   IMGLDVGTRTVGVAVSDAFGWTAQGIETIKIHEELGFLGYERIKELVKEYEVSKIVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMN + GPR  +++ +   + + K  +P  ++DERLTT+ A+++LI+ +VSR KR + +
Sbjct: 63  KNMNNTMGPRGEASQRYGEGLRE-KFGIPVDYYDERLTTMQAERVLIEADVSRGKRKKVI 121

Query: 137 DSIAAALILQEVLDR 151
           D +AA +ILQ  LDR
Sbjct: 122 DKMAAVMILQGYLDR 136


>gi|283770690|ref|ZP_06343582.1| Holliday junction resolvase [Staphylococcus aureus subsp. aureus
           H19]
 gi|283460837|gb|EFC07927.1| Holliday junction resolvase [Staphylococcus aureus subsp. aureus
           H19]
          Length = 142

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 81/138 (58%), Gaps = 2/138 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTAL-ELLSFITTENIAAFIIG 74
             I  +D+G++ +G+AISD     A     L + ++  +  + +L+  I   N++  +IG
Sbjct: 4   HKILGLDVGSRTVGIAISDIMGWTAQGLDTLRINEENNELGIDQLVDIIKKHNVSTVVIG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN S G R  ++  +   +++    +  V WDERL+T++A++ L++ +VSR+KR Q
Sbjct: 64  LPKNMNNSIGFRGEASLTYKEKLLEAYPSIEIVMWDERLSTMAAERSLLEADVSRQKRKQ 123

Query: 135 KVDSIAAALILQEVLDRI 152
            +D +AA  ILQ  LD +
Sbjct: 124 VIDKMAAVFILQGYLDSL 141


>gi|210610063|ref|ZP_03288242.1| hypothetical protein CLONEX_00428 [Clostridium nexile DSM 1787]
 gi|210152674|gb|EEA83680.1| hypothetical protein CLONEX_00428 [Clostridium nexile DSM 1787]
          Length = 143

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 74/137 (54%), Gaps = 4/137 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           +  +D G+K +G+AISDP    A     + RK   K+ QT   +   +    +   ++G 
Sbjct: 3   VMGLDYGSKTVGVAISDPLGITAQGIETIHRKAENKLRQTLARIEELVKEYEVDKLVLGF 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MN + G R   +      M++R+  +P + WDERLTT+ A++ LI+  V R+ R + 
Sbjct: 63  PKHMNNTIGDRAEKSLEL-KAMLERRTGLPVIMWDERLTTLEAERTLIESKVRREDRKKY 121

Query: 136 VDSIAAALILQEVLDRI 152
           VD IAA  ILQ  LD I
Sbjct: 122 VDKIAAVFILQGYLDSI 138


>gi|331701290|ref|YP_004398249.1| Holliday junction resolvase [Lactobacillus buchneri NRRL B-30929]
 gi|329128633|gb|AEB73186.1| Holliday junction resolvase [Lactobacillus buchneri NRRL B-30929]
          Length = 144

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 79/136 (58%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           +  +D+G+K +G+A+SD  G          + +   +  L+ +S  +    +  F++GLP
Sbjct: 3   LMGLDVGSKTVGVAVSDQLGWTSQGVEIIRIDEDNKEFGLDRVSELVKKYQVDGFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQK 135
            NMN S GPR  +++ +   + D K  +P  F DERLTTV AQ++L  + +VSR KR + 
Sbjct: 63  KNMNNSLGPRAEASQQYGKRLED-KFNLPVDFEDERLTTVEAQRMLTEEADVSRAKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 122 IDKLAAGLILQNYLDR 137


>gi|329770531|ref|ZP_08261909.1| Holliday junction resolvase [Gemella sanguinis M325]
 gi|328836280|gb|EGF85949.1| Holliday junction resolvase [Gemella sanguinis M325]
          Length = 142

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 80/139 (57%), Gaps = 2/139 (1%)

Query: 17  QPIASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIG 74
           + I  +D G+K IG+A+SD  G          + +++    ++ +  +  E N+   I+G
Sbjct: 4   KRIMGLDYGSKTIGVAVSDLLGLTAQGIETININEQIKDFKIKRIKELVNEHNVGKIIVG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NM+ S G R  +T  FV  +  +   V  +  DERLTT+ A+++L++ NVSRKKR  
Sbjct: 64  LPKNMDNSIGFRGEATLYFVEVLKKKIKSVEIILQDERLTTMGAERVLLEANVSRKKRKN 123

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA LILQ  LD+++
Sbjct: 124 VIDKMAAVLILQTYLDKLN 142


>gi|82751216|ref|YP_416957.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           RF122]
 gi|146325611|sp|Q2YT62|RUVX_STAAB RecName: Full=Putative Holliday junction resolvase
 gi|82656747|emb|CAI81176.1| probable Holliday junction resolvase [Staphylococcus aureus RF122]
          Length = 142

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 80/138 (57%), Gaps = 2/138 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTAL-ELLSFITTENIAAFIIG 74
             I  +D+G++ +G+AISD     A     L + ++  +  + +L+  I   N+   +IG
Sbjct: 4   HKILGLDVGSRTVGIAISDIMGWTAQGLDTLRINEENNELGIDQLVDIIKKHNVGTVVIG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN S G R  ++  +   +++    +  V WDERL+T++A++ L++ +VSR+KR Q
Sbjct: 64  LPKNMNNSIGFRGEASLTYKEKLLEAYPSIEIVMWDERLSTMAAERSLLEADVSRQKRKQ 123

Query: 135 KVDSIAAALILQEVLDRI 152
            +D +AA  ILQ  LD +
Sbjct: 124 LIDKMAAVFILQGYLDSL 141


>gi|15675863|ref|NP_270037.1| Holliday junction resolvase-like protein [Streptococcus pyogenes M1
           GAS]
 gi|71911609|ref|YP_283159.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS5005]
 gi|32130060|sp|Q99XP4|RUVX_STRP1 RecName: Full=Putative Holliday junction resolvase
 gi|13623097|gb|AAK34758.1| conserved hypothetical protein [Streptococcus pyogenes M1 GAS]
 gi|71854391|gb|AAZ52414.1| endonuclease involved in recombination [Streptococcus pyogenes
           MGAS5005]
          Length = 139

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 80/139 (57%), Gaps = 10/139 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFII 73
           I  +D+G+K +G+AISDP    A     +   K+ +   E     L   +    +  F+I
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEII---KIDEEKAEFGFTRLEELVKQYQVEQFVI 59

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
           GLP NMN + GPRV ++  +  N I+    +P  + DERLTTV A+++LI+  ++SR KR
Sbjct: 60  GLPKNMNNTNGPRVDASITY-GNHIEHLFGLPVHYQDERLTTVEAKRMLIEQADISRGKR 118

Query: 133 IQKVDSIAAALILQEVLDR 151
            + +D +AA LILQ  L+R
Sbjct: 119 KKVIDKLAAQLILQNYLNR 137


>gi|21283295|ref|NP_646383.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus MW2]
 gi|49483861|ref|YP_041085.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus MRSA252]
 gi|49486449|ref|YP_043670.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus MSSA476]
 gi|57650498|ref|YP_186511.1| hypothetical protein SACOL1671 [Staphylococcus aureus subsp. aureus
           COL]
 gi|87160105|ref|YP_494268.1| hypothetical protein SAUSA300_1573 [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88195425|ref|YP_500229.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus NCTC 8325]
 gi|148268097|ref|YP_001247040.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus JH9]
 gi|150394165|ref|YP_001316840.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus JH1]
 gi|151221729|ref|YP_001332551.1| hypothetical protein NWMN_1517 [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|161509843|ref|YP_001575502.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus USA300_TCH1516]
 gi|221141114|ref|ZP_03565607.1| hypothetical protein SauraJ_05678 [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|253316599|ref|ZP_04839812.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus str. CF-Marseille]
 gi|253732271|ref|ZP_04866436.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus USA300_TCH959]
 gi|253733133|ref|ZP_04867298.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus TCH130]
 gi|255006401|ref|ZP_05145002.2| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus Mu50-omega]
 gi|257425741|ref|ZP_05602165.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus 55/2053]
 gi|257428401|ref|ZP_05604799.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257431039|ref|ZP_05607418.1| Holliday junction resolvase [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257433725|ref|ZP_05610083.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257436640|ref|ZP_05612684.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|257793691|ref|ZP_05642670.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|258411010|ref|ZP_05681290.1| Holliday junction resolvase [Staphylococcus aureus A9763]
 gi|258420188|ref|ZP_05683143.1| Holliday junction resolvase [Staphylococcus aureus A9719]
 gi|258424042|ref|ZP_05686924.1| conserved hypothetical protein [Staphylococcus aureus A9635]
 gi|258438190|ref|ZP_05689474.1| Holliday junction resolvase YqgF [Staphylococcus aureus A9299]
 gi|258443653|ref|ZP_05691992.1| Holliday junction resolvase YqgF [Staphylococcus aureus A8115]
 gi|258446860|ref|ZP_05695014.1| conserved hypothetical protein [Staphylococcus aureus A6300]
 gi|258448774|ref|ZP_05696886.1| Holliday junction resolvase YqgF [Staphylococcus aureus A6224]
 gi|258450557|ref|ZP_05698619.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|258453593|ref|ZP_05701571.1| Holliday junction resolvase YqgF [Staphylococcus aureus A5937]
 gi|269203242|ref|YP_003282511.1| hypothetical protein SAAV_1608 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282893119|ref|ZP_06301353.1| conserved hypothetical protein [Staphylococcus aureus A8117]
 gi|282904197|ref|ZP_06312085.1| putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus C160]
 gi|282906023|ref|ZP_06313878.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282908935|ref|ZP_06316753.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282911253|ref|ZP_06319055.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282914421|ref|ZP_06322207.1| putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus M899]
 gi|282916885|ref|ZP_06324643.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           D139]
 gi|282919391|ref|ZP_06327126.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C427]
 gi|282920163|ref|ZP_06327888.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|282924716|ref|ZP_06332384.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C101]
 gi|282928250|ref|ZP_06335855.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|283958377|ref|ZP_06375828.1| putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|284024673|ref|ZP_06379071.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus 132]
 gi|293503496|ref|ZP_06667343.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510513|ref|ZP_06669219.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M809]
 gi|293531053|ref|ZP_06671735.1| putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus M1015]
 gi|294848645|ref|ZP_06789391.1| hypothetical protein SKAG_00712 [Staphylococcus aureus A9754]
 gi|295406738|ref|ZP_06816543.1| hypothetical protein SMAG_01910 [Staphylococcus aureus A8819]
 gi|295428193|ref|ZP_06820825.1| hypothetical protein SIAG_00722 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|296276723|ref|ZP_06859230.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus MR1]
 gi|297207664|ref|ZP_06924099.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|297245680|ref|ZP_06929545.1| hypothetical protein SLAG_01773 [Staphylococcus aureus A8796]
 gi|297590840|ref|ZP_06949478.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus MN8]
 gi|300911746|ref|ZP_07129189.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|304380787|ref|ZP_07363454.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus ATCC BAA-39]
 gi|54039586|sp|P67490|RUVX_STAAN RecName: Full=Putative Holliday junction resolvase
 gi|54039587|sp|P67491|RUVX_STAAW RecName: Full=Putative Holliday junction resolvase
 gi|54042291|sp|P67489|RUVX_STAAM RecName: Full=Putative Holliday junction resolvase
 gi|62900903|sp|Q5HFE6|RUVX_STAAC RecName: Full=Putative Holliday junction resolvase
 gi|62900976|sp|Q6G8V3|RUVX_STAAS RecName: Full=Putative Holliday junction resolvase
 gi|62900977|sp|Q6GG87|RUVX_STAAR RecName: Full=Putative Holliday junction resolvase
 gi|146325609|sp|Q2FGB0|RUVX_STAA3 RecName: Full=Putative Holliday junction resolvase
 gi|146325610|sp|Q2FXW1|RUVX_STAA8 RecName: Full=Putative Holliday junction resolvase
 gi|172048919|sp|A6QHF7|RUVX_STAAE RecName: Full=Putative Holliday junction resolvase
 gi|189046106|sp|A6U285|RUVX_STAA2 RecName: Full=Putative Holliday junction resolvase
 gi|189046107|sp|A5ITE1|RUVX_STAA9 RecName: Full=Putative Holliday junction resolvase
 gi|189046108|sp|A8Z4F4|RUVX_STAAT RecName: Full=Putative Holliday junction resolvase
 gi|21204735|dbj|BAB95431.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49241990|emb|CAG40687.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49244892|emb|CAG43353.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57284684|gb|AAW36778.1| conserved hypothetical protein TIGR00250 [Staphylococcus aureus
           subsp. aureus COL]
 gi|87126079|gb|ABD20593.1| conserved hypothetical protein TIGR00250 [Staphylococcus aureus
           subsp. aureus USA300_FPR3757]
 gi|87202983|gb|ABD30793.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|147741166|gb|ABQ49464.1| Holliday junction resolvase YqgF [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149946617|gb|ABR52553.1| Holliday junction resolvase YqgF [Staphylococcus aureus subsp.
           aureus JH1]
 gi|150374529|dbj|BAF67789.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|160368652|gb|ABX29623.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus USA300_TCH1516]
 gi|253724060|gb|EES92789.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus USA300_TCH959]
 gi|253728889|gb|EES97618.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus TCH130]
 gi|257271435|gb|EEV03581.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus 55/2053]
 gi|257275242|gb|EEV06729.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257278242|gb|EEV08884.1| Holliday junction resolvase [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257281818|gb|EEV11955.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257283991|gb|EEV14114.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|257787663|gb|EEV26003.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|257840160|gb|EEV64624.1| Holliday junction resolvase [Staphylococcus aureus A9763]
 gi|257843899|gb|EEV68293.1| Holliday junction resolvase [Staphylococcus aureus A9719]
 gi|257845663|gb|EEV69695.1| conserved hypothetical protein [Staphylococcus aureus A9635]
 gi|257848234|gb|EEV72225.1| Holliday junction resolvase YqgF [Staphylococcus aureus A9299]
 gi|257851059|gb|EEV75002.1| Holliday junction resolvase YqgF [Staphylococcus aureus A8115]
 gi|257854435|gb|EEV77384.1| conserved hypothetical protein [Staphylococcus aureus A6300]
 gi|257858052|gb|EEV80941.1| Holliday junction resolvase YqgF [Staphylococcus aureus A6224]
 gi|257861715|gb|EEV84514.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|257864324|gb|EEV87074.1| Holliday junction resolvase YqgF [Staphylococcus aureus A5937]
 gi|262075532|gb|ACY11505.1| hypothetical protein SAAV_1608 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269941102|emb|CBI49488.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282313551|gb|EFB43946.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C101]
 gi|282317201|gb|EFB47575.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C427]
 gi|282319372|gb|EFB49724.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           D139]
 gi|282321602|gb|EFB51927.1| putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus M899]
 gi|282324948|gb|EFB55258.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282327199|gb|EFB57494.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282331315|gb|EFB60829.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282590057|gb|EFB95139.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|282594511|gb|EFB99496.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|282595815|gb|EFC00779.1| putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus C160]
 gi|282764437|gb|EFC04563.1| conserved hypothetical protein [Staphylococcus aureus A8117]
 gi|283470893|emb|CAQ50104.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ST398]
 gi|283790526|gb|EFC29343.1| putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|290920321|gb|EFD97387.1| putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus M1015]
 gi|291095162|gb|EFE25427.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466877|gb|EFF09397.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M809]
 gi|294824671|gb|EFG41094.1| hypothetical protein SKAG_00712 [Staphylococcus aureus A9754]
 gi|294968485|gb|EFG44509.1| hypothetical protein SMAG_01910 [Staphylococcus aureus A8819]
 gi|295128551|gb|EFG58185.1| hypothetical protein SIAG_00722 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|296887681|gb|EFH26579.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|297177331|gb|EFH36583.1| hypothetical protein SLAG_01773 [Staphylococcus aureus A8796]
 gi|297575726|gb|EFH94442.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus MN8]
 gi|298694896|gb|ADI98118.1| probable Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus ED133]
 gi|300885992|gb|EFK81194.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|302333290|gb|ADL23483.1| Holliday junction resolvase [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|302751445|gb|ADL65622.1| Holliday junction resolvase [Staphylococcus aureus subsp. aureus
           str. JKD6008]
 gi|304340663|gb|EFM06596.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus ATCC BAA-39]
 gi|312437916|gb|ADQ76987.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus TCH60]
 gi|312830003|emb|CBX34845.1| uncharacterised protein family (UPF0081) family protein
           [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315129897|gb|EFT85887.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus CGS03]
 gi|315195516|gb|EFU25903.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus CGS00]
 gi|315198687|gb|EFU29015.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus CGS01]
 gi|320140497|gb|EFW32351.1| conserved hypothetical protein TIGR00250 [Staphylococcus aureus
           subsp. aureus MRSA131]
 gi|320144036|gb|EFW35805.1| conserved hypothetical protein TIGR00250 [Staphylococcus aureus
           subsp. aureus MRSA177]
 gi|323439037|gb|EGA96769.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           O11]
 gi|323442820|gb|EGB00445.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           O46]
 gi|329314291|gb|AEB88704.1| Putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329727568|gb|EGG64024.1| RNAse H domain protein, YqgF family [Staphylococcus aureus subsp.
           aureus 21172]
 gi|329728326|gb|EGG64763.1| RNAse H domain protein, YqgF family [Staphylococcus aureus subsp.
           aureus 21189]
 gi|329733081|gb|EGG69418.1| RNAse H domain protein, YqgF family [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 142

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 80/138 (57%), Gaps = 2/138 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTAL-ELLSFITTENIAAFIIG 74
             I  +D+G++ +G+AISD     A     L + ++  +  + +L+  I   N+   +IG
Sbjct: 4   HKILGLDVGSRTVGIAISDIMGWTAQGLDTLRINEENNELGIDQLVDIIKKHNVGTVVIG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN S G R  ++  +   +++    +  V WDERL+T++A++ L++ +VSR+KR Q
Sbjct: 64  LPKNMNNSIGFRGEASLTYKEKLLEAYPSIEIVMWDERLSTMAAERSLLEADVSRQKRKQ 123

Query: 135 KVDSIAAALILQEVLDRI 152
            +D +AA  ILQ  LD +
Sbjct: 124 VIDKMAAVFILQGYLDSL 141


>gi|229822860|ref|ZP_04448930.1| hypothetical protein GCWU000282_00149 [Catonella morbi ATCC 51271]
 gi|229787673|gb|EEP23787.1| hypothetical protein GCWU000282_00149 [Catonella morbi ATCC 51271]
          Length = 142

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 79/141 (56%), Gaps = 9/141 (6%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALEL-----LSFITTENIAAFII 73
           I  +D+G+K +G+A+SD           L   ++ + A +L     L  +    +   +I
Sbjct: 5   IMGLDVGSKTVGVAVSDL---MGWTAQGLETIRIDEAAGDLGYDRLLELVDQHQVKELVI 61

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKR 132
           GLP NMN S GPR  ++ A+   +   +  +   + DERLTT  A+++L+ + NVSRKKR
Sbjct: 62  GLPKNMNNSLGPRAEASMAYGEGISKLRPELTIHYQDERLTTSQAERMLVTEGNVSRKKR 121

Query: 133 IQKVDSIAAALILQEVLDRIS 153
            Q +D +AA +ILQ  LDRI+
Sbjct: 122 KQVIDKLAAVIILQNYLDRIN 142


>gi|320529130|ref|ZP_08030222.1| conserved hypothetical protein TIGR00250 [Selenomonas artemidis
           F0399]
 gi|320138760|gb|EFW30650.1| conserved hypothetical protein TIGR00250 [Selenomonas artemidis
           F0399]
          Length = 138

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 71/131 (54%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           S+D+G   IG+A+SD     A     + R  +      L + +    + A + GLP +MN
Sbjct: 2   SLDIGDVTIGIAVSDLLGLTAQGVETIRRTTLAADFERLSTLMRDYEVDALVAGLPKHMN 61

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EG R    RAF+         V   +WDERL+TV+A + L++ +VSRKKR + +D +A
Sbjct: 62  GDEGTRCEMVRAFMAEAAQCFPGVKIHYWDERLSTVAATRTLLEGDVSRKKRRKVIDKMA 121

Query: 141 AALILQEVLDR 151
           A  ILQ  LDR
Sbjct: 122 AVYILQGFLDR 132


>gi|332637231|ref|ZP_08416094.1| Holliday junction resolvase-like protein [Weissella cibaria KACC
           11862]
          Length = 144

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 81/139 (58%), Gaps = 10/139 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIA-----AFII 73
           +  +D+G++ +G+A+SD     A     +   ++ +   E       E +A      F++
Sbjct: 4   VMGLDVGSRTVGVAVSDLLGWTAQGVEII---RINEDEKEFGIARMKELVAQFQPTGFVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKR 132
           GLP NMN + GPRV + RA+  +++     +P  F DERLTTV A+++L++  + SRKKR
Sbjct: 61  GLPKNMNNTSGPRVDAARAY-GDLLTETFGLPIDFQDERLTTVEAERMLVEEADASRKKR 119

Query: 133 IQKVDSIAAALILQEVLDR 151
            Q +D +AAALILQ  LDR
Sbjct: 120 KQVIDKLAAALILQNYLDR 138


>gi|325262832|ref|ZP_08129568.1| putative Holliday junction resolvase [Clostridium sp. D5]
 gi|324031926|gb|EGB93205.1| putative Holliday junction resolvase [Clostridium sp. D5]
          Length = 148

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 78/145 (53%), Gaps = 5/145 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D GTK +G+AISD     A     + RK   K+ +T   +   ++   +   ++G 
Sbjct: 3   IMGLDYGTKTVGVAISDALGFTAQGIETIQRKEENKLRRTLARIEELVSEYEVEKIVLGF 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MN   G R   +  F  +M+ R+  +  + WDERLTTV A++ LI+ NV R+ R + 
Sbjct: 63  PKHMNNDIGERAEKSLEF-RDMLVRRTGLEVIMWDERLTTVEAERTLIESNVRRENRKKY 121

Query: 136 VDSIAAALILQEVLDRISFLESSKG 160
           +D IAA  ILQ  LD + +L+   G
Sbjct: 122 IDKIAAIFILQGYLDSV-YLQRQAG 145


>gi|126698882|ref|YP_001087779.1| putative holliday junction resolvase [Clostridium difficile 630]
 gi|254974830|ref|ZP_05271302.1| putative holliday junction resolvase [Clostridium difficile
           QCD-66c26]
 gi|255092218|ref|ZP_05321696.1| putative holliday junction resolvase [Clostridium difficile CIP
           107932]
 gi|255100303|ref|ZP_05329280.1| putative holliday junction resolvase [Clostridium difficile
           QCD-63q42]
 gi|255306242|ref|ZP_05350414.1| putative holliday junction resolvase [Clostridium difficile ATCC
           43255]
 gi|255313957|ref|ZP_05355540.1| putative holliday junction resolvase [Clostridium difficile
           QCD-76w55]
 gi|255516637|ref|ZP_05384313.1| putative holliday junction resolvase [Clostridium difficile
           QCD-97b34]
 gi|255649736|ref|ZP_05396638.1| putative holliday junction resolvase [Clostridium difficile
           QCD-37x79]
 gi|260682892|ref|YP_003214177.1| putative holliday junction resolvase [Clostridium difficile CD196]
 gi|260686490|ref|YP_003217623.1| putative holliday junction resolvase [Clostridium difficile R20291]
 gi|306519845|ref|ZP_07406192.1| putative Holliday junction resolvase [Clostridium difficile
           QCD-32g58]
 gi|118597204|sp|Q18BF1|RUVX_CLOD6 RecName: Full=Putative Holliday junction resolvase
 gi|115250319|emb|CAJ68141.1| putative Holliday junction resolvase [Clostridium difficile]
 gi|260209055|emb|CBA62181.1| putative holliday junction resolvase [Clostridium difficile CD196]
 gi|260212506|emb|CBE03438.1| putative holliday junction resolvase [Clostridium difficile R20291]
          Length = 141

 Score = 83.6 bits (205), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G K IG+A+SD     A     + R    +   EL + I  + +   + GLP N
Sbjct: 6   IMGLDVGDKTIGVAVSDLMGLTAQGVKTIKRVGKKKDIEELKAIIKEKQVNKIVSGLPKN 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP+      F   ++  +  +   FWDERL+TV+A++ L++ +VSR+KR + +D 
Sbjct: 66  MNGTLGPQGEKVIKFCE-LVKAETGIDVEFWDERLSTVAAERSLLEADVSRQKRKKVIDM 124

Query: 139 IAAALILQEVLD 150
           +AA +ILQ  LD
Sbjct: 125 LAAVIILQGYLD 136


>gi|15604198|ref|NP_220713.1| Holliday junction resolvase-like protein [Rickettsia prowazekii
           str. Madrid E]
 gi|6226362|sp|Q9ZDJ8|RUVX_RICPR RecName: Full=Putative Holliday junction resolvase
 gi|3860890|emb|CAA14790.1| unknown [Rickettsia prowazekii]
 gi|292571936|gb|ADE29851.1| Putative endonuclease involved in recombination [Rickettsia
           prowazekii Rp22]
          Length = 156

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 83/149 (55%), Gaps = 5/149 (3%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFL--VRKKVTQTALELLSFI 63
           +++  + L PN+P+ +ID G+K+IG+A+SD     A P   +  V KKV  T+  LL+ I
Sbjct: 6   LQEFYRLLIPNKPLIAIDYGSKKIGVALSDQELSIAMPFNTITAVNKKVVITS--LLNII 63

Query: 64  TTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI 123
               +   +IGLP++M+G    + +    F   +  + + +P    DERLTT SA   L 
Sbjct: 64  KKYKVCGIVIGLPIDMSGGVTQQTNIVMKFAEKL-KQSLGLPIYLQDERLTTKSANNFLK 122

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLDRI 152
              + RK R    D++AA++IL+ VL+ I
Sbjct: 123 SFGIKRKDRNHNDDAVAASMILEIVLNAI 151


>gi|325568881|ref|ZP_08145174.1| crossover junction endodeoxyribonuclease [Enterococcus
           casseliflavus ATCC 12755]
 gi|325157919|gb|EGC70075.1| crossover junction endodeoxyribonuclease [Enterococcus
           casseliflavus ATCC 12755]
          Length = 143

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 82/135 (60%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G++ +G+A+SDP    A     + + +       + L+ +  E  ++ F++GLP
Sbjct: 3   IMGLDVGSRTVGVAVSDPMGWTAQGIEIIRINEDEGNFGYDRLAELVKEYEVSRFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPR  ++ A+    I+++  +P V+ DERLTTV A+++L++  N SR KR + 
Sbjct: 63  KNMNNTIGPRAEASMAY-GAAIEQQFGLPVVYQDERLTTVQAERMLVEQANTSRAKRKKV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA +ILQ  LD
Sbjct: 122 IDKLAAVMILQNYLD 136


>gi|283781683|ref|YP_003372438.1| Holliday junction resolvase YqgF [Pirellula staleyi DSM 6068]
 gi|283440136|gb|ADB18578.1| Holliday junction resolvase YqgF [Pirellula staleyi DSM 6068]
          Length = 153

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 69/129 (53%), Gaps = 1/129 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D GT RIGLAI+DP ++FA P     R+     A         E  AA+++GLP++  
Sbjct: 12  GVDYGTVRIGLAITDPEQKFASPLDNYTRRGGQADARYFQRVAQEERAAAWVVGLPVHTT 71

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GSE  +    R F    ++    +P   +DER T+  A+++LI   +SRK+R   +D +A
Sbjct: 72  GSESQKSTEARQFA-KQLEELTKLPVFLFDERFTSADAEEMLIAAGMSRKERKSHLDKLA 130

Query: 141 AALILQEVL 149
           A ++L   L
Sbjct: 131 AQILLSAFL 139


>gi|189220288|ref|YP_001940928.1| RNase H-like ribonuclease [Methylacidiphilum infernorum V4]
 gi|189187146|gb|ACD84331.1| RNase H-like ribonuclease [Methylacidiphilum infernorum V4]
          Length = 168

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 72/132 (54%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I S+D G K IGLA++D     A P   L  +   +   +L   I    ++  I+GLP N
Sbjct: 25  ILSLDYGNKHIGLAVNDESFSIAIPLDPLPAEPYVKFIGKLKEIIVNYEVSLLIVGLPRN 84

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+GS GP     R FV  +  + + +P  F DERLTT  A ++L     + +++ +K+DS
Sbjct: 85  MDGSYGPAAEKVRQFVLKL-KQWIPIPVEFHDERLTTKLADRLLTQCGCNGREKKKKIDS 143

Query: 139 IAAALILQEVLD 150
            AAA+ILQ  LD
Sbjct: 144 YAAAVILQSYLD 155


>gi|319892670|ref|YP_004149545.1| Putative Holliday junction resolvase [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317162366|gb|ADV05909.1| Putative Holliday junction resolvase [Staphylococcus
           pseudintermedius HKU10-03]
 gi|323464292|gb|ADX76445.1| Holliday junction resolvase, putative [Staphylococcus
           pseudintermedius ED99]
          Length = 142

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALE-LLSFITTENIAAFIIG 74
             I  +D+G++ +G+AISD     A     L + ++  +  ++ L+  I  EN+   +IG
Sbjct: 4   HKIIGLDVGSRTVGIAISDLMGWTAQGLDTLQINEEENELGIDALIDIIQKENVGTVVIG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN S G R  ++  +   + +R   +  + WDERL+T++A++ L++ +VSR KR +
Sbjct: 64  LPKNMNNSIGFRGEASLKYKDALAERMPNLEIIMWDERLSTMAAERSLLEADVSRAKRKK 123

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA  ILQ  LD ++
Sbjct: 124 VIDKMAAVFILQGYLDGLN 142


>gi|225848600|ref|YP_002728763.1| hypothetical protein SULAZ_0781 [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644154|gb|ACN99204.1| conserved hypothetical protein [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 138

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 80/140 (57%), Gaps = 11/140 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D+GTKRIG+A+SDP    A P  ++  K        + S I ++N++  +IGLP+ 
Sbjct: 4   ILALDIGTKRIGVAVSDPLGITAKPLDYI--KNDDNVFQNIKSLIESQNVSTVVIGLPIT 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVP---FVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           + G +G +V  T+ F   +   K Y+P    VF DER TT  A++ L      +KK I+ 
Sbjct: 62  LKGLQGQQVEYTKEFAEKL---KHYIPHINIVFIDERFTTSLAEKHL--SQTKKKKNIKD 116

Query: 136 -VDSIAAALILQEVLDRISF 154
            +DS++A  ILQ  LD +SF
Sbjct: 117 YIDSLSAVFILQTYLDSLSF 136


>gi|167747070|ref|ZP_02419197.1| hypothetical protein ANACAC_01782 [Anaerostipes caccae DSM 14662]
 gi|167654030|gb|EDR98159.1| hypothetical protein ANACAC_01782 [Anaerostipes caccae DSM 14662]
          Length = 138

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 77/135 (57%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D GTK +G+A+SD     A P   + RK   K+ +T   +        +   ++G 
Sbjct: 3   ILGLDYGTKTVGVALSDELGITAQPFETITRKDENKLRKTYARIEEIAAEYKVEKIVLGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R  +T AF  +++ R+  +  + WDERL+TV++ ++L++  V R+ R + 
Sbjct: 63  PKNMNNTIGERGMATEAFRDSLV-RRTGLDVILWDERLSTVASNKVLMESGVRREHRKKV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA++ILQ  LD
Sbjct: 122 IDQVAASMILQGYLD 136


>gi|153812697|ref|ZP_01965365.1| hypothetical protein RUMOBE_03104 [Ruminococcus obeum ATCC 29174]
 gi|149831213|gb|EDM86302.1| hypothetical protein RUMOBE_03104 [Ruminococcus obeum ATCC 29174]
          Length = 140

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 73/139 (52%), Gaps = 4/139 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K +G+A+SDP    A     + RK   K+ +T  ++   +    I   ++G 
Sbjct: 3   ILGLDYGSKTVGVAVSDPLGVTAQRLETIWRKQENKLRRTLAQVEELVKEYEIEKIVLGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R      F   M+ ++  +  + WDERLTTVSA + L++  V R+ R + 
Sbjct: 63  PKNMNNTVGERAEKALEF-GEMLKKRTGLEVIMWDERLTTVSADRALMEAGVRRENRKEY 121

Query: 136 VDSIAAALILQEVLDRISF 154
           +D IAA  ILQ  LD +  
Sbjct: 122 LDGIAAVFILQGYLDSLKM 140


>gi|323341645|ref|ZP_08081878.1| crossover junction endodeoxyribonuclease [Erysipelothrix
           rhusiopathiae ATCC 19414]
 gi|322464070|gb|EFY09263.1| crossover junction endodeoxyribonuclease [Erysipelothrix
           rhusiopathiae ATCC 19414]
          Length = 144

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 53/141 (37%), Positives = 73/141 (51%), Gaps = 2/141 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK-KVTQTALELLSFITTENIAAFIIGLPL 77
           I  +DLG+K  G+A+SD    +AHP   L  K  + +    L S I  E +    +G P 
Sbjct: 5   IIGLDLGSKTCGVALSDGLGMYAHPVETLYYKVSIDELKEPLDSLIKKERVKVIALGFPK 64

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
            MN   G R   +  F    ++       V  DERLT+V A + LID +VSRKKR + VD
Sbjct: 65  MMNNDVGERAQISEEF-KKTLESWFNCEVVLIDERLTSVVANRQLIDQDVSRKKRKKVVD 123

Query: 138 SIAAALILQEVLDRISFLESS 158
            +AA  ILQ  LD+  F+E +
Sbjct: 124 QLAAVHILQTYLDKRRFMEGN 144


>gi|229543745|ref|ZP_04432805.1| Holliday junction resolvase YqgF [Bacillus coagulans 36D1]
 gi|229328165|gb|EEN93840.1| Holliday junction resolvase YqgF [Bacillus coagulans 36D1]
          Length = 138

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 79/134 (58%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITT-ENIAAFIIGLP 76
           I  +D+G+K +G+A+SD  G          + +   +   + ++ +     +   ++G P
Sbjct: 3   IMGLDVGSKTVGVAVSDALGWTAQGIETIAINEAKGKFGFDRVAELAQIHGVEKIVVGFP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMN + GPR  +++ +   +  +++ +P + WDERL+T  A++IL++ +VSRKKR + +
Sbjct: 63  KNMNNTIGPRAEASKVYAEEL-KKRLNLPVILWDERLSTAQAERILLEADVSRKKRKKVI 121

Query: 137 DSIAAALILQEVLD 150
           D +AA++ILQ  LD
Sbjct: 122 DKMAASVILQGFLD 135


>gi|21911333|ref|NP_665601.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS315]
 gi|21905548|gb|AAM80404.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315]
          Length = 136

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 10/137 (7%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFIIGL 75
            +D+G+K +G+AISDP    A     +   K+ +   E     L   +    +  F+IGL
Sbjct: 2   GLDVGSKTVGVAISDPLGFTAQGLEII---KIDEEKAEFGFTRLEELVKQYQVEQFVIGL 58

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQ 134
           P NMN + GPRV ++  +  N I+    +P  + DERLTTV A+++LI+  ++SR KR +
Sbjct: 59  PKNMNNTNGPRVDASITY-GNHIEHLFGLPVHYQDERLTTVEAERMLIEQADISRGKRKK 117

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA LILQ  L+R
Sbjct: 118 VIDKLAAQLILQNYLNR 134


>gi|28378868|ref|NP_785760.1| Holliday junction resolvase-like protein [Lactobacillus plantarum
           WCFS1]
 gi|254557074|ref|YP_003063491.1| Holliday junction resolvase-like protein [Lactobacillus plantarum
           JDM1]
 gi|300768026|ref|ZP_07077932.1| crossover junction endodeoxyribonuclease [Lactobacillus plantarum
           subsp. plantarum ATCC 14917]
 gi|308181068|ref|YP_003925196.1| Holliday junction resolvase-like protein [Lactobacillus plantarum
           subsp. plantarum ST-III]
 gi|32130018|sp|Q88V13|RUVX_LACPL RecName: Full=Putative Holliday junction resolvase
 gi|28271705|emb|CAD64611.1| endonuclease involved in recombination (putative) [Lactobacillus
           plantarum WCFS1]
 gi|254046001|gb|ACT62794.1| Holliday junction resolvase-like protein [Lactobacillus plantarum
           JDM1]
 gi|300494375|gb|EFK29537.1| crossover junction endodeoxyribonuclease [Lactobacillus plantarum
           subsp. plantarum ATCC 14917]
 gi|308046559|gb|ADN99102.1| Holliday junction resolvase-like protein [Lactobacillus plantarum
           subsp. plantarum ST-III]
          Length = 144

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 83/136 (61%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           +  +D+G++ +G+AISD     A     + + +   +  ++ ++ +  E +   F++GLP
Sbjct: 3   LMGLDVGSRTVGVAISDAFGWTAQGVEIIRINEDAEEFGIDRVAELVEELDAGGFVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQK 135
            NMN + GPR  + + +   ++  + ++P  F DERLTTV A+++L++  N SRKKR + 
Sbjct: 63  KNMNNTLGPRAEAAQHY-GELLTARFHLPVDFEDERLTTVEAERMLVEEANTSRKKRKKV 121

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA+LILQ  LDR
Sbjct: 122 IDKLAASLILQNYLDR 137


>gi|329766971|ref|ZP_08258499.1| Holliday junction resolvase [Gemella haemolysans M341]
 gi|328837696|gb|EGF87321.1| Holliday junction resolvase [Gemella haemolysans M341]
          Length = 142

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 81/140 (57%), Gaps = 2/140 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFII 73
           ++ I  +D G+K IG+A+SD  G          + +++    ++ +  +  E N+   ++
Sbjct: 3   DKRIMGLDYGSKTIGVAVSDLLGLTAQGIETININEQIKDFKIKRIKELVQEHNVGKIVV 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NM+ S G R  +T  FV  +  +   V  +  DERLTT+ A+++L++ NVSRKKR 
Sbjct: 63  GLPKNMDNSVGFRGEATLFFVEVLKKKIKNVEIILQDERLTTMGAERVLLEANVSRKKRK 122

Query: 134 QKVDSIAAALILQEVLDRIS 153
             +D +AA LILQ  LD+++
Sbjct: 123 DVIDKMAAVLILQTYLDKLN 142


>gi|167770376|ref|ZP_02442429.1| hypothetical protein ANACOL_01719 [Anaerotruncus colihominis DSM
           17241]
 gi|167667383|gb|EDS11513.1| hypothetical protein ANACOL_01719 [Anaerotruncus colihominis DSM
           17241]
          Length = 142

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 66/132 (50%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D G  R GLA  D     A P   L  K       ++ +  +  ++   I+G P+N
Sbjct: 3   ILAVDFGDARTGLACCDRTEYLASPIGVLHDKDFGSVLQKVAAAASEYDVQEIIVGHPIN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+EGPR      F   +  + V VP   WDER TTVSA   L   N   KKR + +D 
Sbjct: 63  MNGTEGPRAQLCADFAGQLA-KLVTVPVRLWDERGTTVSATGFLNATNTRGKKRKEVIDE 121

Query: 139 IAAALILQEVLD 150
           +AA +IL+  L+
Sbjct: 122 VAATIILESYLN 133


>gi|313888091|ref|ZP_07821765.1| RNAse H domain protein, YqgF family [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312845781|gb|EFR33168.1| RNAse H domain protein, YqgF family [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 138

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 80/138 (57%), Gaps = 5/138 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN-IAAFIIGLPL 77
           I  +D+G   IG+AISD     A P    ++++  + A E +  I  EN +   ++GLP 
Sbjct: 4   ILGLDVGDVWIGVAISDALMLTAQP-LMTIKRESNKIAYEKIHEIIKENNVEKVVVGLPK 62

Query: 78  NMNGSEGPRVHSTRAFVHNMIDR-KVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           NMN + GP+      F   + ++ KV + +V  DER+TT+ A+Q+LI+ +V R+ R + +
Sbjct: 63  NMNNTIGPQSEKVIKFAEKLKNKFKVEIEYV--DERMTTLMAEQVLIEGSVRRENRKKYI 120

Query: 137 DSIAAALILQEVLDRISF 154
           D IAA  ILQ  LDRI+ 
Sbjct: 121 DKIAATYILQSYLDRINL 138


>gi|241896590|ref|ZP_04783886.1| crossover junction endodeoxyribonuclease [Weissella
           paramesenteroides ATCC 33313]
 gi|241870182|gb|EER73933.1| crossover junction endodeoxyribonuclease [Weissella
           paramesenteroides ATCC 33313]
          Length = 144

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 80/136 (58%), Gaps = 4/136 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLP 76
           I  +D+G++ +G+A+SD     A     + + +   +  ++ +   +       F++GLP
Sbjct: 4   ILGLDVGSRTVGVAVSDQLGWTAQGVEIIPINEDEKEFGIDRMKELVAKYEPIGFVLGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQK 135
            NMN + GPRV ++RA+   ++     +P  F DERLTTV A+++LI + + SRKKR + 
Sbjct: 64  KNMNNTSGPRVDASRAY-GELLKETFGLPIDFQDERLTTVEAERMLIEEADTSRKKRKKV 122

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LDR
Sbjct: 123 IDKLAAGLILQNYLDR 138


>gi|51473526|ref|YP_067283.1| Holliday junction resolvase-like protein [Rickettsia typhi str.
           Wilmington]
 gi|62900964|sp|Q68X41|RUVX_RICTY RecName: Full=Putative Holliday junction resolvase
 gi|51459838|gb|AAU03801.1| possible Holliday junction resolvase [Rickettsia typhi str.
           Wilmington]
          Length = 156

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 77/147 (52%), Gaps = 1/147 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           +++  + L PN+P+ +ID G+K+IG+A+SD     A P   +           LL+ I  
Sbjct: 6   LQEFYRLLIPNEPLIAIDYGSKKIGVALSDQALAIAMPLNTITELNQRVIITSLLNIIEK 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             +   +IGLP++M+G    + +    F   +  + V +P    DERLTT SA   L   
Sbjct: 66  YQVCGIVIGLPIDMSGGVTKQTNIVMKFADKL-KQSVSLPIYLQDERLTTKSANNFLKSF 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRI 152
            + RK R    D++AA++IL+ VL+ I
Sbjct: 125 GIKRKDRNNNDDAVAASMILEIVLNAI 151


>gi|326803430|ref|YP_004321248.1| RNAse H domain protein, YqgF family [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326651353|gb|AEA01536.1| RNAse H domain protein, YqgF family [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 140

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 78/138 (56%), Gaps = 10/138 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFII 73
           I  +D+G+K +G+AISDP   F      +   K+ + A +     L   I    +   +I
Sbjct: 3   IMGLDVGSKTVGVAISDP---FGWTAQGIETIKIDEEAGKFGFSRLRQLIEDYQVEKIVI 59

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKR 132
           GLP NMN +EGPR  ++R +  +M      +P  + DERLTT  +++ LI+  +VSRKKR
Sbjct: 60  GLPKNMNNTEGPRAEASRHY-GDMAIELFDLPVFYQDERLTTQQSERFLIEAADVSRKKR 118

Query: 133 IQKVDSIAAALILQEVLD 150
            + +D +AA LILQ  LD
Sbjct: 119 KKVIDKLAAVLILQNYLD 136


>gi|87307204|ref|ZP_01089349.1| hypothetical protein DSM3645_16815 [Blastopirellula marina DSM
           3645]
 gi|87289944|gb|EAQ81833.1| hypothetical protein DSM3645_16815 [Blastopirellula marina DSM
           3645]
          Length = 159

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 77/134 (57%), Gaps = 5/134 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK--KVTQTALELLSFITTENIAAFIIGLP 76
           IA ID GT RIG+AI+DP R  A P     R+  K+ +   E L+ +  E I  F++GLP
Sbjct: 15  IAGIDFGTVRIGVAITDPDRILASPFENYTRRSLKIDRQYFEELAKL--ERIVLFVVGLP 72

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           ++M+G+E  +    R F    + R   VP V++DER TT  A+  L  + ++++K+   +
Sbjct: 73  VHMSGNESGKSGEARKF-GQWLGRITGVPIVYYDERFTTSIAKDYLAGLGMTKQKKKAVI 131

Query: 137 DSIAAALILQEVLD 150
           D +AA ++L   L+
Sbjct: 132 DKLAAQILLTAYLE 145


>gi|157828326|ref|YP_001494568.1| Holliday junction resolvase-like protein [Rickettsia rickettsii
           str. 'Sheila Smith']
 gi|165933035|ref|YP_001649824.1| Holliday junction resolvase-like protein [Rickettsia rickettsii
           str. Iowa]
 gi|167012757|sp|A8GRN5|RUVX_RICRS RecName: Full=Putative Holliday junction resolvase
 gi|189046103|sp|B0BX42|RUVX_RICRO RecName: Full=Putative Holliday junction resolvase
 gi|157800807|gb|ABV76060.1| Holliday junction resolvase-like protein [Rickettsia rickettsii
           str. 'Sheila Smith']
 gi|165908122|gb|ABY72418.1| hypothetical cytosolic protein [Rickettsia rickettsii str. Iowa]
          Length = 154

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 78/147 (53%), Gaps = 1/147 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           +++  + L PN P+ +ID G+K++G+A+S+     A P   +           LL+ I  
Sbjct: 6   LQEFYRLLIPNAPLIAIDYGSKKLGIALSNQELSIAMPLNTITEINTKIVITVLLNIIEK 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             +   IIGLP++M+G+   + +    F   +  + + +P    DERLTT +A  +L   
Sbjct: 66  YKVCGVIIGLPIDMSGAVTEQTNIVMKFAEEL-AKSINLPIYLQDERLTTKAANNLLKSF 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRI 152
            V RK R    D++AA++IL+ VLD I
Sbjct: 125 GVKRKDRNNNDDAVAASMILETVLDSI 151


>gi|312864393|ref|ZP_07724626.1| RNAse H domain protein, YqgF family [Streptococcus downei F0415]
 gi|311100114|gb|EFQ58325.1| RNAse H domain protein, YqgF family [Streptococcus downei F0415]
          Length = 139

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 82/140 (58%), Gaps = 10/140 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLS-FITTENIAAFIIGLP 76
           +  +D+G+K +G+AISDP    A     + + +       + L   +    +  F++GLP
Sbjct: 3   LMGLDIGSKTVGVAISDPLGFTAQGLEIIPINEAKEDFGFQRLGELVKQYKVEKFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAF---VHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
            NMN + GPRV +++A+   +  + D    +P  + DERLTTV A+++L++  +VSR KR
Sbjct: 63  KNMNNTSGPRVEASQAYGEKIAELFD----IPVDYQDERLTTVQAERMLVEQADVSRGKR 118

Query: 133 IQKVDSIAAALILQEVLDRI 152
            + +D +AA LILQ  L+R+
Sbjct: 119 KKVIDKLAAQLILQNYLERM 138


>gi|257867380|ref|ZP_05647033.1| conserved hypothetical protein [Enterococcus casseliflavus EC30]
 gi|257873711|ref|ZP_05653364.1| conserved hypothetical protein [Enterococcus casseliflavus EC10]
 gi|257877460|ref|ZP_05657113.1| conserved hypothetical protein [Enterococcus casseliflavus EC20]
 gi|257801436|gb|EEV30366.1| conserved hypothetical protein [Enterococcus casseliflavus EC30]
 gi|257807875|gb|EEV36697.1| conserved hypothetical protein [Enterococcus casseliflavus EC10]
 gi|257811626|gb|EEV40446.1| conserved hypothetical protein [Enterococcus casseliflavus EC20]
          Length = 140

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 81/133 (60%), Gaps = 4/133 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +D+G++ +G+A+SDP    A     + + +       + L+ +  E  ++ F++GLP N
Sbjct: 2   GLDVGSRTVGVAVSDPMGWTAQGIEIIRINEDEGNFGYDRLAELVKEYEVSRFVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKVD 137
           MN + GPR  ++ A+    I+++  +P V+ DERLTTV A+++L++  N SR KR + +D
Sbjct: 62  MNNTIGPRAEASMAY-GAAIEQQFGLPVVYQDERLTTVQAERMLVEQANTSRAKRKKVID 120

Query: 138 SIAAALILQEVLD 150
            +AA +ILQ  LD
Sbjct: 121 KLAAVMILQNYLD 133


>gi|323705257|ref|ZP_08116832.1| Holliday junction resolvase YqgF [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535159|gb|EGB24935.1| Holliday junction resolvase YqgF [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 140

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 72/131 (54%), Gaps = 2/131 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+G K IG+A+SDP    A     + R+ +     E+   I    +   ++G P NMN
Sbjct: 5   GLDVGDKTIGIAVSDPSGLIAQGIKTIRRESLDNDVFEIKKIIDAFKVEEIVVGFPKNMN 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKVDSI 139
           G+ G +      FV   +  ++ +P + WDERLTTV A ++L++  ++ R KR + +D +
Sbjct: 65  GTIGAQGQKVINFVE-YLKEEIDLPIMLWDERLTTVEANRMLVENADMRRDKRKKVIDKL 123

Query: 140 AAALILQEVLD 150
           AA +ILQ  LD
Sbjct: 124 AATIILQGYLD 134


>gi|289550617|ref|YP_003471521.1| Putative Holliday junction resolvase [Staphylococcus lugdunensis
           HKU09-01]
 gi|315658112|ref|ZP_07910984.1| crossover junction endodeoxyribonuclease [Staphylococcus
           lugdunensis M23590]
 gi|289180149|gb|ADC87394.1| Putative Holliday junction resolvase [Staphylococcus lugdunensis
           HKU09-01]
 gi|315496441|gb|EFU84764.1| crossover junction endodeoxyribonuclease [Staphylococcus
           lugdunensis M23590]
          Length = 142

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 81/142 (57%), Gaps = 10/142 (7%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALE-LLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISD     A     L + ++  +  +E L + I + N+   +IG
Sbjct: 4   HKILGLDVGSKTVGIAISDLMGWTAQGLDTLRINEEQEEYGIEQLTNIIKSNNVDTIVIG 63

Query: 75  LPLNMNGSEGPR----VHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRK 130
           LP NMN S G R    +H     +  M D KV    + WDERL+T++A++ L++ +VSR+
Sbjct: 64  LPKNMNNSIGFRGEASIHYKELILEAMPDMKV----IMWDERLSTMAAERSLLEADVSRQ 119

Query: 131 KRIQKVDSIAAALILQEVLDRI 152
           KR + +D +AA  ILQ  LD I
Sbjct: 120 KRKKVIDKMAAVFILQGYLDSI 141


>gi|304316717|ref|YP_003851862.1| Holliday junction resolvase YqgF [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778219|gb|ADL68778.1| Holliday junction resolvase YqgF [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 140

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 73/131 (55%), Gaps = 2/131 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+G K IG+AISDP    A     + R  +    LE+     +      ++G P NMN
Sbjct: 5   GLDVGDKTIGVAISDPSGLIAQGIKTIKRSNLDDDILEIKRIANSFKAEEIVVGFPKNMN 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKVDSI 139
           G+ G +      FV  ++ +++ +P + WDERLTTV A ++LI+  ++ R KR + +D +
Sbjct: 65  GTIGSQGQKVINFVE-VLKKEINLPIMLWDERLTTVEASRMLIEGADMRRDKRKKVIDKL 123

Query: 140 AAALILQEVLD 150
           AA +ILQ  LD
Sbjct: 124 AATIILQGYLD 134


>gi|154504518|ref|ZP_02041256.1| hypothetical protein RUMGNA_02022 [Ruminococcus gnavus ATCC 29149]
 gi|153795000|gb|EDN77420.1| hypothetical protein RUMGNA_02022 [Ruminococcus gnavus ATCC 29149]
          Length = 148

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 71/137 (51%), Gaps = 4/137 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D GTK +G+AISD     A     + RK   K+ +T   +   +    +   ++G 
Sbjct: 3   IMGLDYGTKTVGVAISDALGLTAQGIETIQRKEENKLRRTLARIEELVREYEVDTIVLGF 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MN   G R   +  F   M+ R+  +  V WDERLTTV A++ LI+  V R+ R Q 
Sbjct: 63  PKHMNNDVGERAKKSLEF-KEMLVRRTGLDVVMWDERLTTVEAERTLIESQVRRENRKQY 121

Query: 136 VDSIAAALILQEVLDRI 152
           +D IAA  ILQ  LD I
Sbjct: 122 IDKIAAVFILQGYLDSI 138


>gi|209560223|ref|YP_002286695.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           NZ131]
 gi|226695308|sp|B5XJ01|RUVX_STRPZ RecName: Full=Putative Holliday junction resolvase
 gi|209541424|gb|ACI62000.1| Putative Holliday junction resolvase [Streptococcus pyogenes NZ131]
          Length = 139

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 80/139 (57%), Gaps = 10/139 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFII 73
           I  +D+G+K +G+AISDP    A     +   K+ +   E     L   +    +  F+I
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEII---KIDEEKAEFGFTRLEELVKQYQVEQFVI 59

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
           GLP NMN + GPRV ++  +  + I+    +P  + DERLTTV A+++LI+  ++SR KR
Sbjct: 60  GLPKNMNNTNGPRVDASITY-GSHIEHLFGLPVHYQDERLTTVEAERMLIEQADISRGKR 118

Query: 133 IQKVDSIAAALILQEVLDR 151
            + +D +AA LILQ  L+R
Sbjct: 119 KKVIDKLAAQLILQNYLNR 137


>gi|289523055|ref|ZP_06439909.1| putative Holliday junction resolvase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503598|gb|EFD24762.1| putative Holliday junction resolvase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 144

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 71/134 (52%), Gaps = 2/134 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + I ++D+G+ RIG+AISDP   FA    FL  +      L LL  I   N+   +IGLP
Sbjct: 2   EHILALDIGSVRIGIAISDPLGIFAQGVGFLNAQGSWLEDLTLL--IRKHNVKKVVIGLP 59

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           +  NG +     +       + ++   + F+ WDER TT  AQ  L D  +S KK+  +V
Sbjct: 60  IRTNGKKDREADAISDLTDKLKEKFPDITFILWDERFTTTLAQNYLRDSGMSGKKKRNRV 119

Query: 137 DSIAAALILQEVLD 150
           D IAA ++LQ  LD
Sbjct: 120 DMIAATVLLQSYLD 133


>gi|327540307|gb|EGF26893.1| Resolvase, holliday junction-type, YqgF-like protein
           [Rhodopirellula baltica WH47]
          Length = 173

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 76/141 (53%), Gaps = 7/141 (4%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +AS+D GT RIG+AI DP    A P        + + A   +    +E IAA+++GLP++
Sbjct: 18  LASVDYGTVRIGVAICDPDWILASPLEVHPVSTLEKDAQYFIDLAKSERIAAWVVGLPIH 77

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
            +G E  +   +R F    +     +P   +DER TTV+A   +     +RKK  Q+VD+
Sbjct: 78  CDGGESDKSKESRKFA-AWLKETTGLPTRLFDERFTTVAANAKIRQGKTTRKKTKQRVDA 136

Query: 139 IAAALILQEVLDRISFLESSK 159
           +AA ++L+      SFLE+ +
Sbjct: 137 VAAQVLLE------SFLEACR 151


>gi|70726304|ref|YP_253218.1| Holliday junction resolvase-like protein [Staphylococcus
           haemolyticus JCSC1435]
 gi|146291068|sp|Q4L6W3|RUVX_STAHJ RecName: Full=Putative Holliday junction resolvase
 gi|68447028|dbj|BAE04612.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 142

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 81/138 (58%), Gaps = 2/138 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALE-LLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISD     A     L + +++    +E L++ I   N+ + +IG
Sbjct: 4   HKILGLDVGSKTVGVAISDLMGWTAQGLDTLRINEELEDYGIEQLVTIIKENNVGSVVIG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN S G R  ++  +   + +    +  + WDERL+T++A++ L++ +VSR+KR +
Sbjct: 64  LPKNMNNSIGFRGEASLRYKELLKESLPDIEIIMWDERLSTMAAERSLLEADVSRQKRKK 123

Query: 135 KVDSIAAALILQEVLDRI 152
            +D +AA  ILQ  LD I
Sbjct: 124 VIDKMAAVFILQGYLDSI 141


>gi|110004986|emb|CAK99317.1| putative holliday junction resolvase yqgf protein [Spiroplasma
           citri]
          Length = 139

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 73/134 (54%), Gaps = 5/134 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G+K +GLA S       +           Q A  L   ITTE  +  I+G P NMN
Sbjct: 7   AVDVGSKTLGLATSQGLIATGYGVYRFPENDFLQAAQYLAGLITTEQFSDIIVGYPKNMN 66

Query: 81  GSEGPRVHSTRAFVH---NMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
            + GPR      FV+    ++D  + +  V  DERLTT  A QI+++ N+SR+KR QK D
Sbjct: 67  NTIGPRALMVSDFVNLLKQLLDPTITIHLV--DERLTTHQAHQIMLEANLSRQKRKQKKD 124

Query: 138 SIAAALILQEVLDR 151
           S+AA LIL+  L +
Sbjct: 125 SLAAQLILETYLHQ 138


>gi|163849371|ref|YP_001637415.1| Holliday junction resolvase YqgF [Chloroflexus aurantiacus J-10-fl]
 gi|222527368|ref|YP_002571839.1| Holliday junction resolvase YqgF [Chloroflexus sp. Y-400-fl]
 gi|189046090|sp|A9WCR4|RUVX_CHLAA RecName: Full=Putative Holliday junction resolvase
 gi|254767506|sp|B9LH40|RUVX_CHLSY RecName: Full=Putative Holliday junction resolvase
 gi|163670660|gb|ABY37026.1| Holliday junction resolvase YqgF [Chloroflexus aurantiacus J-10-fl]
 gi|222451247|gb|ACM55513.1| Holliday junction resolvase YqgF [Chloroflexus sp. Y-400-fl]
          Length = 153

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 77/135 (57%), Gaps = 1/135 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +Q I ++D+G +RIG+AISD   R A P   +      +   +++  +    ++  ++GL
Sbjct: 3   DQIILALDVGERRIGVAISDADARIAAPLTTINAHPPERAIAQIVRLVQERGVSRVVVGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PL M G  GP+    + F  + +   +  P   +DERLT+V+A+Q+L ++ +   K   +
Sbjct: 63  PLTMRGERGPQAEVVQRFA-DTLSSALSCPVEMFDERLTSVAAEQMLRNLGLKPAKIKAQ 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA++ILQ+ LD
Sbjct: 122 IDQVAASIILQDYLD 136


>gi|239637577|ref|ZP_04678549.1| conserved hypothetical protein [Staphylococcus warneri L37603]
 gi|239596795|gb|EEQ79320.1| conserved hypothetical protein [Staphylococcus warneri L37603]
          Length = 142

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 78/139 (56%), Gaps = 2/139 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALE-LLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISD     A     L + +   +  +E L+  I    +   +IG
Sbjct: 4   HKILGLDVGSKTVGIAISDLMGWTAQGLDTLRIDENNNELGIEQLVEIIKQHGVGTVVIG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN S G R  ++  +   + +    +  + WDERL+T++A++ L++ +VSR+KR +
Sbjct: 64  LPKNMNNSIGFRGEASLQYKEKLQEALPSIEIIMWDERLSTMAAEKSLLEADVSRQKRKK 123

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA  ILQ  LD IS
Sbjct: 124 VIDKMAAVFILQGYLDSIS 142


>gi|254993596|ref|ZP_05275786.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           FSL J2-064]
          Length = 124

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 58/83 (69%), Gaps = 1/83 (1%)

Query: 68  IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV 127
           +   ++GLP NMN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +V
Sbjct: 40  VEKVVVGLPKNMNNTIGPRAESSKIYAE-VLESRIGLPVVLWDERLTTSAAERTLIEADV 98

Query: 128 SRKKRIQKVDSIAAALILQEVLD 150
           SRKKR + +D +AA +ILQ  LD
Sbjct: 99  SRKKRKEVIDKLAAVMILQSYLD 121


>gi|219847050|ref|YP_002461483.1| Holliday junction resolvase YqgF [Chloroflexus aggregans DSM 9485]
 gi|254767505|sp|B8GC73|RUVX_CHLAD RecName: Full=Putative Holliday junction resolvase
 gi|219541309|gb|ACL23047.1| Holliday junction resolvase YqgF [Chloroflexus aggregans DSM 9485]
          Length = 142

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 76/135 (56%), Gaps = 1/135 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            Q I  +D+G +RIG+AISD   R A P   +      +   ++   +    +   ++GL
Sbjct: 3   EQTILGLDVGERRIGVAISDVEARIAAPLTTIPAHPPERAIAQIARLVAERGVRRVVVGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PL M G  GP+  + + FV + +   +  P   +DERLT+V+A+Q+L ++ V   K  ++
Sbjct: 63  PLTMRGEHGPQAAAIQRFV-DALAAVLNCPVEMFDERLTSVAAEQMLRNLGVKPAKIKEQ 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA++ILQ+ LD
Sbjct: 122 IDQVAASIILQDYLD 136


>gi|238916712|ref|YP_002930229.1| putative Holliday junction resolvase [Eubacterium eligens ATCC
           27750]
 gi|259495704|sp|C4Z578|RUVX_EUBE2 RecName: Full=Putative Holliday junction resolvase
 gi|238872072|gb|ACR71782.1| putative Holliday junction resolvase [Eubacterium eligens ATCC
           27750]
          Length = 140

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 77/144 (53%), Gaps = 10/144 (6%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D+GTK +G+A+SDP    A P   + RK   K+ +T   +   I+  ++   ++G 
Sbjct: 3   IIGLDVGTKTVGVALSDPLGITAQPFETITRKENNKLRRTYARIEQIISEYDVTEIVVGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NM+ + G R  +   F    ++R+  +P   WDERLTTV A ++L +  + R+ R   
Sbjct: 63  PKNMDDTIGERAKACEEFAA-ALERRTGLPVTLWDERLTTVEADEVLEECGMRRENRKTV 121

Query: 136 VDSIAAALILQEVLDRISFLESSK 159
           +D +AA  IL+       ++ES +
Sbjct: 122 IDQLAAVFILR------GYMESKQ 139


>gi|118597218|sp|Q6MD02|RUVX_PARUW RecName: Full=Putative Holliday junction resolvase
          Length = 150

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 79/144 (54%), Gaps = 9/144 (6%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITT------E 66
           KP++ I  ID G  RIGLA SD  +  A P   +   KK  QT ++LL  I+        
Sbjct: 6   KPSR-ILGIDFGMSRIGLAQSDERKIIAMPLITVHTEKKSEQTVIKLLETISQLCETQKC 64

Query: 67  NIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMN 126
            I   +IGLPL M+G  G      + F   ++ +   +P   WDERLTTV A++ L +  
Sbjct: 65  EIEEIVIGLPLMMSGRTGFLADEVKHFAQ-LLQQLTPIPIRLWDERLTTVQAERSLRESQ 123

Query: 127 VSRKKRIQKVDSIAAALILQEVLD 150
           ++RKKR + VD ++A++ILQ  LD
Sbjct: 124 LTRKKRSKVVDIVSASIILQSYLD 147


>gi|295695754|ref|YP_003588992.1| Holliday junction resolvase YqgF [Bacillus tusciae DSM 2912]
 gi|295411356|gb|ADG05848.1| Holliday junction resolvase YqgF [Bacillus tusciae DSM 2912]
          Length = 157

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 67/132 (50%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G  RIG+A+SDP    A     L           +   I    +   ++GLP N
Sbjct: 4   ILGLDVGRVRIGVAVSDPLGLVAQGLEVLAVDDEESALARIEGLIAEWGVERVVVGLPRN 63

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+ S G +   T  F   +  R V VP   WDERLTTV A++ LID  + R +R + VD 
Sbjct: 64  MDASLGAQGRYTEEFAEKLRHR-VRVPVDLWDERLTTVVAEKTLIDAGLRRARRKKVVDQ 122

Query: 139 IAAALILQEVLD 150
           +AA ++LQ  LD
Sbjct: 123 VAATVLLQSYLD 134


>gi|94991373|ref|YP_599473.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS10270]
 gi|118597223|sp|Q1JEI0|RUVX_STRPD RecName: Full=Putative Holliday junction resolvase
 gi|94544881|gb|ABF34929.1| Endonuclease involved in recombination [Streptococcus pyogenes
           MGAS10270]
          Length = 139

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 79/139 (56%), Gaps = 10/139 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFII 73
           I  +D+G+K +G+AISDP    A     +   K+ +   E     L   +    +  F+I
Sbjct: 3   IMGLDVGSKTVGVAISDPLGFTAQGLEII---KIDEEKAEFGFTRLEELVKQYQVEQFVI 59

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
           GLP NMN +  PRV ++  +  N I+    +P  + DERLTTV A+++LI+  ++SR KR
Sbjct: 60  GLPKNMNNTNSPRVDASITY-GNHIEHLFGLPVHYQDERLTTVEAERMLIEQADISRGKR 118

Query: 133 IQKVDSIAAALILQEVLDR 151
            + +D +AA LILQ  L+R
Sbjct: 119 KKVIDKLAAQLILQNYLNR 137


>gi|111224622|ref|YP_715416.1| Holliday junction resolvase-like protein [Frankia alni ACN14a]
 gi|111152154|emb|CAJ63884.1| Conserved hypothetical protein. Putative Holliday junction
           resolvase [Frankia alni ACN14a]
          Length = 205

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 68/131 (51%), Gaps = 1/131 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-LLSFITTENIAAFIIGLPLNM 79
            +D+G+ R+G+A SDPG   A P   L R K     +E L+  +        ++GLP  M
Sbjct: 33  GVDVGSVRVGVAASDPGGVLAVPVTTLARDKRHNADIEQLVQIVRDRQAVEVVVGLPRQM 92

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +G EG  V   R +V  + +R   VP  F DERLTTV+A + + +  V  + R   VD  
Sbjct: 93  SGQEGRAVQLVRQYVEVLAERIAPVPVRFVDERLTTVAAHRRMAERGVRSRARRSLVDQE 152

Query: 140 AAALILQEVLD 150
           AA  ILQ  LD
Sbjct: 153 AAVQILQHDLD 163


>gi|125972677|ref|YP_001036587.1| Holliday junction resolvase YqgF [Clostridium thermocellum ATCC
           27405]
 gi|256004836|ref|ZP_05429810.1| Holliday junction resolvase YqgF [Clostridium thermocellum DSM
           2360]
 gi|281416864|ref|ZP_06247884.1| Holliday junction resolvase YqgF [Clostridium thermocellum JW20]
 gi|167012716|sp|A3DBR5|RUVX_CLOTH RecName: Full=Putative Holliday junction resolvase
 gi|125712902|gb|ABN51394.1| Holliday junction resolvase YqgF [Clostridium thermocellum ATCC
           27405]
 gi|255991146|gb|EEU01254.1| Holliday junction resolvase YqgF [Clostridium thermocellum DSM
           2360]
 gi|281408266|gb|EFB38524.1| Holliday junction resolvase YqgF [Clostridium thermocellum JW20]
 gi|316941087|gb|ADU75121.1| Holliday junction resolvase YqgF [Clostridium thermocellum DSM
           1313]
          Length = 141

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 70/133 (52%), Gaps = 1/133 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPL 77
           +  ID G  RIG+AISDP    A     +  +   +  L+ +S +  E  +   I+G P 
Sbjct: 3   VLGIDYGDSRIGIAISDPLGWTAQALETITWRSDVEVPLKRISELVEEYGVKTVIVGFPK 62

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NM+G+ G R   T  F+  +  R   +  + WDERLTTV+A + + +M + + K+   VD
Sbjct: 63  NMDGTVGARGEKTIEFIDLLQQRIKDIEVIKWDERLTTVAANRTMYEMGIKKSKKKLVVD 122

Query: 138 SIAAALILQEVLD 150
            IAA  ILQ  LD
Sbjct: 123 QIAAVYILQGYLD 135


>gi|32475183|ref|NP_868177.1| an endonuclease [Rhodopirellula baltica SH 1]
 gi|62901008|sp|Q7UG74|RUVX_RHOBA RecName: Full=Putative Holliday junction resolvase
 gi|32445724|emb|CAD78455.1| conserved hypothetical protein-putative an endonuclease
           [Rhodopirellula baltica SH 1]
          Length = 173

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 79/144 (54%), Gaps = 13/144 (9%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHP---RPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +AS+D GT RIG+AI DP    A P    P    +K  Q  ++L     +E IAA+++GL
Sbjct: 18  LASVDYGTVRIGVAICDPDWILASPLEVHPVSTPEKDAQYFIDLAK---SERIAAWVVGL 74

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P++ +G E  +   +R F    +     +P   +DER TTV+A   +     +RKK  Q+
Sbjct: 75  PIHCDGGESDKSKESRKFA-AWLKETTGLPTRLFDERFTTVAANAKIRQGKTTRKKTKQR 133

Query: 136 VDSIAAALILQEVLDRISFLESSK 159
           VD++AA ++L+      SFLE+ +
Sbjct: 134 VDAVAAQVLLE------SFLEACR 151


>gi|37520701|ref|NP_924078.1| Holliday junction resolvase-like protein [Gloeobacter violaceus PCC
           7421]
 gi|62901004|sp|Q7NLJ1|RUVX_GLOVI RecName: Full=Putative Holliday junction resolvase
 gi|35211696|dbj|BAC89073.1| gll1132 [Gloeobacter violaceus PCC 7421]
          Length = 156

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 74/132 (56%), Gaps = 3/132 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +D+G+KRIG+A  DP    A     +VR  +      +  +I      A +IGLP N
Sbjct: 6   VLGLDVGSKRIGVAGCDPTGLIASGLETIVRCNLGADLDAIRHWIERRRAQAVVIGLPRN 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNGS GP+ H  + F   +  R + VP  + DERL+TV A + L  ++ +R+K +  +D 
Sbjct: 66  MNGSLGPQAHRIQHFGQQLA-RVIDVPIDYVDERLSTVQAGRALQSVSATRRKAL--IDQ 122

Query: 139 IAAALILQEVLD 150
            AAA+ILQ+ LD
Sbjct: 123 QAAAIILQQWLD 134


>gi|310658791|ref|YP_003936512.1| holliday junction resolvase [Clostridium sticklandii DSM 519]
 gi|308825569|emb|CBH21607.1| putative Holliday junction resolvase [Clostridium sticklandii]
          Length = 139

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 74/133 (55%), Gaps = 1/133 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G KRIG+A+SD     A P   L RK   +   E+   I  E+I   ++GLP N
Sbjct: 4   ILGLDIGDKRIGIAVSDLLGMMAQPLYTLTRKSTKEAINEIAEIIQKEDIKQVVVGLPKN 63

Query: 79  MNGSEGPRVHSTRAFVHNMIDR-KVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           M+ SEG +   TR F   ++++    +  ++ DERLT+  A+Q L  M +++ K  + +D
Sbjct: 64  MDSSEGIQAKRTRDFSQLLLEKTNSNIEIIYCDERLTSKMARQSLSHMKLAKAKEKKLID 123

Query: 138 SIAAALILQEVLD 150
           + AA  ILQ  LD
Sbjct: 124 TAAAVHILQGYLD 136


>gi|223044086|ref|ZP_03614125.1| conserved hypothetical protein [Staphylococcus capitis SK14]
 gi|314933782|ref|ZP_07841147.1| putative Holliday junction resolvase [Staphylococcus caprae C87]
 gi|222442480|gb|EEE48586.1| conserved hypothetical protein [Staphylococcus capitis SK14]
 gi|313653932|gb|EFS17689.1| putative Holliday junction resolvase [Staphylococcus caprae C87]
          Length = 142

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 76/137 (55%), Gaps = 4/137 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL---ELLSFITTENIAAFIIGL 75
           I  +D+G+K +G+AISD     A     L R    Q  L   EL+  I    +   +IGL
Sbjct: 6   IIGLDVGSKTVGIAISDLMGWTAQGLDTL-RINEEQNELGIEELVDIIKKNQVGTVVIGL 64

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN S G R  ++  +   + +    +  + WDERL+T++A++ L++ +VSR+KR + 
Sbjct: 65  PKNMNNSIGFRGEASLQYKEKLQEALPSIEIIMWDERLSTMAAERSLLEADVSRQKRKKV 124

Query: 136 VDSIAAALILQEVLDRI 152
           +D +AA  ILQ  LD I
Sbjct: 125 IDKMAAVFILQGYLDSI 141


>gi|325833474|ref|ZP_08165923.1| RNAse H domain protein, YqgF family [Eggerthella sp. HGA1]
 gi|325485398|gb|EGC87867.1| RNAse H domain protein, YqgF family [Eggerthella sp. HGA1]
          Length = 138

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 68/132 (51%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D+G  R+G+A+SDPG R A P   L   +V   A      +        + GLP  
Sbjct: 3   IMALDIGDTRVGVAVSDPGERVASPVAVLPASEVLNCAKPFQRVLEDWEPELLLCGLPYT 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M G+EGP+    R     + D    +P+ F DERL++  A++ L +  ++ K    K+D 
Sbjct: 63  MAGAEGPQAARIRKVAKTISD-ACGIPYEFADERLSSQEAKRSLREKGMTEKAMRGKIDM 121

Query: 139 IAAALILQEVLD 150
           IAA+L LQ  LD
Sbjct: 122 IAASLFLQAWLD 133


>gi|73662454|ref|YP_301235.1| Holliday junction resolvase-like protein [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
 gi|146291069|sp|Q49Y54|RUVX_STAS1 RecName: Full=Putative Holliday junction resolvase
 gi|72494969|dbj|BAE18290.1| putative endonuclease involved in recombination [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
          Length = 142

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 80/138 (57%), Gaps = 2/138 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALE-LLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISD     A     L + ++  +  +E L+  I  +N+   +IG
Sbjct: 4   HKIIGLDVGSKTVGIAISDLMGWTAQGLDTLRIDEENNELGIEALVKIIKRDNVGTVVIG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN S G R  ++  +   + +    +  + WDERL+T++A++ L++ +VSR+KR +
Sbjct: 64  LPKNMNNSIGFRGEASLQYKEQLQEALPSLEIIMWDERLSTMAAERSLLEADVSRQKRKK 123

Query: 135 KVDSIAAALILQEVLDRI 152
            +D +AA  ILQ  LD +
Sbjct: 124 VIDKMAAVFILQGYLDSL 141


>gi|319400946|gb|EFV89165.1| conserved hypothetical protein [Staphylococcus epidermidis FRI909]
          Length = 142

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL---ELLSFITTENIAAFII 73
             I  +D+G+K +G+AISD     A     L R    Q  L   +L+  I    +   +I
Sbjct: 4   HKILGLDVGSKTVGIAISDLMGWTAQGLDTL-RINEEQDDLGIDQLVKIIKDNQVGTVVI 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NMN S G R  ++  +   + D    +  V WDERL+T++A++ L++ +VSR+KR 
Sbjct: 63  GLPKNMNNSIGFRGEASIKYKEKLQDSVPSIDIVMWDERLSTMAAERSLLEADVSRQKRK 122

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA  ILQ  LD I
Sbjct: 123 KVIDKMAAVFILQGYLDSI 141


>gi|222151503|ref|YP_002560659.1| hypothetical protein MCCL_1256 [Macrococcus caseolyticus JCSC5402]
 gi|222120628|dbj|BAH17963.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402]
          Length = 139

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 73/132 (55%), Gaps = 2/132 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLPLN 78
            +D+G+K IG+A+SD     A     L + +      +E L   I T N+   +IGLP N
Sbjct: 6   GLDVGSKTIGVALSDAMGWTAQGLTTLRIDEANEDYGIEALKEIIETNNVTTAVIGLPKN 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MN + GP   ++  F   +      +  + WDERL+TV A++ L++ +VSRKKR Q +D 
Sbjct: 66  MNNTIGPSGEASLHFSEILKSACPELDIIMWDERLSTVGAERSLLEADVSRKKRKQVIDK 125

Query: 139 IAAALILQEVLD 150
           +AA  ILQ  L+
Sbjct: 126 MAAVFILQGYLN 137


>gi|323341498|ref|ZP_08081739.1| crossover junction endodeoxyribonuclease [Lactobacillus ruminis
           ATCC 25644]
 gi|323091109|gb|EFZ33740.1| crossover junction endodeoxyribonuclease [Lactobacillus ruminis
           ATCC 25644]
          Length = 148

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 81/133 (60%), Gaps = 4/133 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLPLN 78
            +D+G++ +G+A+SD     A     + + ++     +E +   +   ++  F++GLP N
Sbjct: 6   GLDVGSRTVGIAVSDELGWTAQGVEIIKINEEEAIFGIERVKELVEKYDVCGFVLGLPKN 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKVD 137
           MN + GPR  +++A+   +I+    +P  F DERLTTV A+++L++  + SRKKR + +D
Sbjct: 66  MNNTLGPRAEASKAYGELLIE-TFGLPIDFQDERLTTVEAERMLVEQADASRKKRKKVID 124

Query: 138 SIAAALILQEVLD 150
            +AA+LILQ  LD
Sbjct: 125 KLAASLILQNYLD 137


>gi|312898887|ref|ZP_07758275.1| conserved hypothetical protein TIGR00250 [Megasphaera
           micronuciformis F0359]
 gi|310620049|gb|EFQ03621.1| conserved hypothetical protein TIGR00250 [Megasphaera
           micronuciformis F0359]
          Length = 138

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 66/132 (50%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G+K IG+A SD     A     L R+   +  L L      + +   ++G P +
Sbjct: 3   ILGLDVGSKTIGVACSDALLLTAQAVGTLKRQSRRKDCLALADICKEKEVHRIVVGKPSH 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG +         FV  +         V+WDERLTTV AQ+ L++  V R+KR   VD+
Sbjct: 63  MNGDKSANTEKIEQFVEKLKKTVPQTEIVWWDERLTTVMAQRQLMEAGVRREKRKAVVDT 122

Query: 139 IAAALILQEVLD 150
           IAA  ILQ  LD
Sbjct: 123 IAAVFILQNYLD 134


>gi|328957194|ref|YP_004374580.1| Holliday junction resolvase-like protein [Carnobacterium sp. 17-4]
 gi|328673518|gb|AEB29564.1| Holliday junction resolvase-like protein [Carnobacterium sp. 17-4]
          Length = 140

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 76/137 (55%), Gaps = 10/137 (7%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFIIGL 75
            +D+G+K +G+A+SDP   F      +   K+ +T  E     +   I    +   +IGL
Sbjct: 5   GLDVGSKTVGVAVSDP---FGWTAQGIEIVKINETQEEYGIERIGELIKIHEVTKVVIGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQ 134
           P NMN S GPR  ++  +   +I     +P +  DERLTTV A+++LI+  N SR KR +
Sbjct: 62  PKNMNNSIGPRAEASLRYAE-LIKETFNLPVILQDERLTTVQAERMLIEEGNTSRAKRKK 120

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  L++
Sbjct: 121 VIDKVAAVMILQNYLNQ 137


>gi|291530568|emb|CBK96153.1| conserved hypothetical protein TIGR00250 [Eubacterium siraeum 70/3]
          Length = 149

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 75/133 (56%), Gaps = 3/133 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL-PL 77
           I ++D G    GLA  D  +  A P   ++ ++  QT +E ++    E     ++   P+
Sbjct: 3   IMAVDYGDAHTGLACCDRTQTLASP-IGVIDERNFQTCVEKVAAAAVEYEVGEVVVGNPI 61

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMNG+ GPR    R F  +M+   + +P V WDER TTV+A  ++ D+N   K+R + +D
Sbjct: 62  NMNGTYGPRSEKCRMFA-DMLQNFLEIPVVMWDERSTTVTAHNMMNDVNKRGKERKKVID 120

Query: 138 SIAAALILQEVLD 150
           ++AAA+ILQ  LD
Sbjct: 121 AVAAAVILQNYLD 133


>gi|167749575|ref|ZP_02421702.1| hypothetical protein EUBSIR_00533 [Eubacterium siraeum DSM 15702]
 gi|167657429|gb|EDS01559.1| hypothetical protein EUBSIR_00533 [Eubacterium siraeum DSM 15702]
 gi|291557838|emb|CBL34955.1| conserved hypothetical protein TIGR00250 [Eubacterium siraeum
           V10Sc8a]
          Length = 149

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 75/133 (56%), Gaps = 3/133 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL-PL 77
           I ++D G    GLA  D  +  A P   ++ ++  QT +E ++    E     ++   P+
Sbjct: 3   IMAVDYGDAHTGLACCDRTQTLASP-IGVIDERNFQTCVEKVAAAAVEYEVGEVVVGNPI 61

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMNG+ GPR    R F  +M+   + +P V WDER TTV+A  ++ D+N   K+R + +D
Sbjct: 62  NMNGTYGPRSEKCRMFA-DMLQNFLEIPVVMWDERSTTVTAHNMMNDVNKRGKERKKVID 120

Query: 138 SIAAALILQEVLD 150
           ++AAA+ILQ  LD
Sbjct: 121 AVAAAVILQNYLD 133


>gi|242373916|ref|ZP_04819490.1| crossover junction endodeoxyribonuclease [Staphylococcus
           epidermidis M23864:W1]
 gi|242348470|gb|EES40072.1| crossover junction endodeoxyribonuclease [Staphylococcus
           epidermidis M23864:W1]
          Length = 142

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 78/136 (57%), Gaps = 2/136 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALE-LLSFITTENIAAFIIGLP 76
           I  +D+G+K +G+AISD     A     L + ++  +  +E L+  I    +   +IGLP
Sbjct: 6   IIGLDVGSKTVGIAISDLMGWTAQGLDTLRINEEQNELGIEKLVEIIQDNQVGTVVIGLP 65

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMN S G R  ++  +   + +    +  + WDERL+T++A++ L++ +VSR+KR + +
Sbjct: 66  KNMNNSIGFRGEASLQYKEKLQEALPSIEIIMWDERLSTMAAERSLLEADVSRQKRKKVI 125

Query: 137 DSIAAALILQEVLDRI 152
           D +AA  ILQ  LD I
Sbjct: 126 DKMAAVFILQGYLDSI 141


>gi|257792292|ref|YP_003182898.1| Holliday junction resolvase YqgF [Eggerthella lenta DSM 2243]
 gi|317490213|ref|ZP_07948701.1| hypothetical protein HMPREF1023_02401 [Eggerthella sp. 1_3_56FAA]
 gi|257476189|gb|ACV56509.1| Holliday junction resolvase YqgF [Eggerthella lenta DSM 2243]
 gi|316910707|gb|EFV32328.1| hypothetical protein HMPREF1023_02401 [Eggerthella sp. 1_3_56FAA]
          Length = 138

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 68/132 (51%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D+G  R+G+A+SDPG R A P   L   +V   A      +        + GLP  
Sbjct: 3   IMALDIGETRVGVAVSDPGERVASPVAVLPASEVLNCAKPFQRALEDWEPELLLCGLPYT 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M G+EGP+    R     + D    +P+ F DERL++  A++ L +  ++ K    K+D 
Sbjct: 63  MAGAEGPQAARIRKAAKTISD-ACGIPYEFADERLSSQEAKRSLREKGMTEKAMRGKIDM 121

Query: 139 IAAALILQEVLD 150
           IAA+L LQ  LD
Sbjct: 122 IAASLFLQAWLD 133


>gi|260654149|ref|ZP_05859639.1| putative Holliday junction resolvase [Jonquetella anthropi E3_33
           E1]
 gi|260631134|gb|EEX49328.1| putative Holliday junction resolvase [Jonquetella anthropi E3_33
           E1]
          Length = 141

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 72/133 (54%), Gaps = 4/133 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL-ELLSFITTENIAAFIIGLPL 77
           I ++DLGT RIG+A++DP   FA               L EL++   T+ +   ++GLP 
Sbjct: 4   IIALDLGTVRIGVAVTDPLGTFAQGVECWDAASGWMGKLGELMAQYGTDRL---LLGLPR 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
             +G+EG      R     +  R   V   FWDER T+  AQ  +I+ ++SR+KR  KVD
Sbjct: 61  KEDGTEGEMAAKVRETAGRIAKRYPQVQIRFWDERYTSRVAQSAMIEGDLSRRKRKGKVD 120

Query: 138 SIAAALILQEVLD 150
            IAA+LILQ  +D
Sbjct: 121 QIAASLILQNFID 133


>gi|332686781|ref|YP_004456555.1| putative holliday junction resolvase [Melissococcus plutonius ATCC
           35311]
 gi|332370790|dbj|BAK21746.1| putative holliday junction resolvase [Melissococcus plutonius ATCC
           35311]
          Length = 140

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 76/133 (57%), Gaps = 4/133 (3%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +D+G+K +G+A+SD  G          + ++  Q   + L  +  E  I  F+IGLP N
Sbjct: 2   GLDVGSKTVGVAVSDLLGWTAQGIEIIRINEEKGQFGFDRLEELAEEYEITKFVIGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKVD 137
           MN S GPR  ++ AF   +      +P V+ DERLTTV A+++LI+  + SR KR + +D
Sbjct: 62  MNNSIGPRAEASLAFGEKL-QELFQLPVVYQDERLTTVQAERMLIEQADTSRAKRKKVID 120

Query: 138 SIAAALILQEVLD 150
            +AA +ILQ  LD
Sbjct: 121 KLAAVMILQNYLD 133


>gi|160931527|ref|ZP_02078922.1| hypothetical protein CLOLEP_00359 [Clostridium leptum DSM 753]
 gi|156869398|gb|EDO62770.1| hypothetical protein CLOLEP_00359 [Clostridium leptum DSM 753]
          Length = 139

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 72/135 (53%), Gaps = 7/135 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLV---RKKVTQTALELLSFITTENIAAFIIGL 75
           I  IDLG  R G+A+ D     A P   +    R+++ +  ++L +    E IA   +GL
Sbjct: 3   ILGIDLGKARTGVAVCDRAEMLASPLCVIQEHNRERLIEKIVKLSNERRAEQIA---LGL 59

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NM+GSEG    + R F   ++  K  +P  F DER TTV+A   L   +V  KKR   
Sbjct: 60  PKNMDGSEGESAQNAREF-GALLQEKTGLPVAFVDERGTTVTAHGYLNQTDVRGKKRKAV 118

Query: 136 VDSIAAALILQEVLD 150
           VDS+AA +ILQ  LD
Sbjct: 119 VDSVAAVIILQNYLD 133


>gi|157825581|ref|YP_001493301.1| Holliday junction resolvase-like protein [Rickettsia akari str.
           Hartford]
 gi|167012754|sp|A8GN18|RUVX_RICAH RecName: Full=Putative Holliday junction resolvase
 gi|157799539|gb|ABV74793.1| Holliday junction resolvase-like protein [Rickettsia akari str.
           Hartford]
          Length = 154

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 77/139 (55%), Gaps = 5/139 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFL--VRKKVTQTALELLSFITTENIAAFII 73
           N P+ +ID G+K++G+A+S+  R  A P   +  + KK+  T+L  LS +    +   +I
Sbjct: 16  NSPLIAIDYGSKKLGIALSNQERSIAMPLNTITEINKKIVITSL--LSIVEKYKVCGVVI 73

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G+P++M+G+   + +    F      + + +P    DERLTT +A   L    + RK R 
Sbjct: 74  GMPIDMSGAVTEQTNMVMKFAEEFT-KSINLPIYLQDERLTTKAANNFLKSFGMKRKDRD 132

Query: 134 QKVDSIAAALILQEVLDRI 152
              D++AA++IL+ VLD +
Sbjct: 133 NNDDAVAASMILETVLDSM 151


>gi|330684841|gb|EGG96531.1| RNAse H domain protein, YqgF family [Staphylococcus epidermidis
           VCU121]
          Length = 142

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 78/139 (56%), Gaps = 2/139 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTAL-ELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISD     A     L + +   +  + +L+  I    +   +IG
Sbjct: 4   HKILGLDVGSKTVGIAISDLMGWTAQGLDTLRIDENNNELGIDQLVDIIKKHGVGTVVIG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN S G R  ++  +   + +    +  + WDERL+T++A++ L++ +VSR+KR +
Sbjct: 64  LPKNMNNSIGFRGEASLQYKEKLQEALPSIEIIMWDERLSTMAAEKSLLEADVSRQKRKK 123

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA  ILQ  LD IS
Sbjct: 124 VIDKMAAVFILQGYLDSIS 142


>gi|116494331|ref|YP_806065.1| Holliday junction resolvase-like protein [Lactobacillus casei ATCC
           334]
 gi|191637663|ref|YP_001986829.1| Holliday junction resolvase-like protein [Lactobacillus casei BL23]
 gi|227534480|ref|ZP_03964529.1| crossover junction endodeoxyribonuclease [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
 gi|239629714|ref|ZP_04672745.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|301065842|ref|YP_003787865.1| RNase H-like ribonuclease [Lactobacillus casei str. Zhang]
 gi|122264241|sp|Q03AZ9|RUVX_LACC3 RecName: Full=Putative Holliday junction resolvase
 gi|226731624|sp|B3WC70|RUVX_LACCB RecName: Full=Putative Holliday junction resolvase
 gi|116104481|gb|ABJ69623.1| RNase H-like ribonuclease [Lactobacillus casei ATCC 334]
 gi|190711965|emb|CAQ65971.1| Putative Holliday junction resolvase [Lactobacillus casei BL23]
 gi|227187879|gb|EEI67946.1| crossover junction endodeoxyribonuclease [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
 gi|239528400|gb|EEQ67401.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|300438249|gb|ADK18015.1| RNase H-like ribonuclease [Lactobacillus casei str. Zhang]
 gi|327381721|gb|AEA53197.1| Putative Holliday junction resolvase [Lactobacillus casei LC2W]
 gi|327384886|gb|AEA56360.1| Putative Holliday junction resolvase [Lactobacillus casei BD-II]
          Length = 144

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 78/135 (57%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTAL-ELLSFITTENIAAFIIGLP 76
           +  +D+G++ +G+A+SDP    A     + + +   Q  +  L   +    + AF++GLP
Sbjct: 3   LMGLDVGSRTVGVAVSDPLGWTAQGLEIIRINEDKEQFGIARLKELVKQYEVTAFVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQK 135
            NMN S GPR   ++A+   ++     +P  F DERLTTV A ++LI + + SRK++ Q 
Sbjct: 63  KNMNNSIGPRAEKSQAY-GELLKTTFGLPVDFIDERLTTVEASRMLIEEADASRKRQKQV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA +ILQ  LD
Sbjct: 122 IDKLAAQMILQNYLD 136


>gi|157803931|ref|YP_001492480.1| Holliday junction resolvase-like protein [Rickettsia canadensis
           str. McKiel]
 gi|167012756|sp|A8EZB2|RUVX_RICCK RecName: Full=Putative Holliday junction resolvase
 gi|157785194|gb|ABV73695.1| Holliday junction resolvase-like protein [Rickettsia canadensis
           str. McKiel]
          Length = 154

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 76/147 (51%), Gaps = 1/147 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           +++  + L PN  + +ID G+K++G+A+S+  R  A P   +     T     +LS I  
Sbjct: 6   LQEFYRLLIPNTQLIAIDYGSKKLGIAMSNGERSIAMPLNTITVVNKTAVINSVLSIIAK 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
             I   +IGLP++M+G    + +    F   +  +   +P    DERLTT +A   L   
Sbjct: 66  YKICGVVIGLPIDMSGVVTQQTNIVMKFAEELA-KYTNLPIYLQDERLTTKAANNFLKSF 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRI 152
            V RK R    D++AA++IL+ VLD I
Sbjct: 125 GVKRKDRNNNDDAVAASMILETVLDSI 151


>gi|153005395|ref|YP_001379720.1| Holliday junction resolvase-like protein [Anaeromyxobacter sp.
           Fw109-5]
 gi|167012689|sp|A7HDE0|RUVX_ANADF RecName: Full=Putative Holliday junction resolvase
 gi|152028968|gb|ABS26736.1| Holliday junction resolvase YqgF [Anaeromyxobacter sp. Fw109-5]
          Length = 137

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 72/131 (54%), Gaps = 3/131 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLNM 79
            +DLG  RIGLA++D   R A P   +VR +  +  L  ++    E  +   ++GLPLNM
Sbjct: 5   GLDLGRARIGLALADDVLRTARPLS-VVRHRTREADLASIAATLREWEVGTAVVGLPLNM 63

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +GSEG      RAF   +  R   VP   +DERL+T  A+  L +   S ++   +VD+ 
Sbjct: 64  DGSEGASARYARAFAEELA-RATGVPVELFDERLSTFEAESRLREQGFSARELRGRVDAE 122

Query: 140 AAALILQEVLD 150
           AAA+ILQ  LD
Sbjct: 123 AAAVILQGWLD 133


>gi|32130063|sp|Q9CJ63|RUVX_LACLA RecName: Full=Putative Holliday junction resolvase
          Length = 143

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 74/134 (55%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+GTK +G+++SD     A P     +  +  +   E L  +  E      ++GLP
Sbjct: 5   ILGLDVGTKTVGVSVSDLLGMTAQPVETIKIDSEAGELGFERLGVLIKEYKPEKVVLGLP 64

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            +MNG EG R  ++R +   + + +  +   + DERLTT  A+++LID  V RK+R + +
Sbjct: 65  KHMNGDEGIRAEASRDYGTKLAN-EFGLEVAYQDERLTTAQAEKVLIDGGVRRKERKKSI 123

Query: 137 DSIAAALILQEVLD 150
           D +AA LILQ  LD
Sbjct: 124 DKLAAVLILQNYLD 137


>gi|270290966|ref|ZP_06197189.1| conserved hypothetical protein [Pediococcus acidilactici 7_4]
 gi|304385235|ref|ZP_07367580.1| crossover junction endodeoxyribonuclease [Pediococcus acidilactici
           DSM 20284]
 gi|270280362|gb|EFA26197.1| conserved hypothetical protein [Pediococcus acidilactici 7_4]
 gi|304328442|gb|EFL95663.1| crossover junction endodeoxyribonuclease [Pediococcus acidilactici
           DSM 20284]
          Length = 146

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLP 76
           +  +D+G++ +G+A+SD     A     + + +   +  +  +   ++   +A F+IGLP
Sbjct: 3   LMGMDVGSRTVGIAVSDQLGWTAQGVEIIPINEDEGEFGISRVKELVSQYEVAGFVIGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN +EGPRV + R +   ++     +P  F DERLTTV A+++LI+  + SR KR + 
Sbjct: 63  KNMNNTEGPRVEAARNY-GKLLTETFGLPIDFQDERLTTVEAERMLIEQADTSRSKRKKV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA+LIL+  L+
Sbjct: 122 IDKLAASLILENYLN 136


>gi|314936268|ref|ZP_07843615.1| putative Holliday junction resolvase [Staphylococcus hominis subsp.
           hominis C80]
 gi|313654887|gb|EFS18632.1| putative Holliday junction resolvase [Staphylococcus hominis subsp.
           hominis C80]
          Length = 142

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 81/138 (58%), Gaps = 2/138 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALE-LLSFITTENIAAFIIG 74
             I  +D+G++ +G+AISD     A     L + ++  +  ++ L+S I   N+ + +IG
Sbjct: 4   HKILGLDVGSRTVGIAISDLMGWTAQGLDTLRINEENEEFGIDRLVSIIKDNNVGSVVIG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN S G R  ++  +   + +    +  + WDERL+T++A++ L++ +VSR+KR +
Sbjct: 64  LPKNMNNSIGFRGEASLKYKELLQEALPNIEIIMWDERLSTMAAERSLLEADVSRQKRKK 123

Query: 135 KVDSIAAALILQEVLDRI 152
            +D +AA  ILQ  LD I
Sbjct: 124 VIDKMAAVFILQGYLDSI 141


>gi|229825002|ref|ZP_04451071.1| hypothetical protein GCWU000182_00351 [Abiotrophia defectiva ATCC
           49176]
 gi|229790749|gb|EEP26863.1| hypothetical protein GCWU000182_00351 [Abiotrophia defectiva ATCC
           49176]
          Length = 140

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 71/135 (52%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +DLG+K  G+A++D     A     + RK   K+ QT   +        +   ++G 
Sbjct: 3   IMGLDLGSKTCGVAVTDGLGLTAQGLEVIRRKEENKLRQTLARITELTEEYKVEKIVLGY 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NM+GS   R   +  F   +  R   +  + WDERLTTVSA +I+I+  + R++R + 
Sbjct: 63  PKNMDGSVSKRCELSEEFAKKLTGR-TGIEVILWDERLTTVSAHEIMIEAGLKREEREKI 121

Query: 136 VDSIAAALILQEVLD 150
           VD +AA  IL++ ++
Sbjct: 122 VDKVAAVFILEDYMN 136


>gi|260589075|ref|ZP_05854988.1| putative holliday junction resolvase [Blautia hansenii DSM 20583]
 gi|331082505|ref|ZP_08331630.1| Holliday junction resolvase [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260540495|gb|EEX21064.1| putative holliday junction resolvase [Blautia hansenii DSM 20583]
 gi|330400483|gb|EGG80113.1| Holliday junction resolvase [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 144

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 72/135 (53%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I  +D G+K IG+AISDP    A     + R+   K+ ++   +        ++  ++G 
Sbjct: 3   IMGLDYGSKTIGVAISDPLGITAQGIEIIRREEENKLRKSLRRVEELAKEYEVSEIVLGF 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + G R   +       ++R++ +P V WDERLTTV A + L++  V R+ R + 
Sbjct: 63  PKNMNNTIGERAEKSLQL-KEALERRLGLPVVMWDERLTTVEANRTLMETGVRRENRGKY 121

Query: 136 VDSIAAALILQEVLD 150
           VD IAA  ILQ  LD
Sbjct: 122 VDMIAAVFILQGYLD 136


>gi|261337333|ref|ZP_05965217.1| putative Holliday junction resolvase [Bifidobacterium gallicum DSM
           20093]
 gi|270277707|gb|EFA23561.1| putative Holliday junction resolvase [Bifidobacterium gallicum DSM
           20093]
          Length = 156

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 71/144 (49%), Gaps = 13/144 (9%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            +DLG  RIG A+SDP   FAHP   + VR        E+L+ I  E +   ++GLPL +
Sbjct: 5   GLDLGNARIGTALSDPQLTFAHPAGNITVRGNYGVEFDEVLAIIEDEQVDHVVVGLPLQL 64

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVY-----------VPFV-FWDERLTTVSAQQILIDMNV 127
           +G+EG      R +V  +I R V            +P V   DERLTTV A + L D  V
Sbjct: 65  DGTEGASARKARTWVRELIHRLVQEVADPRSGITTMPSVTLCDERLTTVDAHRRLHDAQV 124

Query: 128 SRKKRIQKVDSIAAALILQEVLDR 151
             +     VD  +A  ILQ  LD+
Sbjct: 125 QGRNHRAMVDQQSAVEILQSALDQ 148


>gi|224542878|ref|ZP_03683417.1| hypothetical protein CATMIT_02072 [Catenibacterium mitsuokai DSM
           15897]
 gi|224524208|gb|EEF93313.1| hypothetical protein CATMIT_02072 [Catenibacterium mitsuokai DSM
           15897]
          Length = 140

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 72/138 (52%), Gaps = 3/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAH--PRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           + I  +DLG++  G+AISD     AH             + A  + + +   NI   ++G
Sbjct: 2   EKILGLDLGSRTCGVAISDTLGMLAHGVETYHFSENAYKKCAYHIKNIVEENNIHTIVLG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP +MNG  G R   +  F   + ++ + V  +  DERLTTV A   LI  +VSRKKR Q
Sbjct: 62  LPKHMNGDLGERAQISIDFKERL-EKMMDVEVILEDERLTTVIATNNLIFGDVSRKKRKQ 120

Query: 135 KVDSIAAALILQEVLDRI 152
            VD +AA  ILQ  LD+I
Sbjct: 121 VVDKMAAVEILQGYLDKI 138


>gi|228475168|ref|ZP_04059894.1| conserved hypothetical protein [Staphylococcus hominis SK119]
 gi|228270779|gb|EEK12181.1| conserved hypothetical protein [Staphylococcus hominis SK119]
          Length = 142

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 81/138 (58%), Gaps = 2/138 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALE-LLSFITTENIAAFIIG 74
             I  +D+G++ +G+AISD     A     L + ++  +  ++ L+S I   N+ + +IG
Sbjct: 4   HKILGLDVGSRTVGIAISDLMGWTAQGLDTLRINEEDEEFGIDRLVSIIKDNNVGSVVIG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN S G R  ++  +   + +    +  + WDERL+T++A++ L++ +VSR+KR +
Sbjct: 64  LPKNMNNSIGFRGEASLKYKELLQEALPNIEIIMWDERLSTMAAERSLLEADVSRQKRKK 123

Query: 135 KVDSIAAALILQEVLDRI 152
            +D +AA  ILQ  LD I
Sbjct: 124 VIDKMAAVFILQGYLDSI 141


>gi|281490614|ref|YP_003352594.1| YqgF family resolvase [Lactococcus lactis subsp. lactis KF147]
 gi|161702205|gb|ABX75666.1| Resolvase, YqgF family [Lactococcus lactis subsp. lactis KF147]
          Length = 143

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 73/134 (54%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+GTK +G+++SD     A P     +  +  +   E L  +  E      ++GLP
Sbjct: 5   ILGLDVGTKTVGVSVSDLLGMTAQPVETIKIDSEAGELGFERLGVLIKEYKPEKVVLGLP 64

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            +MNG EG R  ++R +   + + +  +   + DERLTT  A+++LID  V RK R + +
Sbjct: 65  KHMNGDEGVRAEASRDYGTKLAN-EFGLEVAYQDERLTTAQAEKVLIDGGVRRKDRKKSI 123

Query: 137 DSIAAALILQEVLD 150
           D +AA LILQ  LD
Sbjct: 124 DKLAAVLILQNYLD 137


>gi|160915322|ref|ZP_02077535.1| hypothetical protein EUBDOL_01331 [Eubacterium dolichum DSM 3991]
 gi|158433121|gb|EDP11410.1| hypothetical protein EUBDOL_01331 [Eubacterium dolichum DSM 3991]
          Length = 137

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 77/134 (57%), Gaps = 4/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTAL-ELLSFITTENIAAFIIGLP 76
           +  +DLG++ +G+++SD     A P   +   ++   +A  ++ ++I    I   ++GLP
Sbjct: 3   VLGLDLGSRTLGVSVSDALGMIAQPVTTIRFEEEDYDSAFGQVQTYIKEYQIKTVVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            +MNG  G R   +  F   +    + V  V WDERLTTV+AQ+ILI  +VSRKKR + +
Sbjct: 63  KHMNGDVGIRGDISIMFKERL--ETLGVTVVLWDERLTTVAAQRILIAADVSRKKRKKVI 120

Query: 137 DSIAAALILQEVLD 150
           D +AA  ILQ  LD
Sbjct: 121 DQMAAVQILQGYLD 134


>gi|188996418|ref|YP_001930669.1| Holliday junction resolvase YqgF [Sulfurihydrogenibium sp. YO3AOP1]
 gi|226695309|sp|B2V842|RUVX_SULSY RecName: Full=Putative Holliday junction resolvase
 gi|188931485|gb|ACD66115.1| Holliday junction resolvase YqgF [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 145

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/141 (37%), Positives = 82/141 (58%), Gaps = 13/141 (9%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVR-KKVTQTALELLSFITTENIAAFIIGLPL 77
           I  +D+G KRIG+A+SDP    A P  F++  +KV +   +L   I    I+  +IGLPL
Sbjct: 4   ILGLDIGLKRIGVAVSDPFGVTATPLEFILNDEKVFEKINDL---IKNYKISKIVIGLPL 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVP----FVFWDERLTTVSAQQILIDMNVSRKKRI 133
            + G EG +   T+ FV N+   K ++P     +F DER T+  A++ L  +   +K + 
Sbjct: 61  TLKGEEGEQARYTKEFVENL---KNHIPQDIEIIFVDERFTSSLAEKTL--LQTKKKNKK 115

Query: 134 QKVDSIAAALILQEVLDRISF 154
           +K+DS++A  ILQ  LDR+SF
Sbjct: 116 EKIDSLSAVFILQTYLDRLSF 136


>gi|293400452|ref|ZP_06644597.1| putative Holliday junction resolvase [Erysipelotrichaceae bacterium
           5_2_54FAA]
 gi|291305478|gb|EFE46722.1| putative Holliday junction resolvase [Erysipelotrichaceae bacterium
           5_2_54FAA]
          Length = 140

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 76/135 (56%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTAL-ELLSFITTENIAAFIIGLP 76
           I  +DLG++ +G+++SD     A P       +    +AL ++  +I    +   ++GLP
Sbjct: 3   ILGLDLGSRTLGVSVSDALGMIARPVETIRFEQDDYDSALTQIKKYIDEFQVKKAVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            +MNG  G R   +  F   +    + V  + WDERLTTV+A++ILI  +VSRKKR + +
Sbjct: 63  KHMNGDVGIRGEISIMFKEKL--ETLGVEVILWDERLTTVAAERILISADVSRKKRKKVI 120

Query: 137 DSIAAALILQEVLDR 151
           D +AA  ILQ  LDR
Sbjct: 121 DQMAAVQILQGYLDR 135


>gi|125623030|ref|YP_001031513.1| putative Hollyday junction resolvase [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|167012732|sp|A2RHM2|RUVX_LACLM RecName: Full=Putative Holliday junction resolvase
 gi|124491838|emb|CAL96758.1| putative Hollyday junction resolvase [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|300069777|gb|ADJ59177.1| Holliday junction resolvase-like protein [Lactococcus lactis subsp.
           cremoris NZ9000]
          Length = 143

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 74/134 (55%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+GTK +G+++SD     A P     +  +  +   + L+ +  E      ++GLP
Sbjct: 5   ILGLDVGTKTVGVSVSDLLGMTAQPVETIKIDSEAGELGFDRLAVLIKEYKPEKVVLGLP 64

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            +MNG EG R  ++R +   + + K  +   + DERLTT  A+++LID  V RK R + +
Sbjct: 65  KHMNGDEGIRAEASRDYGTKLAN-KFGLEVAYQDERLTTAQAEKVLIDGGVRRKDRKKSI 123

Query: 137 DSIAAALILQEVLD 150
           D +AA LILQ  LD
Sbjct: 124 DKLAAVLILQNYLD 137


>gi|261366579|ref|ZP_05979462.1| putative Holliday junction resolvase [Subdoligranulum variabile DSM
           15176]
 gi|282571398|gb|EFB76933.1| putative Holliday junction resolvase [Subdoligranulum variabile DSM
           15176]
          Length = 156

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 66/131 (50%), Gaps = 2/131 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
           ++D G  R GLA  D       P  P +  K + + A  +            + GLP NM
Sbjct: 5   AVDYGDARTGLAGCDASETITSPITPQIEEKSMNKVAAAVTQVAVQRGAEGIVCGLPKNM 64

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +G+EG R   +R F   + +     P V WDER TTVSA  IL D +   +KR  ++DS+
Sbjct: 65  DGTEGSRAAKSRRFAQRLAN-TAGRPVVLWDERRTTVSATAILADNDTFGQKRKARLDSV 123

Query: 140 AAALILQEVLD 150
           +AA+IL+  L+
Sbjct: 124 SAAVILESFLN 134


>gi|242242890|ref|ZP_04797335.1| crossover junction endodeoxyribonuclease [Staphylococcus
           epidermidis W23144]
 gi|242233665|gb|EES35977.1| crossover junction endodeoxyribonuclease [Staphylococcus
           epidermidis W23144]
          Length = 142

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL---ELLSFITTENIAAFII 73
             I  +D+G+K +G+AISD     A     L R    Q  L   +L+  I    +   +I
Sbjct: 4   HKILGLDVGSKTVGIAISDLMGWTAQGLDTL-RINEEQEDLGIDQLVKIIKDNQVGTVVI 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NMN S G R  ++  +   + +    +  V WDERL+T++A++ L++ +VSR+KR 
Sbjct: 63  GLPKNMNNSIGFRGEASIKYKEKLQESVPSIDIVMWDERLSTMAAERSLLEADVSRQKRK 122

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA  ILQ  LD I
Sbjct: 123 KVIDKMAAVFILQGYLDSI 141


>gi|239622021|ref|ZP_04665052.1| holliday junction resolvase YqgF [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|296454024|ref|YP_003661167.1| Holliday junction resolvase YqgF [Bifidobacterium longum subsp.
           longum JDM301]
 gi|239515212|gb|EEQ55079.1| holliday junction resolvase YqgF [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|296183455|gb|ADH00337.1| Holliday junction resolvase YqgF [Bifidobacterium longum subsp.
           longum JDM301]
          Length = 156

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 74/144 (51%), Gaps = 13/144 (9%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            +DLG  R+GLA+SDP   FAHP   + V         E+L+ I  E++   I+GLPL M
Sbjct: 9   GVDLGNARVGLALSDPELTFAHPAGNIHVAGDYFFAIDEVLNVIEDEHVDHVIVGLPLQM 68

Query: 80  NGSEGPRVHSTRAFVHNMIDR-----------KVYVPFV-FWDERLTTVSAQQILIDMNV 127
           +G+EG      R +  N+  R           +  +P V   DERLTTVSA + L + + 
Sbjct: 69  DGTEGKSAKKARRWAANLEKRLQAESEDSDSTEYQIPQVSLIDERLTTVSAHRQLFEAHK 128

Query: 128 SRKKRIQKVDSIAAALILQEVLDR 151
           +  K    VD  +A +ILQ  LDR
Sbjct: 129 ASNKHRPVVDQQSAVVILQTALDR 152


>gi|326405717|gb|ADZ62788.1| YqgF family resolvase [Lactococcus lactis subsp. lactis CV56]
          Length = 143

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 73/134 (54%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+GTK +G+++SD     A P     +  +  +   E L  +  E      ++GLP
Sbjct: 5   ILGLDVGTKTVGVSVSDLLGMTAQPVETIKIDSEAGELGFERLGVLIKEYKPEKVVLGLP 64

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            +MNG EG R  ++R +   + + +  +   + DERLTT  A+++LID  V RK R + +
Sbjct: 65  KHMNGDEGIRAEASRDYGTKLAN-EFGLEVAYQDERLTTAQAEKVLIDGGVRRKDRKKSI 123

Query: 137 DSIAAALILQEVLD 150
           D +AA LILQ  LD
Sbjct: 124 DKLAAVLILQNYLD 137


>gi|213692472|ref|YP_002323058.1| Holliday junction resolvase YqgF [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|254767498|sp|B7GSA0|RUVX_BIFLI RecName: Full=Putative Holliday junction resolvase
 gi|213523933|gb|ACJ52680.1| Holliday junction resolvase YqgF [Bifidobacterium longum subsp.
           infantis ATCC 15697]
          Length = 151

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 74/144 (51%), Gaps = 13/144 (9%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            +DLG  R+GLA+SDP   FAHP   + V         E+L+ I  E++   I+GLPL M
Sbjct: 5   GVDLGNARVGLALSDPELTFAHPAGNIHVAGDYFFAIDEVLNVIEDEHVDHVIVGLPLQM 64

Query: 80  NGSEGPRVHSTRAFVHNMIDR-----------KVYVPFV-FWDERLTTVSAQQILIDMNV 127
           +G+EG      R +  N+  R           +  +P V   DERLTTVSA + L + + 
Sbjct: 65  DGTEGKSAKKARRWAANLEKRLQAESEDSDSTEYQIPQVSLIDERLTTVSAHRQLFEAHK 124

Query: 128 SRKKRIQKVDSIAAALILQEVLDR 151
           +  K    VD  +A +ILQ  LDR
Sbjct: 125 ASNKHRPVVDQQSAVVILQTALDR 148


>gi|189439478|ref|YP_001954559.1| putative endonuclease for recombination [Bifidobacterium longum
           DJO10A]
 gi|227545931|ref|ZP_03975980.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Bifidobacterium longum subsp. infantis ATCC 55813]
 gi|312132885|ref|YP_004000224.1| endonuclease for recombination [Bifidobacterium longum subsp.
           longum BBMN68]
 gi|317482214|ref|ZP_07941236.1| hypothetical protein HMPREF0177_00629 [Bifidobacterium sp.
           12_1_47BFAA]
 gi|32130036|sp|Q8G5X0|RUVX_BIFLO RecName: Full=Putative Holliday junction resolvase
 gi|226725490|sp|B3DSE2|RUVX_BIFLD RecName: Full=Putative Holliday junction resolvase
 gi|189427913|gb|ACD98061.1| Putative endonuclease for recombination [Bifidobacterium longum
           DJO10A]
 gi|227213565|gb|EEI81414.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Bifidobacterium longum subsp. infantis ATCC 55813]
 gi|311773856|gb|ADQ03344.1| Putative endonuclease for recomBination [Bifidobacterium longum
           subsp. longum BBMN68]
 gi|316916352|gb|EFV37752.1| hypothetical protein HMPREF0177_00629 [Bifidobacterium sp.
           12_1_47BFAA]
          Length = 152

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 74/144 (51%), Gaps = 13/144 (9%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            +DLG  R+GLA+SDP   FAHP   + V         E+L+ I  E++   I+GLPL M
Sbjct: 5   GVDLGNARVGLALSDPELTFAHPAGNIHVAGDYFFAIDEVLNVIEDEHVDHVIVGLPLQM 64

Query: 80  NGSEGPRVHSTRAFVHNMIDR-----------KVYVPFV-FWDERLTTVSAQQILIDMNV 127
           +G+EG      R +  N+  R           +  +P V   DERLTTVSA + L + + 
Sbjct: 65  DGTEGKSAKKARRWAANLEKRLQAESEDSDSTEYQIPQVSLIDERLTTVSAHRQLFEAHK 124

Query: 128 SRKKRIQKVDSIAAALILQEVLDR 151
           +  K    VD  +A +ILQ  LDR
Sbjct: 125 ASNKHRPVVDQQSAVVILQTALDR 148


>gi|257870135|ref|ZP_05649788.1| conserved hypothetical protein [Enterococcus gallinarum EG2]
 gi|257804299|gb|EEV33121.1| conserved hypothetical protein [Enterococcus gallinarum EG2]
          Length = 140

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 77/133 (57%), Gaps = 4/133 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +D+G++ +G+A+SDP    A     + + +       + L  +  E  +  F++GLP N
Sbjct: 2   GLDVGSRTVGVAVSDPMGWTAQGIEIIRINEDENDFGYDRLGELVKEYEVTRFVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKVD 137
           MN + GPR  ++ A+    I+ +  +P  + DERLTTV A+++L++  N SR KR + +D
Sbjct: 62  MNNTIGPRAEASLAY-GKAIEERFDLPVDYQDERLTTVQAERMLVEQANTSRAKRKKVID 120

Query: 138 SIAAALILQEVLD 150
            +AA +ILQ  LD
Sbjct: 121 KLAAVMILQNYLD 133


>gi|27468217|ref|NP_764854.1| hypothetical protein SE1299 [Staphylococcus epidermidis ATCC 12228]
 gi|57867099|ref|YP_188756.1| hypothetical protein SERP1180 [Staphylococcus epidermidis RP62A]
 gi|251811023|ref|ZP_04825496.1| crossover junction endodeoxyribonuclease [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|282875958|ref|ZP_06284825.1| RNAse YqgF [Staphylococcus epidermidis SK135]
 gi|293366426|ref|ZP_06613104.1| conserved hypothetical protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|32130023|sp|Q8CSA9|RUVX_STAES RecName: Full=Putative Holliday junction resolvase
 gi|62900904|sp|Q5HNT4|RUVX_STAEQ RecName: Full=Putative Holliday junction resolvase
 gi|27315763|gb|AAO04898.1|AE016748_132 conserved hypothetical protein [Staphylococcus epidermidis ATCC
           12228]
 gi|57637757|gb|AAW54545.1| conserved hypothetical protein TIGR00250 [Staphylococcus
           epidermidis RP62A]
 gi|251805441|gb|EES58098.1| crossover junction endodeoxyribonuclease [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|281294983|gb|EFA87510.1| RNAse YqgF [Staphylococcus epidermidis SK135]
 gi|291319460|gb|EFE59828.1| conserved hypothetical protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329735297|gb|EGG71589.1| RNAse H domain protein, YqgF family [Staphylococcus epidermidis
           VCU045]
 gi|329737275|gb|EGG73529.1| RNAse H domain protein, YqgF family [Staphylococcus epidermidis
           VCU028]
          Length = 142

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL---ELLSFITTENIAAFII 73
             I  +D+G+K +G+AISD     A     L R    Q  L   +L+  I    +   +I
Sbjct: 4   HKILGLDVGSKTVGIAISDLMGWTAQGLDTL-RINEEQDDLGIDQLVKIIKDNQVGTVVI 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NMN S G R  ++  +   + +    +  V WDERL+T++A++ L++ +VSR+KR 
Sbjct: 63  GLPKNMNNSIGFRGEASIKYKEKLQESIPSIDIVMWDERLSTMAAERSLLEADVSRQKRK 122

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA  ILQ  LD I
Sbjct: 123 KVIDKMAAVFILQGYLDSI 141


>gi|69245163|ref|ZP_00603287.1| Conserved hypothetical protein 250 [Enterococcus faecium DO]
 gi|257879617|ref|ZP_05659270.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257883923|ref|ZP_05663576.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
 gi|257890284|ref|ZP_05669937.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
 gi|258616772|ref|ZP_05714542.1| Holliday junction resolvase-like protein [Enterococcus faecium DO]
 gi|260559720|ref|ZP_05831900.1| conserved hypothetical protein [Enterococcus faecium C68]
 gi|261208764|ref|ZP_05923201.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289565552|ref|ZP_06445999.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|293560123|ref|ZP_06676627.1| conserved hypothetical protein [Enterococcus faecium E1162]
 gi|294614420|ref|ZP_06694336.1| hypothetical protein EfmE1636_0526 [Enterococcus faecium E1636]
 gi|294617987|ref|ZP_06697592.1| conserved hypothetical protein [Enterococcus faecium E1679]
 gi|314939503|ref|ZP_07846735.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133a04]
 gi|314944177|ref|ZP_07850822.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133C]
 gi|314949753|ref|ZP_07853063.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0082]
 gi|314951904|ref|ZP_07854936.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133A]
 gi|314994470|ref|ZP_07859749.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133B]
 gi|314997874|ref|ZP_07862775.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133a01]
 gi|68196006|gb|EAN10439.1| Conserved hypothetical protein 250 [Enterococcus faecium DO]
 gi|257813845|gb|EEV42603.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257819761|gb|EEV46909.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
 gi|257826644|gb|EEV53270.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
 gi|260074388|gb|EEW62710.1| conserved hypothetical protein [Enterococcus faecium C68]
 gi|260077266|gb|EEW64986.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289162634|gb|EFD10487.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|291592728|gb|EFF24321.1| hypothetical protein EfmE1636_0526 [Enterococcus faecium E1636]
 gi|291595796|gb|EFF27084.1| conserved hypothetical protein [Enterococcus faecium E1679]
 gi|291605990|gb|EFF35420.1| conserved hypothetical protein [Enterococcus faecium E1162]
 gi|313588099|gb|EFR66944.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133a01]
 gi|313591125|gb|EFR69970.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133B]
 gi|313595938|gb|EFR74783.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133A]
 gi|313597239|gb|EFR76084.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133C]
 gi|313641204|gb|EFS05784.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133a04]
 gi|313643826|gb|EFS08406.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0082]
          Length = 143

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 76/138 (55%), Gaps = 10/138 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFII 73
           +  +D+G+K +G+AISDP   F      +   ++ +   E     L   +    +  F++
Sbjct: 3   VMGLDVGSKTVGVAISDP---FGWTAQGVEIIRINEAEEEFGFDRLKELVAQYEVDRFVV 59

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
           GLP NMN S GPR  ++ ++    I     +P  + DERLTTV A+++L++  N SR KR
Sbjct: 60  GLPKNMNNSIGPRAEASMSYGEK-IKELFSLPVDYQDERLTTVQAERMLVEQANTSRAKR 118

Query: 133 IQKVDSIAAALILQEVLD 150
            + +D +AA +ILQ  LD
Sbjct: 119 KKVIDKLAAVMILQNYLD 136


>gi|86741899|ref|YP_482299.1| Holliday junction resolvase-like protein [Frankia sp. CcI3]
 gi|124107440|sp|Q2J822|RUVX_FRASC RecName: Full=Putative Holliday junction resolvase
 gi|86568761|gb|ABD12570.1| Holliday junction resolvase YqgF [Frankia sp. CcI3]
          Length = 202

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 68/131 (51%), Gaps = 1/131 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIA-AFIIGLPLNM 79
            +D+G+ R+G+A SDPG   A P   L R +     ++ L  I  E  A   ++GLP  M
Sbjct: 28  GVDVGSVRVGVAASDPGGVLAVPVTTLARDRRGNADIDQLVLIVRERQAVEVVVGLPRQM 87

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +G EG  V   R +   + +R   VP  F DERLTTV+A + + +  V  + R   VD  
Sbjct: 88  SGQEGRAVRLVRQYAEVLAERIAPVPVRFVDERLTTVAAHRRMAERGVRSRARRSLVDQE 147

Query: 140 AAALILQEVLD 150
           AA  ILQ  LD
Sbjct: 148 AAVQILQHDLD 158


>gi|85858514|ref|YP_460716.1| 4-amino-4-deoxychorismate lyase [Syntrophus aciditrophicus SB]
 gi|146325615|sp|Q2LR42|RUVX_SYNAS RecName: Full=Putative Holliday junction resolvase
 gi|85721605|gb|ABC76548.1| 4-amino-4-deoxychorismate lyase [Syntrophus aciditrophicus SB]
          Length = 150

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 71/135 (52%), Gaps = 1/135 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D G KRIG+A+ D     A     ++RK        + S + T ++   +IG PL 
Sbjct: 3   ILGLDYGEKRIGVALCDELGLTAQALTTVIRKSWRNDVGIIASLVRTYDVEKIVIGYPLR 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           ++G+EG +      F   + +  + +P + WDE LTT  A++IL    V  +KR   VD 
Sbjct: 63  LDGTEGIQCEKVVRFARRL-EAALGIPVIRWDETLTTKEAEEILSRSGVPPRKRRGVVDR 121

Query: 139 IAAALILQEVLDRIS 153
           +AA+LILQ  LD IS
Sbjct: 122 LAASLILQSYLDAIS 136


>gi|291456670|ref|ZP_06596060.1| putative Holliday junction resolvase [Bifidobacterium breve DSM
           20213]
 gi|291381947|gb|EFE89465.1| putative Holliday junction resolvase [Bifidobacterium breve DSM
           20213]
          Length = 150

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 73/142 (51%), Gaps = 11/142 (7%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            +DLG  R+GLA+SDP   FAHP   + V         E+L+ +  E++   I+GLPL M
Sbjct: 5   GVDLGNARVGLALSDPELTFAHPAGNIHVAGDYFFAIDEVLNVVEDEHVTHIIVGLPLQM 64

Query: 80  NGSEGPRVHSTRAFVHNMIDR---------KVYVP-FVFWDERLTTVSAQQILIDMNVSR 129
           +G+EG      R +  N+  R         +  +P  V  DERLTTVSA + L +   + 
Sbjct: 65  DGTEGKSAKKARRWAVNLEKRLRSEREESQEPQIPQVVLVDERLTTVSAHRQLFEAQKAS 124

Query: 130 KKRIQKVDSIAAALILQEVLDR 151
            K    VD  +A +ILQ  LDR
Sbjct: 125 TKHRPMVDQQSAVVILQTALDR 146


>gi|121535968|ref|ZP_01667762.1| Holliday junction resolvase YqgF [Thermosinus carboxydivorans Nor1]
 gi|121305460|gb|EAX46408.1| Holliday junction resolvase YqgF [Thermosinus carboxydivorans Nor1]
          Length = 140

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 68/135 (50%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D+G K IG A+SD     A     + R         +            I+GLP N
Sbjct: 3   ILALDVGEKTIGAAVSDELLLTAQGVEVIRRMSPEADMARIRELAEHFEATVIIVGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ GP+    +AF   + +    +    WDERL+TV+A++ LI  +V R KR Q +D 
Sbjct: 63  MNGTIGPQGEKVKAFASELQNYLAGIEVRLWDERLSTVAAERSLIAADVRRAKRRQVIDK 122

Query: 139 IAAALILQEVLDRIS 153
           +AA  ILQ  LD +S
Sbjct: 123 MAAVFILQGYLDSLS 137


>gi|332975378|gb|EGK12272.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Desmospora sp. 8437]
          Length = 141

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 79/142 (55%), Gaps = 8/142 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +DLG KR+G+A+SDP    A     L R+        L   I    + A ++GLP N
Sbjct: 4   IMGLDLGEKRVGVAVSDPMGWTAQGVDVL-RRDQPDWMDRLARLIEDYEVEALVVGLPRN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+GS G +  + R     + +R   +P   WDERL+TV+ ++ LID ++SR+KR + VD 
Sbjct: 63  MDGSIGAKGEACRQLGRELEER-FQIPVELWDERLSTVAVERTLIDADLSRRKRRKVVDR 121

Query: 139 IAAALILQEVLDRISFLESSKG 160
           +AA+ ILQ       +LE+ +G
Sbjct: 122 MAASWILQ------GYLEARRG 137


>gi|282882848|ref|ZP_06291453.1| putative Holliday junction resolvase [Peptoniphilus lacrimalis
           315-B]
 gi|300814171|ref|ZP_07094454.1| RNAse YqgF [Peptoniphilus sp. oral taxon 836 str. F0141]
 gi|281297259|gb|EFA89750.1| putative Holliday junction resolvase [Peptoniphilus lacrimalis
           315-B]
 gi|300511828|gb|EFK39045.1| RNAse YqgF [Peptoniphilus sp. oral taxon 836 str. F0141]
          Length = 147

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 77/142 (54%), Gaps = 7/142 (4%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +D+G K IG+AISD     A P   + R    +   ++   I   ++   ++GLP N
Sbjct: 4   VLGLDVGEKWIGVAISDETFTIATPLETIERTSNKEAYDKIHDLIEKYDVKKIVVGLPKN 63

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MN + GP     + F   + + K  +  V+ DER+TT+ A+ +L++ +V R+ R + VD 
Sbjct: 64  MNNTLGPTCQMVQKFSEKLKN-KFRLELVYVDERMTTLMAKDVLMEASVRRENRKKYVDK 122

Query: 139 IAAALILQEVLDRISFLESSKG 160
           IAAA IL+      ++++SS G
Sbjct: 123 IAAAFILK------TYMDSSDG 138


>gi|328954563|ref|YP_004371897.1| Holliday junction resolvase [Desulfobacca acetoxidans DSM 11109]
 gi|328454887|gb|AEB10716.1| Holliday junction resolvase [Desulfobacca acetoxidans DSM 11109]
          Length = 144

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 74/132 (56%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +DLG+KRIG+A+SD     A     + R    +    +L  +    +   +IGLP +
Sbjct: 3   ILGLDLGSKRIGIALSDALGWTAQGLTVIHRAGRARDLARVLELVKKYEVQEIVIGLPRH 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           ++G  G       A+   + +  +++P   WDERLTT+ A+++L+  ++SR+KR Q +D 
Sbjct: 63  LDGRLGEGAEEALAWAAELRE-HLHIPVHTWDERLTTLQAERVLLQADLSRRKRRQVIDK 121

Query: 139 IAAALILQEVLD 150
           +AA LILQ  LD
Sbjct: 122 LAAGLILQAFLD 133


>gi|227552124|ref|ZP_03982173.1| crossover junction endodeoxyribonuclease [Enterococcus faecium
           TX1330]
 gi|257882634|ref|ZP_05662287.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|257886706|ref|ZP_05666359.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257894866|ref|ZP_05674519.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
 gi|257895281|ref|ZP_05674934.1| conserved hypothetical protein [Enterococcus faecium Com12]
 gi|257897895|ref|ZP_05677548.1| conserved hypothetical protein [Enterococcus faecium Com15]
 gi|293553141|ref|ZP_06673779.1| conserved hypothetical protein [Enterococcus faecium E1039]
 gi|293568771|ref|ZP_06680085.1| conserved hypothetical protein [Enterococcus faecium E1071]
 gi|293571039|ref|ZP_06682081.1| conserved hypothetical protein [Enterococcus faecium E980]
 gi|227178706|gb|EEI59678.1| crossover junction endodeoxyribonuclease [Enterococcus faecium
           TX1330]
 gi|257818292|gb|EEV45620.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|257822760|gb|EEV49692.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257831245|gb|EEV57852.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
 gi|257831846|gb|EEV58267.1| conserved hypothetical protein [Enterococcus faecium Com12]
 gi|257835807|gb|EEV60881.1| conserved hypothetical protein [Enterococcus faecium Com15]
 gi|291588488|gb|EFF20322.1| conserved hypothetical protein [Enterococcus faecium E1071]
 gi|291602732|gb|EFF32946.1| conserved hypothetical protein [Enterococcus faecium E1039]
 gi|291608879|gb|EFF38159.1| conserved hypothetical protein [Enterococcus faecium E980]
          Length = 143

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 76/138 (55%), Gaps = 10/138 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFII 73
           +  +D+G+K +G+A+SDP   F      +   ++ +   E     L   +    +  F++
Sbjct: 3   VMGLDVGSKTVGVAVSDP---FGWTAQGVEIIRINEAEEEFGFDRLKELVAQYEVDRFVV 59

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
           GLP NMN S GPR  ++ ++    I     +P  + DERLTTV A+++L++  N SR KR
Sbjct: 60  GLPKNMNNSIGPRAEASMSYGEK-IKELFSLPVDYQDERLTTVQAERMLVEQANTSRAKR 118

Query: 133 IQKVDSIAAALILQEVLD 150
            + +D +AA +ILQ  LD
Sbjct: 119 KKVIDKLAAVMILQNYLD 136


>gi|262198569|ref|YP_003269778.1| Holliday junction resolvase YqgF [Haliangium ochraceum DSM 14365]
 gi|262081916|gb|ACY17885.1| Holliday junction resolvase YqgF [Haliangium ochraceum DSM 14365]
          Length = 139

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 70/134 (52%), Gaps = 7/134 (5%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+G K IG+A SD     AHP   + R+        + + ++       ++GLPL ++
Sbjct: 6   GLDVGMKTIGVAGSDELGLAAHPVETIARRGTGPDVARVCALVSEREATDVVVGLPLELS 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVP----FVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           G EG R    R  +  +   +  +P       WDER +T + +++LI+ ++SR+KR Q +
Sbjct: 66  GQEGRRARRVRVLIDAL---RAALPDEVAVHTWDERFSTAAVERVLIEADMSRRKRKQVI 122

Query: 137 DSIAAALILQEVLD 150
           D  AAA ILQ  LD
Sbjct: 123 DKQAAAYILQGWLD 136


>gi|163790356|ref|ZP_02184788.1| Holliday junction resolvase-like protein [Carnobacterium sp. AT7]
 gi|159874427|gb|EDP68499.1| Holliday junction resolvase-like protein [Carnobacterium sp. AT7]
          Length = 140

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 75/137 (54%), Gaps = 10/137 (7%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFIIGL 75
            +D+G+K +G+A+SDP   F      +   K+ +   E     +   I    +   +IGL
Sbjct: 5   GLDVGSKTVGVAVSDP---FGWTAQGIEIVKINEAQEEYGIDRIGELIAIHEVTKVVIGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQ 134
           P NMN S GPR  ++  +   ++     +P +  DERLTTV A+++LI+  N SR KR +
Sbjct: 62  PKNMNNSIGPRAEASLRYAE-LVKETFGLPVILQDERLTTVQAERMLIEEGNTSRAKRKK 120

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  L++
Sbjct: 121 VIDKVAAVMILQNYLNQ 137


>gi|47097199|ref|ZP_00234763.1| conserved hypothetical protein TIGR00250 [Listeria monocytogenes
           str. 1/2a F6854]
 gi|47014413|gb|EAL05382.1| conserved hypothetical protein TIGR00250 [Listeria monocytogenes
           str. 1/2a F6854]
          Length = 117

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 69/116 (59%), Gaps = 3/116 (2%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G+K +G+AISDP G          + +   Q   + +  +  E  +   ++GLP
Sbjct: 3   IMGLDVGSKTVGVAISDPLGWTAQGVETIQIDENRKQFGYDRVKELVLEYEVEKVVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
            NMN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR
Sbjct: 63  KNMNNTIGPRAESSKIYAE-VLEARIGLPVVLWDERLTTSAAERTLIEADVSRKKR 117


>gi|225351925|ref|ZP_03742948.1| hypothetical protein BIFPSEUDO_03529 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225157172|gb|EEG70511.1| hypothetical protein BIFPSEUDO_03529 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 157

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 75/144 (52%), Gaps = 13/144 (9%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL-ELLSFITTENIAAFIIGLPLNM 79
            IDLG  R+GLA+SDPG   AHP   +     +  AL E++  I  E++   ++GLPL +
Sbjct: 5   GIDLGDARVGLALSDPGITLAHPAGNIQVYGDSFRALDEVVDVIEDESVDHVVVGLPLLL 64

Query: 80  NGSEGPRVHSTRAFVHNM-------IDRKVY----VPFV-FWDERLTTVSAQQILIDMNV 127
           +G EG      R +  N+       +D + Y    VP +   DERLTTV+A   L D  V
Sbjct: 65  SGEEGKSAKKARRWTVNLEKRLRVAVDDENYALKEVPSIELVDERLTTVTAHHQLFDAQV 124

Query: 128 SRKKRIQKVDSIAAALILQEVLDR 151
             +K    VD  +A +ILQ  +DR
Sbjct: 125 GGRKHRPMVDQQSAVVILQTAIDR 148


>gi|304440513|ref|ZP_07400400.1| crossover junction endodeoxyribonuclease [Peptoniphilus duerdenii
           ATCC BAA-1640]
 gi|304370991|gb|EFM24610.1| crossover junction endodeoxyribonuclease [Peptoniphilus duerdenii
           ATCC BAA-1640]
          Length = 141

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 72/133 (54%), Gaps = 1/133 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+G K IG++ISD     A     + R    +   E+   +   NI   ++G+P+NM+
Sbjct: 6   GLDVGDKYIGVSISDTTCTIASNLVTIRRTSNDKAYEEIEGILNDYNIGTVVVGVPINMD 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GS+       R F   +   K  V  +F DER T++ A++ LI  NV R+ R + +D +A
Sbjct: 66  GSDTVMSKRIRKFARKLTP-KFGVEVIFQDERFTSIEAERTLIQSNVRRENRKKYIDQLA 124

Query: 141 AALILQEVLDRIS 153
           A++ILQ  +DR++
Sbjct: 125 ASIILQTYIDRMN 137


>gi|309775358|ref|ZP_07670363.1| putative Holliday junction resolvase [Erysipelotrichaceae bacterium
           3_1_53]
 gi|308916875|gb|EFP62610.1| putative Holliday junction resolvase [Erysipelotrichaceae bacterium
           3_1_53]
          Length = 137

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 72/134 (53%), Gaps = 4/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLS-FITTENIAAFIIGLP 76
           I  +DLG+K +G+++SD     A P             A E +  +I    +   ++GLP
Sbjct: 3   ILGLDLGSKTLGVSVSDALGMIARPVETIRFESDDYDAAFEQVQKYIKEFQVTTAVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            +MNG  G R   +  F   +    + +  V WDERLTTV+A++ILI  +VSRKKR + +
Sbjct: 63  KHMNGDVGIRGEISVMFKEKL--ETLGLEVVLWDERLTTVAAEKILISADVSRKKRKKII 120

Query: 137 DSIAAALILQEVLD 150
           D +AA  ILQ  LD
Sbjct: 121 DQMAAVQILQSYLD 134


>gi|116510965|ref|YP_808181.1| RNase H-like ribonuclease [Lactococcus lactis subsp. cremoris SK11]
 gi|123125957|sp|Q032W3|RUVX_LACLS RecName: Full=Putative Holliday junction resolvase
 gi|116106619|gb|ABJ71759.1| RNase H-like ribonuclease [Lactococcus lactis subsp. cremoris SK11]
          Length = 143

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 74/134 (55%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+GTK +G+++SD     A P     +  +  +   + L+ +  E      ++GLP
Sbjct: 5   ILGLDVGTKTVGVSVSDLLGMTAQPVETIKIDSEAGELGFDRLAVLIKEYKPEKVVLGLP 64

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            +MNG EG R  ++R +   + + +  +   + DERLTT  A+++LID  V RK R + +
Sbjct: 65  KHMNGDEGIRAEASRDYGTKLAN-EFSLEVAYQDERLTTAQAEKVLIDGGVRRKDRKKSI 123

Query: 137 DSIAAALILQEVLD 150
           D +AA LILQ  LD
Sbjct: 124 DKLAAVLILQNYLD 137


>gi|84496691|ref|ZP_00995545.1| hypothetical protein JNB_04190 [Janibacter sp. HTCC2649]
 gi|84383459|gb|EAP99340.1| hypothetical protein JNB_04190 [Janibacter sp. HTCC2649]
          Length = 161

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 68/134 (50%), Gaps = 5/134 (3%)

Query: 22  IDLGTKRIGLAISDPGRRFAHPRPFLVR-----KKVTQTALELLSFITTENIAAFIIGLP 76
           +D+GT R+G+A+SDP    A P   L R     +       E+++          I+GLP
Sbjct: 1   MDVGTVRVGVAVSDPSGMLATPHATLTRIWPDAETPGDDIAEIVALSAERAALEVIVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            +++G EGP   + R +   +  R   V     DERLT+VSA + L D  V+ +++   V
Sbjct: 61  RSLSGDEGPSAEAARKYAAELARRVAPVGVRLVDERLTSVSAHRALRDSGVAGRRQRAVV 120

Query: 137 DSIAAALILQEVLD 150
           D  AA LILQ  LD
Sbjct: 121 DQAAAVLILQAALD 134


>gi|116493009|ref|YP_804744.1| Holliday junction resolvase-like protein [Pediococcus pentosaceus
           ATCC 25745]
 gi|122265527|sp|Q03ES0|RUVX_PEDPA RecName: Full=Putative Holliday junction resolvase
 gi|116103159|gb|ABJ68302.1| RNase H-like ribonuclease [Pediococcus pentosaceus ATCC 25745]
          Length = 146

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 81/135 (60%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           +  +D+G++ +G+++SD     A     + + +      +E +  +  E ++  F++GLP
Sbjct: 3   LMGMDVGSRTVGISVSDQLGWTAQGVEIVPINEDEEIFGIERVKELVKEYDVVGFVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN +EGPRV + R +   +++    +P  F DERLTTV A+++LI+  + SR KR + 
Sbjct: 63  KNMNNTEGPRVEAARNY-GKLLEETFGLPIDFQDERLTTVEAERMLIEQADTSRSKRKKV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA+LIL+  L+
Sbjct: 122 IDKLAASLILENYLN 136


>gi|225017619|ref|ZP_03706811.1| hypothetical protein CLOSTMETH_01548 [Clostridium methylpentosum
           DSM 5476]
 gi|224949584|gb|EEG30793.1| hypothetical protein CLOSTMETH_01548 [Clostridium methylpentosum
           DSM 5476]
          Length = 145

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 65/132 (49%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D G  R GLA+ D     A P   +  +       +        ++   ++G P N
Sbjct: 3   IMAVDFGDARTGLAVCDRTEFLASPIGTIQERDFNMAVCKTAVAAKEYDVKMVVVGYPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+GS G R      F   + +  + +P   WDER TTVSA Q L ++NV  +KR + VD 
Sbjct: 63  MDGSCGERAKKCEEFAKRLGEM-IPLPIKLWDERQTTVSAHQFLNEVNVRGQKRKEVVDE 121

Query: 139 IAAALILQEVLD 150
           +AA +IL+  L+
Sbjct: 122 VAATIILESYLE 133


>gi|313897358|ref|ZP_07830901.1| RNAse H domain protein, YqgF family [Clostridium sp. HGF2]
 gi|312957728|gb|EFR39353.1| RNAse H domain protein, YqgF family [Clostridium sp. HGF2]
          Length = 137

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 72/134 (53%), Gaps = 4/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL--VRKKVTQTALELLSFITTENIAAFIIGLP 76
           I  +DLG+K +G+++SD     A P   +            ++  +I    +   ++GLP
Sbjct: 3   ILGLDLGSKTLGVSVSDALGMIARPVETIRFESDDYEAACKQVQPYIKEFQVKTAVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            +MNG  G R   +  F   +    + +  V WDERLTTV+A++ILI  +VSRKKR + +
Sbjct: 63  KHMNGDVGIRGEISLMFKEKL--EALGLEVVLWDERLTTVAAEKILISADVSRKKRKKII 120

Query: 137 DSIAAALILQEVLD 150
           D +AA  ILQ  LD
Sbjct: 121 DQMAAVQILQSYLD 134


>gi|289547922|ref|YP_003472910.1| Holliday junction resolvase YqgF [Thermocrinis albus DSM 14484]
 gi|289181539|gb|ADC88783.1| Holliday junction resolvase YqgF [Thermocrinis albus DSM 14484]
          Length = 133

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 72/136 (52%), Gaps = 7/136 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLSFITTENIAAFIIGLPL 77
           +  ID GTK +GLA+ D   + A P +P   R KV +   EL   +   ++   ++GLPL
Sbjct: 3   VLCIDWGTKSLGLALGDTNLKLATPLKPIPNRGKVLERIAEL---VKEYDVRLVVVGLPL 59

Query: 78  NMNGSEGPRVHSTRAFVHNMID-RKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
             +G EG R    R+FV  +      +V    WDER TT  A Q+L     SRKK  +  
Sbjct: 60  TPSGREGQRASQVRSFVEELSALLPEHVGVELWDERYTTYEAVQLL--EGKSRKKVKELK 117

Query: 137 DSIAAALILQEVLDRI 152
           DS++A +ILQE LD +
Sbjct: 118 DSVSALIILQEYLDSL 133


>gi|255026681|ref|ZP_05298667.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           FSL J2-003]
          Length = 114

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 68/114 (59%), Gaps = 3/114 (2%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +D+G+K +G+AISDP G          + +   Q   + +  +  E  +   ++GLP N
Sbjct: 2   GLDVGSKTVGVAISDPLGWTAQGVETIQIDENRKQFGYDRVKELVLEYEVEKVVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           MN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR
Sbjct: 62  MNNTIGPRAESSKIYAE-VLEARIGLPVVLWDERLTTSAAERTLIEADVSRKKR 114


>gi|255028975|ref|ZP_05300926.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           LO28]
          Length = 116

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 68/114 (59%), Gaps = 3/114 (2%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +D+G+K +G+AISDP G          + +   Q   + +  +  E  +   ++GLP N
Sbjct: 2   GLDVGSKTVGVAISDPLGWTAQGVETIQIDENRKQFGYDRVKELVLEYEVEKVVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           MN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR
Sbjct: 62  MNNTIGPRAESSKIYAE-VLEARIGLPVVLWDERLTTSAAERTLIEADVSRKKR 114


>gi|320109161|ref|YP_004184751.1| Holliday junction resolvase YqgF [Terriglobus saanensis SP1PR4]
 gi|319927682|gb|ADV84757.1| Holliday junction resolvase YqgF [Terriglobus saanensis SP1PR4]
          Length = 157

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 69/143 (48%), Gaps = 7/143 (4%)

Query: 14  KPNQP------IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN 67
           +P QP      I  +D+G +RIG+AISD     A P   L R    +    +        
Sbjct: 3   QPPQPVMNLARIMGLDIGDRRIGVAISDGLGLTAQPVFTLHRSNPREDIRSIARLTRKHE 62

Query: 68  IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV 127
             A + GLPL+M+G   P+   ++AF   +  R   +P  FWDERLT+ +A +IL     
Sbjct: 63  ATAIVAGLPLHMSGDLSPQAQKSQAFAQELAKR-TGLPLYFWDERLTSHAAHEILDVSGF 121

Query: 128 SRKKRIQKVDSIAAALILQEVLD 150
               R   +D +AA LILQ  LD
Sbjct: 122 GTTGRKAVIDQVAAVLILQGFLD 144


>gi|294790798|ref|ZP_06755956.1| putative Holliday junction resolvase [Scardovia inopinata F0304]
 gi|294458695|gb|EFG27048.1| putative Holliday junction resolvase [Scardovia inopinata F0304]
          Length = 166

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 70/135 (51%), Gaps = 5/135 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-LLSFITTENIAAFIIGLPLNM 79
            +DLG  RIGLA+SDP   FAHP   +        A++ ++  I    ++  ++G PLN+
Sbjct: 9   GLDLGNARIGLALSDPELTFAHPEGVIQAGGDYFYAIDQIVDVIEDREVSHIVLGYPLNL 68

Query: 80  NGSEGPRVHSTRAFVHNMIDR----KVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           +G+EG      R F   +  R     +       DER+TTVSA  +L+   +S ++    
Sbjct: 69  DGAEGKSAKKVRRFAQALSRRLEEAGIDSQIELTDERMTTVSAHDLLLQAGMSSRQHRAV 128

Query: 136 VDSIAAALILQEVLD 150
           VD+ +A +ILQ  LD
Sbjct: 129 VDTQSAVVILQSALD 143


>gi|293378151|ref|ZP_06624320.1| RNAse YqgF [Enterococcus faecium PC4.1]
 gi|292643015|gb|EFF61156.1| RNAse YqgF [Enterococcus faecium PC4.1]
          Length = 143

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 75/138 (54%), Gaps = 10/138 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFII 73
           +  +D+G+K +G+A+SDP   F      +   ++ +   E     L   +    +  F++
Sbjct: 3   VMGLDVGSKTVGVAVSDP---FGWTAQGVEIIRINEAEEEFGFDRLKELVAQYEVDRFVV 59

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
           GLP NMN S GPR  ++  +    I     +P  + DERLTTV A+++L++  N SR KR
Sbjct: 60  GLPKNMNNSIGPRAEASMLYGEK-IKELFSLPVDYQDERLTTVQAERMLVEQANTSRAKR 118

Query: 133 IQKVDSIAAALILQEVLD 150
            + +D +AA +ILQ  LD
Sbjct: 119 KKVIDKLAAVMILQNYLD 136


>gi|327398201|ref|YP_004339070.1| Holliday junction resolvase [Hippea maritima DSM 10411]
 gi|327180830|gb|AEA33011.1| Holliday junction resolvase [Hippea maritima DSM 10411]
          Length = 136

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 71/134 (52%), Gaps = 5/134 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN-IAAFIIGLPL 77
           I  ID GTK+IG+AISD     A P   +         L+ +  I  +N I   ++G+P+
Sbjct: 3   ILGIDYGTKKIGIAISDETNTIALPHGVI---DTDGEYLDKIKEIVKKNKITRIVVGMPI 59

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV- 136
            + G +G R   T  F++ +  +   +  V WDERL+T  +++IL   NV  +K  +KV 
Sbjct: 60  TLKGEKGKRALETEDFINELACKIENIEIVEWDERLSTRFSERILNKANVKGRKNKKKVI 119

Query: 137 DSIAAALILQEVLD 150
           D IAA  ILQ  LD
Sbjct: 120 DKIAATFILQGYLD 133


>gi|257462580|ref|ZP_05626990.1| DNA integration/recombination/invertion protein [Fusobacterium sp.
           D12]
 gi|317060232|ref|ZP_07924717.1| DNA integration/recombination/inversion protein [Fusobacterium sp.
           D12]
 gi|313685908|gb|EFS22743.1| DNA integration/recombination/inversion protein [Fusobacterium sp.
           D12]
          Length = 139

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 76/133 (57%), Gaps = 6/133 (4%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  RIG+A SDP    A P   + R+K  +    ++     EN  + ++G+P +++
Sbjct: 7   ALDVGDVRIGVAKSDPLGMLAIPLETIDRRK-EKPVKRIMQLCEEENTKSIVVGIPKSLD 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK---VD 137
           GSE  +    R F+H +      V  +  DER TTV+A +IL +MN  RK  ++K   VD
Sbjct: 66  GSEKRQAEKVRIFIHALKSAIPGVEILEVDERFTTVTADRILTEMN--RKGALEKRKVVD 123

Query: 138 SIAAALILQEVLD 150
            +AA+LILQ+ L+
Sbjct: 124 KVAASLILQQYLN 136


>gi|240047431|ref|YP_002960819.1| putative Holliday junction resolvase [Mycoplasma conjunctivae
           HRC/581]
 gi|239985003|emb|CAT04996.1| Putative Holliday junction resolvase [Mycoplasma conjunctivae]
          Length = 141

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 69/133 (51%), Gaps = 3/133 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGLP 76
           I ++DLGTK  G AI+DP    A        K   + Q  L++        I   ++G P
Sbjct: 7   ILALDLGTKTCGFAITDPLAIIAQSLENFTYKNGDLNQIVLKIRDLQKQYEIGKIVLGYP 66

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           L MNG++ P        + +++ +   +P V  DERL+T  A  ILI  NVSRKKR + +
Sbjct: 67  LYMNGNKAPHTLLVEK-MSSILKQNFQIPVVLQDERLSTSQAHDILILANVSRKKRKKVI 125

Query: 137 DSIAAALILQEVL 149
           D +AA +IL+  L
Sbjct: 126 DKLAAQIILERYL 138


>gi|221195852|ref|ZP_03568905.1| conserved hypothetical protein [Atopobium rimae ATCC 49626]
 gi|221184326|gb|EEE16720.1| conserved hypothetical protein [Atopobium rimae ATCC 49626]
          Length = 140

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 68/133 (51%), Gaps = 1/133 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + ++D+G  R+G+A+SDP  R A P   L  ++V   A    S +        + G PL 
Sbjct: 3   VLALDIGDARVGIAVSDPDGRIASPVCVLPAQEVFSHARSFRSVLEDWEPELLVCGKPLT 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           ++G EGP+          + DR   +P    DERL++  A++IL    +S K    KVD 
Sbjct: 63  LSGEEGPQAQKIMEQAKKIADR-TGLPVELTDERLSSSEAKRILRAQGLSEKTMRGKVDM 121

Query: 139 IAAALILQEVLDR 151
           +AA+L LQ  LDR
Sbjct: 122 VAASLFLQAWLDR 134


>gi|119025719|ref|YP_909564.1| putative Holliday junction resolvase [Bifidobacterium adolescentis
           ATCC 15703]
 gi|154487460|ref|ZP_02028867.1| hypothetical protein BIFADO_01313 [Bifidobacterium adolescentis
           L2-32]
 gi|167012696|sp|A1A199|RUVX_BIFAA RecName: Full=Putative Holliday junction resolvase
 gi|118765303|dbj|BAF39482.1| putative Holliday junction resolvase [Bifidobacterium adolescentis
           ATCC 15703]
 gi|154083978|gb|EDN83023.1| hypothetical protein BIFADO_01313 [Bifidobacterium adolescentis
           L2-32]
          Length = 151

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 74/144 (51%), Gaps = 13/144 (9%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL-ELLSFITTENIAAFIIGLPLNM 79
            IDLG  R+GLA+SDP    AHP   +     +  AL E++  I  E++   +IGLPL +
Sbjct: 5   GIDLGDARVGLALSDPELTLAHPIGNIQVYGDSFRALDEVIDVIGDESVDHVVIGLPLLL 64

Query: 80  NGSEGPRVHSTRAF-------VHNMIDRKVY----VPFV-FWDERLTTVSAQQILIDMNV 127
           NG EG      R +       +H  ++ + Y    VP +   DERLTTV+A   L D  +
Sbjct: 65  NGEEGKSAKKARRWSVNLEKRLHAAVEDESYSVTRVPTIELVDERLTTVTAHHQLFDARI 124

Query: 128 SRKKRIQKVDSIAAALILQEVLDR 151
             +K    VD  +A +ILQ  LDR
Sbjct: 125 GGRKHRPMVDQQSAVVILQTALDR 148


>gi|268316439|ref|YP_003290158.1| Holliday junction resolvase YqgF [Rhodothermus marinus DSM 4252]
 gi|262333973|gb|ACY47770.1| Holliday junction resolvase YqgF [Rhodothermus marinus DSM 4252]
          Length = 145

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 72/136 (52%), Gaps = 7/136 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI-TTENIAAFIIGLPL 77
           + ++D GT+R+GLA++DP R  A P          + AL++L  +   E I   +IG PL
Sbjct: 5   VVAVDYGTRRVGLALADPLRVIAQP----YGTYAPEAALQVLQRLHAEEGIETLVIGWPL 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK-- 135
              G+EG        F+  +      V  V WDER T+  A++ L ++   RKKR  K  
Sbjct: 61  TEAGTEGEATRRVERFIRRLRRLLPGVQIVRWDERYTSELAKERLREVGGPRKKRRDKGR 120

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA +ILQE L++
Sbjct: 121 IDQMAAVIILQEYLEQ 136


>gi|86157658|ref|YP_464443.1| Holliday junction resolvase-like protein [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|146325549|sp|Q2IQC1|RUVX_ANADE RecName: Full=Putative Holliday junction resolvase
 gi|85774169|gb|ABC81006.1| Holliday junction resolvase YqgF [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 137

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 70/131 (53%), Gaps = 1/131 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLG  RIGLA++D   R A     +VR+   +    +        +   ++GLPLNM+
Sbjct: 5   GVDLGRVRIGLAVADEILRTARAVTTVVRRGEAEDLAAIAEVARDYEVTRAVVGLPLNMD 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G+EGP     R F   + +  + VP   +DERL++  A+  L    VS + +  +VD+ A
Sbjct: 65  GTEGPSARLARGFAPRL-EAALGVPVELFDERLSSFEAESRLRARGVSARDQRGQVDAEA 123

Query: 141 AALILQEVLDR 151
           AA+ILQ  LDR
Sbjct: 124 AAVILQGWLDR 134


>gi|315641319|ref|ZP_07896395.1| crossover junction endodeoxyribonuclease [Enterococcus italicus DSM
           15952]
 gi|315482892|gb|EFU73412.1| crossover junction endodeoxyribonuclease [Enterococcus italicus DSM
           15952]
          Length = 145

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 78/135 (57%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTE-NIAAFIIGLP 76
           I  +D+G++ +G+A+SDP    A     + + +       + +  +  +  I  F++GLP
Sbjct: 3   IMGLDVGSRTVGIAVSDPMGWTAQGIEIIKINEDEDNFGFDRVKELADQYEIGHFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN + GPR  ++ ++   + ++   +P  + DERLTTV A+++LI+  N SR KR + 
Sbjct: 63  KNMNNTIGPRAEASMSYGEKL-EQLFGLPVSYQDERLTTVQAERMLIEQANASRAKRKKV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA +ILQ  LD
Sbjct: 122 IDKLAAVMILQNFLD 136


>gi|317124716|ref|YP_004098828.1| Holliday junction resolvase YqgF [Intrasporangium calvum DSM 43043]
 gi|315588804|gb|ADU48101.1| Holliday junction resolvase YqgF [Intrasporangium calvum DSM 43043]
          Length = 165

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/141 (37%), Positives = 72/141 (51%), Gaps = 5/141 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLNM 79
            ID+G  R+G+A SDP   FA+P   L R       +E ++ +T E ++   ++GLP  +
Sbjct: 10  GIDVGDARVGVAASDPSGTFANPVQTLARDVRELADIEAIAILTAERDVLEIVVGLPRLL 69

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +G EG      RA+   +  R   VP    DERLTTV A Q L D  V  + +   VD  
Sbjct: 70  SGGEGEAARGARAYAAQLAARVAPVPVRLVDERLTTVGAHQRLRDSGVPGRGQRSVVDQA 129

Query: 140 AAALILQEVLDRISFLESSKG 160
           AA LILQ  LD     E+S G
Sbjct: 130 AAVLILQSALD----AEASAG 146


>gi|313884998|ref|ZP_07818750.1| RNAse H domain protein, YqgF family [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312619689|gb|EFR31126.1| RNAse H domain protein, YqgF family [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 145

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 79/140 (56%), Gaps = 9/140 (6%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAF 71
           + I  +D+G+K +G+A+SD     A     +   ++ + A +     LL  +    +   
Sbjct: 5   ERIVGLDVGSKTVGVAMSDLLGWIAQGLETI---RIDEEAGDFGFDRLLELLDQHQVKKV 61

Query: 72  IIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRK 130
           +IGLP NMN + GPR  +++ +   ++D +  +   + DERLTT  A+++L+ + NVSR 
Sbjct: 62  VIGLPKNMNNTIGPRAQASQRYGQKLLDIRPDLLIAYQDERLTTSQAERMLVSEGNVSRS 121

Query: 131 KRIQKVDSIAAALILQEVLD 150
           KR + +D +AA +ILQ  LD
Sbjct: 122 KRKKVIDKLAAVIILQNYLD 141


>gi|218961790|ref|YP_001741565.1| putative Holliday junction resolvase [Candidatus Cloacamonas
           acidaminovorans]
 gi|167730447|emb|CAO81359.1| putative Holliday junction resolvase [Candidatus Cloacamonas
           acidaminovorans]
          Length = 138

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 73/133 (54%), Gaps = 1/133 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D G KRIG+A+SDP R F+ P   L  K   Q   EL   IT   +   IIG+P  
Sbjct: 7   ILALDYGEKRIGIALSDPNRIFSKPLCVLSNKGFEQLVEELKKLITLHQVTLLIIGIPYA 66

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           ++GS  P+    +  ++ + D  + +    +DER +T  A + L  M  + ++  +  D+
Sbjct: 67  IDGSITPKTEECQQILNRLKDV-LSISVEGFDERYSTWEANEELKKMGYNWRQAKEIKDA 125

Query: 139 IAAALILQEVLDR 151
           ++AA+IL+E L++
Sbjct: 126 MSAAMILKEFLNQ 138


>gi|315924762|ref|ZP_07920979.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315621661|gb|EFV01625.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 143

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 78/137 (56%), Gaps = 5/137 (3%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA-LELLSFITTE-NIAAFIIG 74
           + I  +D+G K +G+A+SD        + +   KK  + A L     + T+ NI   + G
Sbjct: 3   EKILGLDIGDKYVGIAVSDA--LGVTAQGYRTYKKADRNADLAFFGDVVTQFNIKTAVAG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP +M+G E  +V  T+ +  N + +++ +  ++ DERLTT +++ +LI   V R+ R Q
Sbjct: 61  LPKDMDGRETAQVRKTKNYC-NFLAKRLGLEVIYIDERLTTRASEAVLIAGGVRRENRKQ 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D+++A LILQ  LDR
Sbjct: 120 HIDTLSAQLILQMYLDR 136


>gi|313905326|ref|ZP_07838692.1| Holliday junction resolvase YqgF [Eubacterium cellulosolvens 6]
 gi|313469796|gb|EFR65132.1| Holliday junction resolvase YqgF [Eubacterium cellulosolvens 6]
          Length = 146

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 69/136 (50%), Gaps = 5/136 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQ---TALELLSFITTENIAAFIIGL 75
           I  +D G K +G+A+SD     A     + R++ T+   T   +        I+  ++GL
Sbjct: 3   ILGLDYGAKTVGVAVSDALGITAQALETVTRERETKLRRTVARIAELCEQYEISKIVLGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV-SRKKRIQ 134
           PL M+   G R      F   M+ ++  +  + WDERLTTV+A ++L +M V  R  R  
Sbjct: 63  PLLMSDEIGDRAQKAMEF-GEMLKKRTGLEVIMWDERLTTVAADEVLDEMGVRGRHNRKA 121

Query: 135 KVDSIAAALILQEVLD 150
            +D IAA  ILQE LD
Sbjct: 122 VIDQIAAGFILQEYLD 137


>gi|220917826|ref|YP_002493130.1| Holliday junction resolvase YqgF [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|254767492|sp|B8JDZ9|RUVX_ANAD2 RecName: Full=Putative Holliday junction resolvase
 gi|219955680|gb|ACL66064.1| Holliday junction resolvase YqgF [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 137

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 71/131 (54%), Gaps = 1/131 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLG  RIGLA++D   R A     +VR+   +    +        +   ++GLPLNM+
Sbjct: 5   GVDLGRVRIGLAVADEILRTARAVTTVVRRTEAEDLAAIAEVARDYEVTRAVVGLPLNMD 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G+EGP     R F   + +  + VP   +DERL++  A+  L    +S +++  +VD+ A
Sbjct: 65  GTEGPSARLARGFAPRL-EAALGVPVELFDERLSSFEAESRLRARGLSAREQRGQVDAEA 123

Query: 141 AALILQEVLDR 151
           AA+ILQ  LDR
Sbjct: 124 AAVILQGWLDR 134


>gi|225851249|ref|YP_002731483.1| hypothetical protein PERMA_1719 [Persephonella marina EX-H1]
 gi|225645144|gb|ACO03330.1| conserved hypothetical protein [Persephonella marina EX-H1]
          Length = 142

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 77/140 (55%), Gaps = 12/140 (8%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLNM 79
           ++D+GTKRIG+A SDP     +P P++      + A E +  +  E +I   +IGLPL +
Sbjct: 8   ALDVGTKRIGVAYSDPLGISTNPLPYIDN---DEHAFEKIRDVVREYDIGTVVIGLPLTL 64

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVP----FVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
            G EG +   T+ F   +   K Y+P      F DER TT  A++ L +     KKR +K
Sbjct: 65  KGKEGTQAKLTKEFAQKL---KGYLPEDVEIEFVDERFTTSLAEKQLKETGKRSKKR-EK 120

Query: 136 VDSIAAALILQEVLDRISFL 155
           +DS++A  IL+  L++  ++
Sbjct: 121 IDSLSAVYILKTYLEKKQYM 140


>gi|169350060|ref|ZP_02866998.1| hypothetical protein CLOSPI_00800 [Clostridium spiroforme DSM 1552]
 gi|169293273|gb|EDS75406.1| hypothetical protein CLOSPI_00800 [Clostridium spiroforme DSM 1552]
          Length = 139

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 71/137 (51%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPF--LVRKKVTQTALELLSFITTENIAAFIIG 74
           + I  +DLG++  G+A+SD     AH             Q A  ++  I    I   ++G
Sbjct: 2   EKILGLDLGSRTCGIAMSDALGMLAHGLETYRFNDGNYKQAANYVVEIINKNQIKTVVLG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVY-VPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           LP +MNG  G R   +  F   M+++KV  +  V  DERLTT  AQ  LI  +VSRKKR 
Sbjct: 62  LPKHMNGDLGERAQISIMF-KEMLEKKVAGLNVVLVDERLTTKVAQDRLIFADVSRKKRK 120

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D +AA  ILQ  LD
Sbjct: 121 QVIDKMAAVAILQGYLD 137


>gi|54020386|ref|YP_115692.1| hypothetical protein mhp179 [Mycoplasma hyopneumoniae 232]
 gi|62900952|sp|Q601M3|RUVX_MYCH2 RecName: Full=Putative Holliday junction resolvase
 gi|148887034|sp|Q4A8G3|RUVX_MYCH7 RecName: Full=Putative Holliday junction resolvase
 gi|148887035|sp|Q4AAD2|RUVX_MYCHJ RecName: Full=Putative Holliday junction resolvase
 gi|53987559|gb|AAV27760.1| putative holliday junction resolvase [Mycoplasma hyopneumoniae 232]
 gi|144227506|gb|AAZ44289.2| conserved hypothetical protein [Mycoplasma hyopneumoniae J]
          Length = 143

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 75/144 (52%), Gaps = 9/144 (6%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLSFITTEN-IAAFIIGLP 76
           I ++DLG K  G AISD   + ++P   F   +    + +  ++F   E  I+  ++G P
Sbjct: 7   ILALDLGIKTCGFAISDQNWKISYPLEQFNFNRYDFASVISRIAFWMKEYPISILVLGYP 66

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           L + G   PR      F  +++ +   +  VF DERLTT  AQ  L+D+ +S KKR + +
Sbjct: 67  LTLAGKISPRTKMVEYFA-DLVKKNYEIKVVFQDERLTTKQAQTFLLDLGISFKKRQKVI 125

Query: 137 DSIAAALILQEVLDRISFLESSKG 160
           D +AA +IL+       FL + KG
Sbjct: 126 DKLAAQIILER------FLNTKKG 143


>gi|320101933|ref|YP_004177524.1| Holliday junction resolvase YqgF [Isosphaera pallida ATCC 43644]
 gi|319749215|gb|ADV60975.1| Holliday junction resolvase YqgF [Isosphaera pallida ATCC 43644]
          Length = 183

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 81/136 (59%), Gaps = 5/136 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQ---TALELLSFITTEN-IAAFIIG 74
           I ++D G KR+GLAISDPGR  A P   L R        T ++ L  +  E+ +   ++G
Sbjct: 4   ILALDHGLKRVGLAISDPGRSIASPLGRLERPGGEAGFTTEIQTLKRLVREHGVDRLVMG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G + P+  + R +  + + +++ +  ++ DER +T  A +++ +  +S  KR +
Sbjct: 64  LPVHTSGRDSPQARAARQW-GDRVAKELGLTIIYVDERYSTKHADELMREAGLSAAKRKR 122

Query: 135 KVDSIAAALILQEVLD 150
           +VDS+AA +IL++ LD
Sbjct: 123 RVDSLAAVVILRDYLD 138


>gi|256852221|ref|ZP_05557607.1| conserved hypothetical protein [Lactobacillus jensenii 27-2-CHN]
 gi|260661747|ref|ZP_05862658.1| anaerobic ribonucleoside triphosphate reductase [Lactobacillus
           jensenii 115-3-CHN]
 gi|282932651|ref|ZP_06338065.1| putative Holliday junction resolvase [Lactobacillus jensenii 208-1]
 gi|297205613|ref|ZP_06923009.1| crossover junction endodeoxyribonuclease [Lactobacillus jensenii
           JV-V16]
 gi|256615267|gb|EEU20458.1| conserved hypothetical protein [Lactobacillus jensenii 27-2-CHN]
 gi|260547494|gb|EEX23473.1| anaerobic ribonucleoside triphosphate reductase [Lactobacillus
           jensenii 115-3-CHN]
 gi|281303225|gb|EFA95413.1| putative Holliday junction resolvase [Lactobacillus jensenii 208-1]
 gi|297150191|gb|EFH30488.1| crossover junction endodeoxyribonuclease [Lactobacillus jensenii
           JV-V16]
          Length = 148

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 76/134 (56%), Gaps = 5/134 (3%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +D+G+K +G+AISD  G          + +      ++ +  I  E ++  F++GLP N
Sbjct: 5   GLDVGSKTVGVAISDELGLTAQKLETISIDETRHNFGMKAIKKIVREYDVTGFVLGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV--SRKKRIQKV 136
           M+GS+G  V+ ++ +    ++ K  +P  + DERLTT+ A ++LI+      RKKR + +
Sbjct: 65  MDGSDGASVNRSKNY-GKRLEEKFSLPVAYSDERLTTIEADRVLIEEAEIHDRKKRKEVI 123

Query: 137 DSIAAALILQEVLD 150
           D +AA LILQ  LD
Sbjct: 124 DQMAAVLILQNYLD 137


>gi|15924606|ref|NP_372140.1| hypothetical protein SAV1616 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15927196|ref|NP_374729.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus N315]
 gi|156979934|ref|YP_001442193.1| hypothetical protein SAHV_1603 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|262048611|ref|ZP_06021494.1| hypothetical protein SAD30_1007 [Staphylococcus aureus D30]
 gi|262051271|ref|ZP_06023495.1| hypothetical protein SA930_1702 [Staphylococcus aureus 930918-3]
 gi|13701414|dbj|BAB42708.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           N315]
 gi|14247387|dbj|BAB57778.1| putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|156722069|dbj|BAF78486.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|259160908|gb|EEW45928.1| hypothetical protein SA930_1702 [Staphylococcus aureus 930918-3]
 gi|259163258|gb|EEW47817.1| hypothetical protein SAD30_1007 [Staphylococcus aureus D30]
 gi|285817298|gb|ADC37785.1| Putative Holliday junction resolvase [Staphylococcus aureus
           04-02981]
          Length = 123

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 59/95 (62%)

Query: 58  ELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVS 117
           +L+  I   N+   +IGLP NMN S G R  ++  +   +++    +  V WDERL+T++
Sbjct: 28  QLVDIIKKHNVGTVVIGLPKNMNNSIGFRGEASLTYKEKLLEAYPSIEIVMWDERLSTMA 87

Query: 118 AQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRI 152
           A++ L++ +VSR+KR Q +D +AA  ILQ  LD +
Sbjct: 88  AERSLLEADVSRQKRKQVIDKMAAVFILQGYLDSL 122


>gi|183601534|ref|ZP_02962904.1| possible endonuclease [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219683929|ref|YP_002470312.1| Holliday junction resolvase [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|241190967|ref|YP_002968361.1| putative endonuclease for recombination [Bifidobacterium animalis
           subsp. lactis Bl-04]
 gi|241196373|ref|YP_002969928.1| putative endonuclease for recombination [Bifidobacterium animalis
           subsp. lactis DSM 10140]
 gi|183219140|gb|EDT89781.1| possible endonuclease [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219621579|gb|ACL29736.1| putative Holliday junction resolvase [Bifidobacterium animalis
           subsp. lactis AD011]
 gi|240249359|gb|ACS46299.1| Putative endonuclease for recombination [Bifidobacterium animalis
           subsp. lactis Bl-04]
 gi|240250927|gb|ACS47866.1| Putative endonuclease for recombination [Bifidobacterium animalis
           subsp. lactis DSM 10140]
 gi|289178709|gb|ADC85955.1| Hypothetical cytosolic protein [Bifidobacterium animalis subsp.
           lactis BB-12]
 gi|295793956|gb|ADG33491.1| Putative endonuclease for recombination [Bifidobacterium animalis
           subsp. lactis V9]
          Length = 163

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 74/149 (49%), Gaps = 18/149 (12%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHP----RPFLVRKKVTQTALELLSFITTEN--IAAFIIG 74
            +DLG  R+G+A S+P R FA+P    R +    +V    L+L+     E   + A  IG
Sbjct: 7   GLDLGNARVGVAASNPERSFAYPEGNIRVYGDYFQVFDDVLDLIEDKAEEGTPVTAIAIG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHN--------MIDRKVYV----PFVFWDERLTTVSAQQIL 122
           LPL M+GS G      + +  +        M D+  ++      +F DERLTTV A + L
Sbjct: 67  LPLQMDGSAGSSAKKAQRWAKSLRRRLESEMEDQDSHIGVMPDIIFIDERLTTVDAHRRL 126

Query: 123 IDMNVSRKKRIQKVDSIAAALILQEVLDR 151
            D NVS K+    VD  +A  ILQ  LDR
Sbjct: 127 FDANVSSKQHRAVVDQQSAVEILQTALDR 155


>gi|239932416|ref|ZP_04689369.1| hypothetical protein SghaA1_29605 [Streptomyces ghanaensis ATCC
           14672]
 gi|291440782|ref|ZP_06580172.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
 gi|291343677|gb|EFE70633.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
          Length = 154

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 67/142 (47%), Gaps = 2/142 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID+G  RIG+A  DPG   A P   +  + V      L   I        ++GLP ++ 
Sbjct: 8   AIDVGDARIGVASCDPGGILATPVETVPGRDVPAAHRRLKQLIEEYEPIEVVVGLPRSLK 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     R F   +    + VP    DER+TTV+A Q L    V  KK    +D  A
Sbjct: 68  GGEGPAAAKVRGFARELARMIMPVPVRLVDERMTTVTASQGLRASGVKSKKGRSVIDQAA 127

Query: 141 AALILQEVL--DRISFLESSKG 160
           A +ILQ+ L  +R+S     +G
Sbjct: 128 AVIILQQALESERVSGEPPGEG 149


>gi|332976666|gb|EGK13506.1| crossover junction endodeoxyribonuclease [Psychrobacter sp.
           1501(2011)]
          Length = 179

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 79/146 (54%), Gaps = 7/146 (4%)

Query: 10  VKSLKPNQPIA-SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-LLSFITTEN 67
            K+  P Q +   +D G K++G+A+ +   + A P   LV         + LL  I T  
Sbjct: 20  TKNSSPEQTVLLGLDYGVKKMGMALGNTVTQDARPFDILVMNNGQPADWDNLLGIIDTWK 79

Query: 68  IAAFIIGLPLNMNGSE---GPRVHS-TRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI 123
           I   ++GLPLNM+GS      R H   R   H +++++++VP   +DERLT+V A+++  
Sbjct: 80  IGRVVVGLPLNMDGSSSMIAKRAHKFARRLAHRLMEQRIHVPVQLFDERLTSVEAREMAW 139

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVL 149
           ++ + + +R   +D I+A L+LQ  L
Sbjct: 140 ELGLIKNER-DPIDDISACLLLQSYL 164


>gi|238063897|ref|ZP_04608606.1| Holliday junction resolvase yqgF [Micromonospora sp. ATCC 39149]
 gi|237885708|gb|EEP74536.1| Holliday junction resolvase yqgF [Micromonospora sp. ATCC 39149]
          Length = 153

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 65/136 (47%), Gaps = 6/136 (4%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRK------KVTQTALELLSFITTENIAAFIIG 74
            +D+G  R+G+A SDP    A P   L R        V     EL++ I        ++G
Sbjct: 11  GVDVGQVRVGVARSDPHGVLATPLVTLARDLTTADDAVPSDMAELVALIAEHECVEVVVG 70

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP+N+ G  GP   + +A+   + D    VP    DER++TV A + L +  V  K+R  
Sbjct: 71  LPINLAGQHGPAARNVKAYADRLADVIAPVPVTLTDERMSTVVASRRLAEGGVRGKRRRA 130

Query: 135 KVDSIAAALILQEVLD 150
            VD  AA  ILQ  LD
Sbjct: 131 VVDQAAAVEILQSWLD 146


>gi|309810777|ref|ZP_07704583.1| RNAse H domain protein, YqgF family [Dermacoccus sp. Ellin185]
 gi|308435257|gb|EFP59083.1| RNAse H domain protein, YqgF family [Dermacoccus sp. Ellin185]
          Length = 170

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 71/131 (54%), Gaps = 1/131 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIA-AFIIGLPLNM 79
            +D+GT R+G+A+SDP    A P   L R   +   ++ ++ +  +  A   ++GLPLNM
Sbjct: 8   GVDVGTVRVGVAVSDPDGIMATPVETLARASASDKDVQRVAELADDARALEVVVGLPLNM 67

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
            G +     + RA+ + +   +  +  +  DERLT+VSA Q L    V+ ++  Q VD  
Sbjct: 68  KGEDTASTQAARAWANTLKRLRPALRVILVDERLTSVSAHQSLHASGVAGREHRQHVDQQ 127

Query: 140 AAALILQEVLD 150
           AA LILQ  L+
Sbjct: 128 AAVLILQAALE 138


>gi|294786853|ref|ZP_06752107.1| putative Holliday junction resolvase [Parascardovia denticolens
           F0305]
 gi|315226489|ref|ZP_07868277.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Parascardovia denticolens DSM 10105]
 gi|294485686|gb|EFG33320.1| putative Holliday junction resolvase [Parascardovia denticolens
           F0305]
 gi|315120621|gb|EFT83753.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Parascardovia denticolens DSM 10105]
          Length = 176

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 67/136 (49%), Gaps = 6/136 (4%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            +DLG  R+G+AISDP   FAHP   + V     Q   E+   I    ++  +IG PL +
Sbjct: 35  GLDLGNARVGVAISDPELTFAHPEGNIRVAGDYFQAIDEITDLIDDHQVSHVVIGYPLQL 94

Query: 80  NGSEGPRVHSTRAFVHNMIDR-KVY----VPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           +G+EG      R F   +  R  +Y    V     DER+TTV A   L+D  +  ++   
Sbjct: 95  DGTEGKSAKKARRFSLALEKRLALYQIQGVSLELKDERMTTVRAHSQLMDAGIGSRRHRP 154

Query: 135 KVDSIAAALILQEVLD 150
            VD  +A LILQ  LD
Sbjct: 155 LVDQQSAVLILQAALD 170


>gi|197123036|ref|YP_002134987.1| Holliday junction resolvase-like protein [Anaeromyxobacter sp. K]
 gi|226725482|sp|B4UH04|RUVX_ANASK RecName: Full=Putative Holliday junction resolvase
 gi|196172885|gb|ACG73858.1| Holliday junction resolvase YqgF [Anaeromyxobacter sp. K]
          Length = 137

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 71/131 (54%), Gaps = 1/131 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLG  RIGLA++D   R A     +VR+   +    +        +   ++GLPLNM+
Sbjct: 5   GVDLGRVRIGLAVADEILRTARAVTTVVRRTEAEDLSAIAEVARDYEVTRAVVGLPLNMD 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G+EGP     R F   + +  + VP   +DERL++  A+  L    +S +++  +VD+ A
Sbjct: 65  GTEGPSARLARGFAPRL-EAALGVPVELFDERLSSFEAESRLRARGLSAREQRGQVDAEA 123

Query: 141 AALILQEVLDR 151
           AA+ILQ  LDR
Sbjct: 124 AAVILQGWLDR 134


>gi|167756782|ref|ZP_02428909.1| hypothetical protein CLORAM_02331 [Clostridium ramosum DSM 1402]
 gi|237734500|ref|ZP_04564981.1| conserved hypothetical protein [Mollicutes bacterium D7]
 gi|167702957|gb|EDS17536.1| hypothetical protein CLORAM_02331 [Clostridium ramosum DSM 1402]
 gi|229382320|gb|EEO32411.1| conserved hypothetical protein [Coprobacillus sp. D7]
          Length = 139

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 74/137 (54%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKK-VTQTALELLSFITTENIAAFIIG 74
           + I  +DLG++  G+AISD     AH    +  R     + A  +++ I    I   ++G
Sbjct: 2   ERILGLDLGSRTCGIAISDTLGMLAHGIETYRFRDDDYDRAAKHVVALINEHQIKTVVLG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKV-YVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           LP +MNG  G R   +  F   M++++V  +  V  DERLTT  AQ  LI  +VSRKKR 
Sbjct: 62  LPKHMNGDLGERAQISIMF-KEMLEKEVPGLNVVLIDERLTTKVAQDQLIFADVSRKKRK 120

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D +AA  ILQ  LD
Sbjct: 121 QVIDKMAAVAILQGYLD 137


>gi|224476714|ref|YP_002634320.1| Holliday junction resolvase-like protein [Staphylococcus carnosus
           subsp. carnosus TM300]
 gi|254767525|sp|B9DNH1|RUVX_STACT RecName: Full=Putative Holliday junction resolvase
 gi|222421321|emb|CAL28135.1| conserved hypothetical protein [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 142

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 77/138 (55%), Gaps = 2/138 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTAL-ELLSFITTENIAAFIIG 74
             I  +D+G+K +G+A+SD     A     L + ++  +  + +L   I  E+    +IG
Sbjct: 4   HKIIGLDVGSKTVGVAVSDLMGWTAQGLDTLRINEEENELGITKLAEIIKKEDADTVVIG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN S G R  ++  +   ++     +  V WDERL+T++A++ L++ +VSR KR +
Sbjct: 64  LPKNMNNSIGFRGEASLKYKEELLKILPDINVVMWDERLSTMAAERSLLEADVSRSKRKK 123

Query: 135 KVDSIAAALILQEVLDRI 152
            +D +AA  ILQ  LD +
Sbjct: 124 VIDKMAAVFILQGYLDSL 141


>gi|310287354|ref|YP_003938612.1| resolvase [Bifidobacterium bifidum S17]
 gi|309251290|gb|ADO53038.1| resolvase [Bifidobacterium bifidum S17]
          Length = 156

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 77/143 (53%), Gaps = 13/143 (9%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-LLSFITTENIAAFIIGLPLNM 79
            +DLG  R+GLA+SDP   FAHP   +     +  AL+ +++ I  E +   ++GLPL +
Sbjct: 9   GVDLGDARVGLALSDPELTFAHPYGNIQAYGDSFRALDDVITVIEDEAVDHIVVGLPLQL 68

Query: 80  NGSEGPRVHSTRAF-------VHNMIDRK----VYVPFV-FWDERLTTVSAQQILIDMNV 127
           +G+EG      R +       + N++D       ++P V   DERLTTVSA + L++  +
Sbjct: 69  DGTEGKSAKKARRWSANLEKRMRNLMDEHDFALYHIPQVTLLDERLTTVSAHRQLLEAQL 128

Query: 128 SRKKRIQKVDSIAAALILQEVLD 150
             ++    VD  +A +ILQ  LD
Sbjct: 129 GSRRHRPVVDQQSAVVILQTALD 151


>gi|23465455|ref|NP_696058.1| endonuclease [Bifidobacterium longum NCC2705]
 gi|322688961|ref|YP_004208695.1| endonuclease [Bifidobacterium longum subsp. infantis 157F]
 gi|322690930|ref|YP_004220500.1| endonuclease [Bifidobacterium longum subsp. longum JCM 1217]
 gi|23326107|gb|AAN24694.1| possible endonuclease [Bifidobacterium longum NCC2705]
 gi|320455786|dbj|BAJ66408.1| putative endonuclease [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|320460297|dbj|BAJ70917.1| putative endonuclease [Bifidobacterium longum subsp. infantis 157F]
          Length = 145

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 72/141 (51%), Gaps = 13/141 (9%)

Query: 24  LGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIAAFIIGLPLNMNGS 82
           +G  R+GLA+SDP   FAHP   + V         E+L+ I  E++   I+GLPL M+G+
Sbjct: 1   MGNARVGLALSDPELTFAHPAGNIHVAGDYFFAIDEVLNVIEDEHVDHVIVGLPLQMDGT 60

Query: 83  EGPRVHSTRAFVHNMIDR-----------KVYVPFV-FWDERLTTVSAQQILIDMNVSRK 130
           EG      R +  N+  R           +  +P V   DERLTTVSA + L + + +  
Sbjct: 61  EGKSAKKARRWAANLEKRLQAESEDSDSTEYQIPQVSLIDERLTTVSAHRQLFEAHKASN 120

Query: 131 KRIQKVDSIAAALILQEVLDR 151
           K    VD  +A +ILQ  LDR
Sbjct: 121 KHRPVVDQQSAVVILQTALDR 141


>gi|320458617|dbj|BAJ69238.1| putative endonuclease [Bifidobacterium longum subsp. infantis ATCC
           15697]
          Length = 144

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 72/141 (51%), Gaps = 13/141 (9%)

Query: 24  LGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIAAFIIGLPLNMNGS 82
           +G  R+GLA+SDP   FAHP   + V         E+L+ I  E++   I+GLPL M+G+
Sbjct: 1   MGNARVGLALSDPELTFAHPAGNIHVAGDYFFAIDEVLNVIEDEHVDHVIVGLPLQMDGT 60

Query: 83  EGPRVHSTRAFVHNMIDR-----------KVYVPFV-FWDERLTTVSAQQILIDMNVSRK 130
           EG      R +  N+  R           +  +P V   DERLTTVSA + L + + +  
Sbjct: 61  EGKSAKKARRWAANLEKRLQAESEDSDSTEYQIPQVSLIDERLTTVSAHRQLFEAHKASN 120

Query: 131 KRIQKVDSIAAALILQEVLDR 151
           K    VD  +A +ILQ  LDR
Sbjct: 121 KHRPVVDQQSAVVILQTALDR 141


>gi|311064195|ref|YP_003970920.1| endonuclease involved in recombination [Bifidobacterium bifidum
           PRL2010]
 gi|313140070|ref|ZP_07802263.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
 gi|310866514|gb|ADP35883.1| Endonuclease involved in recombination [Bifidobacterium bifidum
           PRL2010]
 gi|313132580|gb|EFR50197.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
          Length = 152

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 77/143 (53%), Gaps = 13/143 (9%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-LLSFITTENIAAFIIGLPLNM 79
            +DLG  R+GLA+SDP   FAHP   +     +  AL+ +++ I  E +   ++GLPL +
Sbjct: 5   GVDLGDARVGLALSDPELTFAHPYGNIQAYGDSFRALDDVITVIEDEAVDHIVVGLPLQL 64

Query: 80  NGSEGPRVHSTRAF-------VHNMIDRK----VYVPFV-FWDERLTTVSAQQILIDMNV 127
           +G+EG      R +       + N++D       ++P V   DERLTTVSA + L++  +
Sbjct: 65  DGTEGKSAKKARRWSANLEKRMRNLMDEHDFALYHIPQVTLLDERLTTVSAHRQLLEAQL 124

Query: 128 SRKKRIQKVDSIAAALILQEVLD 150
             ++    VD  +A +ILQ  LD
Sbjct: 125 GSRRHRPVVDQQSAVVILQTALD 147


>gi|257063514|ref|YP_003143186.1| conserved hypothetical protein TIGR00250 [Slackia
           heliotrinireducens DSM 20476]
 gi|256791167|gb|ACV21837.1| conserved hypothetical protein TIGR00250 [Slackia
           heliotrinireducens DSM 20476]
          Length = 138

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 65/132 (49%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + ++D+G  RIGLA+SD   R A P   L    V     E    +    I   + GLP  
Sbjct: 3   VLALDIGEVRIGLAVSDAAGRIASPLKVLPADVVLNDGREFRMLVEDWEIEHLVCGLPYT 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M G EGP+  S +     +   +  +P  F DERL++  A++IL +  +  +    KVD 
Sbjct: 63  MAGEEGPQAASIKEKARQIASAR-DLPLSFVDERLSSAEAKRILREEGLDERSMRGKVDM 121

Query: 139 IAAALILQEVLD 150
           IAA+L LQ  LD
Sbjct: 122 IAASLFLQAWLD 133


>gi|223986206|ref|ZP_03636224.1| hypothetical protein HOLDEFILI_03534 [Holdemania filiformis DSM
           12042]
 gi|223961820|gb|EEF66314.1| hypothetical protein HOLDEFILI_03534 [Holdemania filiformis DSM
           12042]
          Length = 139

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 74/142 (52%), Gaps = 17/142 (11%)

Query: 19  IASIDLGTKRIGLAISDP----GR-----RFAHPRPFLVRKKVTQTALELLSFITTENIA 69
           I  +DLG++ +G+A+SDP     R     RFA         +  Q A EL          
Sbjct: 4   IMGLDLGSRTLGIAVSDPLGMIARTVETFRFADDDYDAACARAVQLAKEL-------GAV 56

Query: 70  AFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR 129
            F++GLP +MNG  G R   +  F   + +    +P +  DERLTT +A++ILI  +VSR
Sbjct: 57  KFVLGLPKHMNGDVGIRGQISLDFKAKL-EAACGLPVILQDERLTTAAAERILISADVSR 115

Query: 130 KKRIQKVDSIAAALILQEVLDR 151
           KKR   +D +AA  ILQ  LD+
Sbjct: 116 KKRKAVIDQMAAVQILQSYLDQ 137


>gi|218282249|ref|ZP_03488548.1| hypothetical protein EUBIFOR_01130 [Eubacterium biforme DSM 3989]
 gi|218216787|gb|EEC90325.1| hypothetical protein EUBIFOR_01130 [Eubacterium biforme DSM 3989]
          Length = 141

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 69/137 (50%), Gaps = 8/137 (5%)

Query: 19  IASIDLGTKRIGLAISDP----GRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           I  +DLG+K  G++I D      R     R             E+L  +    +   ++G
Sbjct: 4   IIGLDLGSKTCGVSICDALHITCRALTTVR--FESDDYDACLEEVLKLLQENKVKEVVLG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP +MNG  G R   +  F   +    + V    WDERLTTV+A++IL+  +VSRKKR +
Sbjct: 62  LPKHMNGDIGIRGEISCEFAKKLESSGIKVHL--WDERLTTVAAEKILLQGDVSRKKRKK 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA  ILQ  LDR
Sbjct: 120 VIDQMAAVQILQSFLDR 136


>gi|81428003|ref|YP_395002.1| Holliday junction resolvase-like protein [Lactobacillus sakei
           subsp. sakei 23K]
 gi|146325576|sp|Q38YN7|RUVX_LACSS RecName: Full=Putative Holliday junction resolvase
 gi|78609644|emb|CAI54690.1| Hypothetical protein LCA_0389 [Lactobacillus sakei subsp. sakei
           23K]
          Length = 147

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 76/135 (56%), Gaps = 3/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELL-SFITTENIAAFIIGLP 76
           +   D+G++ +G+A+SD     A     + + +  ++  L+ +   +    +  F++GLP
Sbjct: 3   LMGFDVGSRTVGIAVSDLFGWTAQGVEIIRINEDESEFGLDRVKELVAQHQVTGFVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN S GPR    + +   + +    +P  + DERLTTV A+++L++  + SRKKR Q 
Sbjct: 63  KNMNNSIGPRAVKAQEYGAMLTELFPEIPVDYIDERLTTVQAERMLVEQADTSRKKRKQV 122

Query: 136 VDSIAAALILQEVLD 150
           +D +AA +ILQ  LD
Sbjct: 123 IDKLAAVMILQNYLD 137


>gi|268608523|ref|ZP_06142250.1| Holliday junction resolvase YqgF [Ruminococcus flavefaciens FD-1]
          Length = 143

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 60/132 (45%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I S+D G  R G+A+       A P   +  K   +   +  +    +     ++G P N
Sbjct: 3   IMSVDFGDARTGIAVCGKSEMIASPVTVIPEKDFDKCIEKTAALAKEQRAEQIVVGYPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ G R      F   + +    +P   WDER TTVSA   L   N   KKR   VD+
Sbjct: 63  MNGTIGERCEKCTLFAEKL-EEMTGIPTRLWDERCTTVSAHNYLNVTNTRGKKRKNVVDA 121

Query: 139 IAAALILQEVLD 150
           +AA +IL+  L+
Sbjct: 122 VAAVIILESYLE 133


>gi|46199780|ref|YP_005447.1| yqgf-family protein [Thermus thermophilus HB27]
 gi|55981798|ref|YP_145095.1| hypothetical protein TTHA1829 [Thermus thermophilus HB8]
 gi|62900932|sp|Q5SHA1|RUVX_THET8 RecName: Full=Putative Holliday junction resolvase
 gi|62900992|sp|Q72HK9|RUVX_THET2 RecName: Full=Putative Holliday junction resolvase
 gi|46197407|gb|AAS81820.1| yqgf-Family protein [Thermus thermophilus HB27]
 gi|55773211|dbj|BAD71652.1| conserved hypothetical protein [Thermus thermophilus HB8]
          Length = 135

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 68/133 (51%), Gaps = 2/133 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + ++D+G  RIGLA+ + G   A  R +LVRK + +    LL F+  E +   ++GLPL 
Sbjct: 3   VGALDVGEARIGLAVGEEGVPLASGRGYLVRKTLEEDVEALLDFVRREGLGKLVVGLPLR 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
            +  E  +       V  +  R V V    WDER TT  AQ+ L       ++   K+D 
Sbjct: 63  TDLKESAQAGKVLPLVEALRARGVEVE--LWDERFTTKLAQERLKHAPKRLRRDKGKLDE 120

Query: 139 IAAALILQEVLDR 151
           +AA ++L++ L R
Sbjct: 121 LAAVVLLEDYLAR 133


>gi|225181970|ref|ZP_03735403.1| Holliday junction resolvase YqgF [Dethiobacter alkaliphilus AHT 1]
 gi|225167332|gb|EEG76150.1| Holliday junction resolvase YqgF [Dethiobacter alkaliphilus AHT 1]
          Length = 138

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 68/131 (51%), Gaps = 1/131 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  +D+G + IG+A SD     A     + R         +   +    ++  ++G P N
Sbjct: 3   ILGLDVGDRTIGVAASDALGWTAQGLEVIRRTTWENDLKRIRELVAEYEVSLIVVGYPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MN + GPR   +  F  + +  ++ +P   WDERLTT+ A++ L+  ++SR KR + +D 
Sbjct: 63  MNNTVGPRAKLSEEFA-DKLSAELNLPVKLWDERLTTMEAERTLLSADMSRAKRKKVIDK 121

Query: 139 IAAALILQEVL 149
           +AA LILQ  L
Sbjct: 122 MAAVLILQNYL 132


>gi|227495467|ref|ZP_03925783.1| possible Holliday junction resolvase [Actinomyces coleocanis DSM
           15436]
 gi|226831014|gb|EEH63397.1| possible Holliday junction resolvase [Actinomyces coleocanis DSM
           15436]
          Length = 155

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 65/130 (50%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D G  RIG+A++DP  + + P   L          ELL+ I  +     +IG+P+++N
Sbjct: 9   GVDYGKSRIGVAVTDPSGKISFPHTTLQFSPYGVHLDELLNLIVEKQAIEVVIGMPVHLN 68

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EG      R F + +      +     DERLTT  A   L +M V  + R  K+D +A
Sbjct: 69  GKEGSSAEFVRDFANELAVEIPDIRVCLMDERLTTNQAHAGLSEMGVDNRARKNKIDQLA 128

Query: 141 AALILQEVLD 150
           A++IL+  ++
Sbjct: 129 ASIILENAIE 138


>gi|253583471|ref|ZP_04860669.1| DNA integration/recombination/inversion protein [Fusobacterium
           varium ATCC 27725]
 gi|251834043|gb|EES62606.1| DNA integration/recombination/inversion protein [Fusobacterium
           varium ATCC 27725]
          Length = 139

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 74/133 (55%), Gaps = 6/133 (4%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           S+D+G  RIG+A SD     A P   + RKK T+    +    T EN  A ++G+P +++
Sbjct: 7   SLDVGDVRIGVAKSDIMGIVATPLEVIDRKK-TKAVKRIKELCTQENTKALVVGIPKSLD 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK---VD 137
           G+E  +    R F+  +      +  +  DERLTTVSA ++L + N  +K  ++K   VD
Sbjct: 66  GTEKRQAEKVREFIAKLNKEIEGLEIIEVDERLTTVSADRMLNESN--KKGALEKRKVVD 123

Query: 138 SIAAALILQEVLD 150
            IAAA+ILQ  LD
Sbjct: 124 KIAAAIILQTFLD 136


>gi|119716635|ref|YP_923600.1| Holliday junction resolvase YqgF [Nocardioides sp. JS614]
 gi|167012741|sp|A1SJC8|RUVX_NOCSJ RecName: Full=Putative Holliday junction resolvase
 gi|119537296|gb|ABL81913.1| Holliday junction resolvase YqgF [Nocardioides sp. JS614]
          Length = 156

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 66/133 (49%), Gaps = 3/133 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL-ELLSFITTEN--IAAFIIGLPL 77
            ID G  RIG+A SDP    A P   + R K     +  +L+    E   +   ++GLP 
Sbjct: 8   GIDPGDARIGVARSDPSGFLATPVETVRRGKGDLARIGRILAAEEDEGATVLEVVVGLPR 67

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           +++G EGP     R F   +  R   VP    DER+TTVSA+ +L D   +  KR   VD
Sbjct: 68  SLSGREGPAAAKVREFAGRLAARVAPVPVRLVDERMTTVSAEAMLRDQGRTGGKRRAVVD 127

Query: 138 SIAAALILQEVLD 150
             AA LILQ  LD
Sbjct: 128 QAAAVLILQHALD 140


>gi|303241625|ref|ZP_07328124.1| Holliday junction resolvase YqgF [Acetivibrio cellulolyticus CD2]
 gi|302590845|gb|EFL60594.1| Holliday junction resolvase YqgF [Acetivibrio cellulolyticus CD2]
          Length = 140

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 67/133 (50%), Gaps = 1/133 (0%)

Query: 19  IASIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPL 77
           I  ID G  RIG+A+SDP G           +  + +    ++  +        I+G P 
Sbjct: 3   IIGIDYGDSRIGIAVSDPLGWTAQGIETISWKNDIEEPIKRIVELVNLYEAKKLIVGFPK 62

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMNG+ GPR   T  F+  +  R   +  + WDERL+TVSA + + ++ V + K+   VD
Sbjct: 63  NMNGTIGPRGEKTNDFIELITARIEGIQIIKWDERLSTVSANRTMHELGVKKSKKKHVVD 122

Query: 138 SIAAALILQEVLD 150
            IAA  ILQ  LD
Sbjct: 123 QIAAVYILQGYLD 135


>gi|322436322|ref|YP_004218534.1| Holliday junction resolvase YqgF [Acidobacterium sp. MP5ACTX9]
 gi|321164049|gb|ADW69754.1| Holliday junction resolvase YqgF [Acidobacterium sp. MP5ACTX9]
          Length = 143

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 69/129 (53%), Gaps = 2/129 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D+G  RIG+A++DP    A P   L RK   + A  LL  I    +   ++G PL+
Sbjct: 6   IMALDVGKARIGIALTDPLGYTAQPLLTLWRKTRNEDARSLLRLIRKHEVTHLVVGNPLH 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR-KKRIQKVD 137
           ++G   P       F   + +R   +P   WDERL++V+A +IL +   +R K R   +D
Sbjct: 66  LSGDLSPFAAKVHEFAEYLRER-TEIPIQLWDERLSSVAANEILDEAGHARGKDRKFIID 124

Query: 138 SIAAALILQ 146
            +AA LIL+
Sbjct: 125 QVAAVLILE 133


>gi|229817701|ref|ZP_04447983.1| hypothetical protein BIFANG_02973 [Bifidobacterium angulatum DSM
           20098]
 gi|229785490|gb|EEP21604.1| hypothetical protein BIFANG_02973 [Bifidobacterium angulatum DSM
           20098]
          Length = 154

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 73/144 (50%), Gaps = 13/144 (9%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            IDLG  R+GLA+SDP   FAHP     V     +   +++  I  EN+   ++GLPL +
Sbjct: 5   GIDLGDARVGLAVSDPELTFAHPIGNVQVYGDSFRAIDDVIYTIEDENVDHVVVGLPLLL 64

Query: 80  NGSEGPRVHSTRAFVHNMIDR-KVY----------VPFV-FWDERLTTVSAQQILIDMNV 127
           +G EG      R +  N+  R  +Y          VP +   DERLTTVSA + L   N+
Sbjct: 65  SGEEGKSAKKARRWASNLAKRIDLYMQSGETTLEQVPEIELMDERLTTVSAHRQLRQANI 124

Query: 128 SRKKRIQKVDSIAAALILQEVLDR 151
           + +     VD  +A +ILQ  LD+
Sbjct: 125 AERGHRPVVDQQSAVVILQAALDK 148


>gi|257452889|ref|ZP_05618188.1| DNA integration/recombination/invertion protein [Fusobacterium sp.
           3_1_5R]
 gi|257466746|ref|ZP_05631057.1| DNA integration/recombination/invertion protein [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|315917895|ref|ZP_07914135.1| DNA integration/recombination/inversion protein [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|317059431|ref|ZP_07923916.1| DNA integration/recombination/inversion protein [Fusobacterium sp.
           3_1_5R]
 gi|313685107|gb|EFS21942.1| DNA integration/recombination/inversion protein [Fusobacterium sp.
           3_1_5R]
 gi|313691770|gb|EFS28605.1| DNA integration/recombination/inversion protein [Fusobacterium
           gonidiaformans ATCC 25563]
          Length = 139

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 75/133 (56%), Gaps = 6/133 (4%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  RIG+A SD     A P   + R+K+ +    ++     EN  + ++G+P +++
Sbjct: 7   ALDVGDVRIGVAKSDIMGIIASPLETIDRRKM-KPVKRIIELCEQENTKSIVVGIPKSLD 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK---VD 137
           GSE  +    R F+H +      V     DER TTV+A QIL +MN  RK  ++K   VD
Sbjct: 66  GSEKRQAEKVRIFIHALKSAIPGVEIFEVDERFTTVTADQILTEMN--RKGALEKRKVVD 123

Query: 138 SIAAALILQEVLD 150
            +AA+LILQ+ L+
Sbjct: 124 KVAASLILQQYLN 136


>gi|46446457|ref|YP_007822.1| hypothetical protein pc0823 [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|46400098|emb|CAF23547.1| conserved hypothetical protein [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 134

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 49/130 (37%), Positives = 71/130 (54%), Gaps = 8/130 (6%)

Query: 28  RIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITT------ENIAAFIIGLPLNMN 80
           RIGLA SD  +  A P   +   KK  QT ++LL  I+         I   +IGLPL M+
Sbjct: 3   RIGLAQSDERKIIAMPLITVHTEKKSEQTVIKLLETISQLCETQKCEIEEIVIGLPLMMS 62

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G  G      + F   ++ +   +P   WDERLTTV A++ L +  ++RKKR + VD ++
Sbjct: 63  GRTGFLADEVKHFAQ-LLQQLTPIPIRLWDERLTTVQAERSLRESQLTRKKRSKVVDIVS 121

Query: 141 AALILQEVLD 150
           A++ILQ  LD
Sbjct: 122 ASIILQSYLD 131


>gi|313674137|ref|YP_004052133.1| holliday junction resolvase yqgf [Marivirga tractuosa DSM 4126]
 gi|312940835|gb|ADR20025.1| Holliday junction resolvase YqgF [Marivirga tractuosa DSM 4126]
          Length = 137

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 73/137 (53%), Gaps = 8/137 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + +ID GTKR+GLA++DP +  A P   +  K + Q    L ++ ++E + A + G P N
Sbjct: 4   VLAIDYGTKRVGLAVTDPLKIIASPLEMIHSKDLVQY---LANYFSSEEVEAVVCGYPTN 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKV-YVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK-- 135
             G          AF+ N+  +K   +P    DE  ++  A Q +I    +RK+R +K  
Sbjct: 61  EEGEATDATRHVDAFI-NLFKKKFPTMPLHLQDESFSSQEAMQAMIHSGSNRKQRNKKSG 119

Query: 136 -VDSIAAALILQEVLDR 151
            +D I+AA+ILQ+ L+ 
Sbjct: 120 NIDKISAAIILQQFLEE 136


>gi|171743065|ref|ZP_02918872.1| hypothetical protein BIFDEN_02191 [Bifidobacterium dentium ATCC
           27678]
 gi|283455925|ref|YP_003360489.1| Holliday junction resolvase [Bifidobacterium dentium Bd1]
 gi|171278679|gb|EDT46340.1| hypothetical protein BIFDEN_02191 [Bifidobacterium dentium ATCC
           27678]
 gi|283102559|gb|ADB09665.1| Holliday junction resolvase [Bifidobacterium dentium Bd1]
          Length = 158

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 69/144 (47%), Gaps = 13/144 (9%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL-ELLSFITTENIAAFIIGLPLNM 79
            +DLG  R+GLA+SDP    AHP   +     +  AL E++  I  E++   ++GLPL +
Sbjct: 5   GVDLGDARVGLALSDPELTLAHPAGNIQVYGDSFRALDEVIDVIEDESVDHVVVGLPLLL 64

Query: 80  NGSEGPRVHSTRAFVHNMIDR------------KVYVPFVFWDERLTTVSAQQILIDMNV 127
           NG  G      R +  N+  R             V       DERLTTV+A Q L D  +
Sbjct: 65  NGEAGKSAKKARRWAANLEKRMQAAAQDESEPLNVIPTIELVDERLTTVTAHQQLFDAQI 124

Query: 128 SRKKRIQKVDSIAAALILQEVLDR 151
             ++    VD  +A +ILQ  LDR
Sbjct: 125 GGRRHRPMVDQQSAVVILQTALDR 148


>gi|315172764|gb|EFU16781.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX1346]
          Length = 140

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 73/135 (54%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL--ELLSFITTENIAAFIIGLP 76
           I  +D+G++ +G+A+SD     A     +   +  +      L   +    +  F++GLP
Sbjct: 3   IMGLDVGSRTVGVAVSDLLGWTAQGIEIIRINEEEENFGFERLGELVKEYEVTKFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN S GPR  ++ A+  + I     +P  + DERLTTV A++ L++  N SR KR + 
Sbjct: 63  KNMNNSIGPRAEASMAY-GDKIQELFQLPVDYQDERLTTVQAERFLVEQANASRAKRKKV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA +ILQ  LD
Sbjct: 122 IDKLAAVMILQNYLD 136


>gi|238855617|ref|ZP_04645918.1| conserved hypothetical protein [Lactobacillus jensenii 269-3]
 gi|260665323|ref|ZP_05866171.1| anaerobic ribonucleoside triphosphate reductase [Lactobacillus
           jensenii SJ-7A-US]
 gi|282933009|ref|ZP_06338403.1| putative Holliday junction resolvase [Lactobacillus jensenii 208-1]
 gi|313473102|ref|ZP_07813586.1| putative Holliday junction resolvase [Lactobacillus jensenii 1153]
 gi|238831761|gb|EEQ24097.1| conserved hypothetical protein [Lactobacillus jensenii 269-3]
 gi|239528661|gb|EEQ67662.1| putative Holliday junction resolvase [Lactobacillus jensenii 1153]
 gi|260560827|gb|EEX26803.1| anaerobic ribonucleoside triphosphate reductase [Lactobacillus
           jensenii SJ-7A-US]
 gi|281302863|gb|EFA95071.1| putative Holliday junction resolvase [Lactobacillus jensenii 208-1]
          Length = 148

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 75/136 (55%), Gaps = 9/136 (6%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL----VRKKVTQTALELLSFITTENIAAFIIGLP 76
            +D+G+K +G+AISD     A     +     R      A++ L  +   ++  F++GLP
Sbjct: 5   GLDVGSKTVGVAISDELGLTAQKLETISIDETRHNFGMKAIKKL--VREYDVTGFVLGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV--SRKKRIQ 134
            NM+GS+G  V  ++ +   + D K  +P  + DERLTT+ A ++LI+      RKKR +
Sbjct: 63  KNMDGSDGVSVSRSKNYGKRLED-KFSLPVAYSDERLTTIEADRVLIEEAEIHDRKKRKE 121

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA LILQ  LD
Sbjct: 122 VIDQMAAVLILQNYLD 137


>gi|307326783|ref|ZP_07605975.1| Holliday junction resolvase YqgF [Streptomyces violaceusniger Tu
           4113]
 gi|306887546|gb|EFN18540.1| Holliday junction resolvase YqgF [Streptomyces violaceusniger Tu
           4113]
          Length = 154

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 63/130 (48%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID+G  RIG+A  DP    A P   +  + +      L + +        ++GLP +++
Sbjct: 8   AIDVGDARIGVASCDPDGILATPVETVPGRDIPAAHKRLAALVEEYEPLEVVVGLPRSLS 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     R F   +  R   VP    DER+TTV+A Q L    V+ KK    VD  A
Sbjct: 68  GREGPAAAKVRTFARELARRVAPVPVRLVDERMTTVTASQGLRASGVTSKKGRSVVDQAA 127

Query: 141 AALILQEVLD 150
           A +ILQ  L+
Sbjct: 128 AVVILQSALE 137


>gi|306822870|ref|ZP_07456246.1| possible Holliday junction resolvase [Bifidobacterium dentium ATCC
           27679]
 gi|309801316|ref|ZP_07695445.1| RNAse H domain protein, YqgF family [Bifidobacterium dentium
           JCVIHMP022]
 gi|304553502|gb|EFM41413.1| possible Holliday junction resolvase [Bifidobacterium dentium ATCC
           27679]
 gi|308222205|gb|EFO78488.1| RNAse H domain protein, YqgF family [Bifidobacterium dentium
           JCVIHMP022]
          Length = 158

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 69/144 (47%), Gaps = 13/144 (9%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL-ELLSFITTENIAAFIIGLPLNM 79
            +DLG  R+GLA+SDP    AHP   +     +  AL E++  I  E++   ++GLPL +
Sbjct: 5   GVDLGDARVGLALSDPELTLAHPAGNIQVYGDSFRALDEVIDVIEDESVDHVVVGLPLLL 64

Query: 80  NGSEGPRVHSTRAFVHNMIDR------------KVYVPFVFWDERLTTVSAQQILIDMNV 127
           NG  G      R +  N+  R             V       DERLTTV+A Q L D  +
Sbjct: 65  NGEAGKSAKKARRWAANLEKRMRAAAQDESEPLNVIPTIELVDERLTTVTAHQQLFDAQI 124

Query: 128 SRKKRIQKVDSIAAALILQEVLDR 151
             ++    VD  +A +ILQ  LDR
Sbjct: 125 GGRRHRPMVDQQSAVVILQTALDR 148


>gi|317487355|ref|ZP_07946146.1| Holliday junction resolvase YqgF [Bilophila wadsworthia 3_1_6]
 gi|316921378|gb|EFV42673.1| Holliday junction resolvase YqgF [Bilophila wadsworthia 3_1_6]
          Length = 142

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 68/131 (51%), Gaps = 1/131 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID G KR G+A+SD G   A PR  ++ +       ELL+ I  E   A +IGLP+N++
Sbjct: 5   AIDYGQKRTGIAVSDTGGSMAFPRKTILMRTRAAFFEELLALIEAEATDAIVIGLPINLD 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G E       R F  ++  R+  +P  + +E L++  A++ L D   S  +    +D  A
Sbjct: 65  GEESLTTRQVRNFSKSLA-RRTTLPLFWMEEALSSYEAERDLRDAGRSAAQGRAVLDQQA 123

Query: 141 AALILQEVLDR 151
           A  ILQ  LD+
Sbjct: 124 AVRILQSFLDQ 134


>gi|57239291|ref|YP_180427.1| putative Holliday junction resolvase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579255|ref|YP_197467.1| putative Holliday junction resolvase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|62900902|sp|Q5HAW7|RUVX_EHRRW RecName: Full=Putative Holliday junction resolvase
 gi|57161370|emb|CAH58293.1| putative Holliday junction resolvase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417881|emb|CAI27085.1| Putative Holliday junction resolvase [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 156

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 72/151 (47%), Gaps = 1/151 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           I +  + +   + I  +D G K+IG+A+SD     A P    VRK   +    L   +  
Sbjct: 6   INEFEQVIDKTKRIMCLDFGEKKIGVALSDKTNLIAIPHSVYVRKNTRKDLGSLYGILIE 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
            +  + +IGLPL++ G           F + MI +K  +     DER +T  A ++    
Sbjct: 66  NDAGSMVIGLPLDLFGMGNELCDKVMLFANRMI-KKYAINIYLHDERYSTAMATRVAKLA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLE 156
           N+ RK+  +  D IAA LILQ+VLD +   +
Sbjct: 125 NIKRKESQKIDDKIAAVLILQQVLDMVKIYQ 155


>gi|298492528|ref|YP_003722705.1| Holliday junction resolvase YqgF ['Nostoc azollae' 0708]
 gi|298234446|gb|ADI65582.1| Holliday junction resolvase YqgF ['Nostoc azollae' 0708]
          Length = 158

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 72/142 (50%), Gaps = 7/142 (4%)

Query: 15  PNQPIAS------IDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENI 68
           P Q + S      +D+G+KRIGLA  D     A     + RK   +   ++   +    +
Sbjct: 3   PQQKLKSFISALGVDVGSKRIGLAGCDGTGLIATGLTTIDRKSFEEDVEQIQQIVNARRV 62

Query: 69  AAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVS 128
              ++GLP  M+GS G +    + F H +  + + +P  + DERLT+  A+Q+LI  N S
Sbjct: 63  QVLVVGLPYAMDGSLGFQARHVQKFTHRLA-QALKLPVEYVDERLTSYQAEQLLIAENRS 121

Query: 129 RKKRIQKVDSIAAALILQEVLD 150
             +    +D  AAALILQ+ LD
Sbjct: 122 PSRHKGLIDRKAAALILQQWLD 143


>gi|260893291|ref|YP_003239388.1| Holliday junction resolvase YqgF [Ammonifex degensii KC4]
 gi|260865432|gb|ACX52538.1| Holliday junction resolvase YqgF [Ammonifex degensii KC4]
          Length = 146

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 71/133 (53%), Gaps = 2/133 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D+G K IG+A+SDP    A     L R +  +    +L       +   +IGLP  
Sbjct: 3   ILALDVGDKTIGVAVSDPFGLTAQGLKVLHRGEEAEDVQHVLELARRYEVEEVVIGLPRT 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           + G  GP+      F   +  + + +  ++WDER TT  A+++L+  +VSRKKR +  D 
Sbjct: 63  LAGEIGPQAQKVLRFGELLAQQGLKI--IYWDERFTTKEAEKVLLAADVSRKKRRRVKDI 120

Query: 139 IAAALILQEVLDR 151
           +AA L+L+  L++
Sbjct: 121 LAAVLLLEAYLEK 133


>gi|313902392|ref|ZP_07835795.1| Holliday junction resolvase YqgF [Thermaerobacter subterraneus DSM
           13965]
 gi|313467323|gb|EFR62834.1| Holliday junction resolvase YqgF [Thermaerobacter subterraneus DSM
           13965]
          Length = 330

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 73/139 (52%), Gaps = 7/139 (5%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLG++ IG+AISDP    A P   L R+   +    ++           ++G P  ++
Sbjct: 5   GLDLGSRVIGVAISDPEGILARPLASLPRQGDDRDIARVVELARQHGAEGIVVGWPRRLD 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G  GP   +  AF   +    V      WDERL+TV A+++LID ++SR++R   +D +A
Sbjct: 65  GRRGPEAEAAEAFAAGLQAAGVSR-VTLWDERLSTVQAERVLIDADLSRRRRKAIIDRMA 123

Query: 141 AALILQEVLDRISFLESSK 159
           A +ILQ      +FLE+ +
Sbjct: 124 ATVILQ------AFLEAQR 136


>gi|237755542|ref|ZP_04584161.1| conserved hypothetical protein [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237692305|gb|EEP61294.1| conserved hypothetical protein [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 145

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 79/140 (56%), Gaps = 13/140 (9%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVR-KKVTQTALELLSFITTENIAAFIIGLPL 77
           I  +D+G KRIG+A+SDP    A P  F++  +KV +   +L   I    I+  +IGLPL
Sbjct: 4   ILGLDIGLKRIGVAVSDPFGVTATPLEFILNDEKVFEKINDL---IKNYKISKIVIGLPL 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVP----FVFWDERLTTVSAQQILIDMNVSRKKRI 133
            + G EG +   T+ F  N+   K ++P     +F DER T+  A++ L      +K + 
Sbjct: 61  TLKGEEGEQARYTKDFAENL---KNHIPQDIEIIFIDERFTSSLAEKTL--SQTKKKNKK 115

Query: 134 QKVDSIAAALILQEVLDRIS 153
           +K+DS++A  ILQ  LDR+S
Sbjct: 116 EKIDSLSAVFILQTYLDRLS 135


>gi|148651960|ref|YP_001279053.1| Holliday junction resolvase YqgF [Psychrobacter sp. PRwf-1]
 gi|172048441|sp|A5WBR2|RUVX_PSYWF RecName: Full=Putative Holliday junction resolvase
 gi|148571044|gb|ABQ93103.1| Holliday junction resolvase YqgF [Psychrobacter sp. PRwf-1]
          Length = 177

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 77/142 (54%), Gaps = 7/142 (4%)

Query: 14  KPNQPIA-SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-LLSFITTENIAAF 71
           +P Q +   +D G K++G+A+ +   + A P   L          + LL  I T  I   
Sbjct: 22  RPEQTVLLGLDYGVKKMGMALGNTVTQDARPFDILAMNNGQPADWDNLLGIIDTWRIGRV 81

Query: 72  IIGLPLNMNGSE---GPRVHS-TRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV 127
           ++GLPLNM+GS      R H   R   H +++++++VP   +DERLT+V A+++  ++ +
Sbjct: 82  VVGLPLNMDGSSSMIAKRAHKFARRLAHRLMEQRIHVPVQLFDERLTSVEAREMAWELGL 141

Query: 128 SRKKRIQKVDSIAAALILQEVL 149
            + +R   +D I+A L+LQ  L
Sbjct: 142 IKNER-DPIDDISACLLLQSYL 162


>gi|310829301|ref|YP_003961658.1| RNAse H-fold protein YqgF [Eubacterium limosum KIST612]
 gi|308741035|gb|ADO38695.1| RNAse H-fold protein YqgF [Eubacterium limosum KIST612]
          Length = 178

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 80/138 (57%), Gaps = 9/138 (6%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE----NIAAFI 72
           + +  +D+G K IG+A+SDP    A    +   K+ T+   + L+F T      N+   +
Sbjct: 40  ERLLGLDVGDKYIGIAVSDPLGITAQG--YRTWKRGTRD--DDLAFFTDVVEQFNVTTLV 95

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
            GLP +M G+E  +   TR F    + +++ +  V+ DERLT+ +++++LI+  V R+KR
Sbjct: 96  SGLPKDMEGNETAQARKTRNFCQ-FLKKRLNLEVVYIDERLTSKASERVLIEGGVRREKR 154

Query: 133 IQKVDSIAAALILQEVLD 150
            + +D++AA +ILQ  LD
Sbjct: 155 KEYIDTLAAQMILQVYLD 172


>gi|58617309|ref|YP_196508.1| putative Holliday junction resolvase [Ehrlichia ruminantium str.
           Gardel]
 gi|62900898|sp|Q5FFQ2|RUVX_EHRRG RecName: Full=Putative Holliday junction resolvase
 gi|58416921|emb|CAI28034.1| Putative Holliday junction resolvase [Ehrlichia ruminantium str.
           Gardel]
          Length = 156

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 72/151 (47%), Gaps = 1/151 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           I +  + +   + I  +D G K+IG+A+SD     A P    VRK   +    L   +  
Sbjct: 6   INEFEQVIDKTKRIMCLDFGEKKIGVALSDKTNLIAIPHSVYVRKNTRKDLGGLYGILIE 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
            +  + +IGLPL++ G           F + MI +K  +     DER +T  A ++    
Sbjct: 66  NDAGSMVIGLPLDLFGMGNELCDKVMLFANRMI-KKYAINIYLHDERYSTAMATRVAKLA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLE 156
           N+ RK+  +  D IAA LILQ+VLD +   +
Sbjct: 125 NIKRKESQKIDDKIAAVLILQQVLDMVKIYQ 155


>gi|88658457|ref|YP_507277.1| hypothetical protein ECH_0460 [Ehrlichia chaffeensis str. Arkansas]
 gi|146325573|sp|Q2GH06|RUVX_EHRCR RecName: Full=Putative Holliday junction resolvase
 gi|88599914|gb|ABD45383.1| conserved hypothetical protein TIGR00250 [Ehrlichia chaffeensis
           str. Arkansas]
          Length = 156

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 73/151 (48%), Gaps = 1/151 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           +++ +K +   + I  +D G K+IG+A+SD     A P    VR+   +    L S    
Sbjct: 6   VDEFIKVIDKTKRIMGLDFGEKKIGIALSDRTNLIAIPYSVYVRRSSRKDLGSLYSIFVE 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
            ++ + +IG PL ++G E         F + +I R   +     DER +T  A ++    
Sbjct: 66  NDVGSIVIGWPLELSGVENELCQKVVMFANRIITR-YKINICLHDERYSTAMATRLAKLA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFLE 156
           N+ RK+     D I+A LILQ+VLD I   +
Sbjct: 125 NIKRKESQAIDDKISAVLILQQVLDIIKVYQ 155


>gi|317154143|ref|YP_004122191.1| Holliday junction resolvase YqgF [Desulfovibrio aespoeensis Aspo-2]
 gi|316944394|gb|ADU63445.1| Holliday junction resolvase YqgF [Desulfovibrio aespoeensis Aspo-2]
          Length = 138

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 73/132 (55%), Gaps = 5/132 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL--ELLSFITTENIAAFIIGLPLN 78
            ID G KR+GLAISD  R      P+L  ++ T+ AL   ++  I  E++ A ++GLPL+
Sbjct: 5   GIDFGLKRVGLAISD--RSGILVSPYLTLERTTRDALFEAIIEIIRQESVEAIVVGLPLS 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+G +       R F  ++  R+  +P    DERLT+  A++ L   ++   KR   +DS
Sbjct: 63  MDGEDTLTTRQARNFAQSL-GRRTDLPIHLADERLTSAQAEEELNAADLRGTKRKMALDS 121

Query: 139 IAAALILQEVLD 150
            AA +IL+  L+
Sbjct: 122 QAAVIILRTWLE 133


>gi|117928536|ref|YP_873087.1| Holliday junction resolvase YqgF [Acidothermus cellulolyticus 11B]
 gi|117648999|gb|ABK53101.1| Holliday junction resolvase YqgF [Acidothermus cellulolyticus 11B]
          Length = 173

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 67/131 (51%), Gaps = 1/131 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAA-FIIGLPLNM 79
            +D+GT RIG+A+SDP  R A P   L R       L  L+ +  E  A   ++GLP+++
Sbjct: 13  GVDVGTVRIGVAVSDPDGRLAVPAETLPRDASGAGELRRLAQLVEERGAVEVVVGLPVSL 72

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
            G+ G        +   +      VP    DER TTV A + L    ++ ++R   VD +
Sbjct: 73  RGTAGAAARDIAGYARRLATAVHPVPVRLVDERFTTVHADRRLQSAGLAGRQRRAVVDQL 132

Query: 140 AAALILQEVLD 150
           AAA++LQ+ LD
Sbjct: 133 AAAILLQDALD 143


>gi|306821649|ref|ZP_07455247.1| Holliday junction resolvase [Eubacterium yurii subsp. margaretiae
           ATCC 43715]
 gi|304550394|gb|EFM38387.1| Holliday junction resolvase [Eubacterium yurii subsp. margaretiae
           ATCC 43715]
          Length = 142

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 75/133 (56%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + I  +D+G ++IG+A+SD     A P+  +  K + +   ++L  I   +I   ++GLP
Sbjct: 2   ERILGLDIGKQKIGIAMSDLLGMTAQPKATIRSKNLEEQMQKILDIIKENSIKEVVVGLP 61

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            ++NG +G +   T++FV  +  +   +  ++ DER T+  A + L  M++ + K  + +
Sbjct: 62  KDINGKDGEQALWTKSFVEKLTLKNENIKIIYIDERYTSKLALKNLSHMSMKKVKDKELI 121

Query: 137 DSIAAALILQEVL 149
           DS+AAA IL+  L
Sbjct: 122 DSLAAASILETYL 134


>gi|319935504|ref|ZP_08009939.1| Holliday junction resolvase [Coprobacillus sp. 29_1]
 gi|319809535|gb|EFW05952.1| Holliday junction resolvase [Coprobacillus sp. 29_1]
          Length = 140

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (53%), Gaps = 3/136 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLSFITTEN-IAAFIIG 74
           + I  +DLG++  G+AISDP    A     +  +    ++A   +  I  EN I   ++G
Sbjct: 2   EKILGLDLGSRTCGIAISDPLGIIAQGVETYRFKDNHYKSAAYHIKTIVQENNIHTIVLG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP +MNG  G R   +  F   + ++ + V  +  DERLTTV  +  LI  +VSRKKR +
Sbjct: 62  LPKHMNGDLGERAQISIDFKERL-EKMMDVEVILVDERLTTVMMENQLIFADVSRKKRKE 120

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA  ILQ  LD
Sbjct: 121 VIDKLAAVQILQGYLD 136


>gi|271967371|ref|YP_003341567.1| endonuclease involved in recombination-like protein
           [Streptosporangium roseum DSM 43021]
 gi|270510546|gb|ACZ88824.1| endonuclease involved in recombination-like protein
           [Streptosporangium roseum DSM 43021]
          Length = 163

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 69/131 (52%), Gaps = 4/131 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLNM 79
            +D+G+ RIG+A SDP    A P   + R +     L+ L+ I  E  +   ++GLP ++
Sbjct: 10  GVDVGSVRIGVARSDPSGLLATPVETVRRGR---GDLDRLAEIAAEYEVVEIVVGLPTSL 66

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +G EG    + R F   +  R   +P   +DERLTTV+AQQ L    V  K +   VD  
Sbjct: 67  SGREGQAAEAARDFATRISLRLAPIPVRLFDERLTTVTAQQGLRASGVKAKNQRAVVDQA 126

Query: 140 AAALILQEVLD 150
           AA ++LQ  LD
Sbjct: 127 AAIVLLQAALD 137


>gi|256829569|ref|YP_003158297.1| Holliday junction resolvase YqgF [Desulfomicrobium baculatum DSM
           4028]
 gi|256578745|gb|ACU89881.1| Holliday junction resolvase YqgF [Desulfomicrobium baculatum DSM
           4028]
          Length = 133

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 71/134 (52%), Gaps = 7/134 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL--ELLSFITTENIAAFIIGLP 76
           I  ID G KRIGLA++  G  F    PF    K T+  L  +L+S I +E + A ++GLP
Sbjct: 3   ILGIDYGQKRIGLAMARQGMAF----PFKTLDKSTRDKLFADLMSIIESEGVEAIVLGLP 58

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           L+MNG E         F  + + R+  +P    +E LT+  A+Q L +  V  +K  + +
Sbjct: 59  LDMNGDETLTTRQVLNF-RDSLARRTELPIHLVNEALTSFDARQRLREAGVPERKHKEML 117

Query: 137 DSIAAALILQEVLD 150
           D +AA  IL+  L+
Sbjct: 118 DQMAAVCILETYLE 131


>gi|210633872|ref|ZP_03297887.1| hypothetical protein COLSTE_01804 [Collinsella stercoris DSM 13279]
 gi|210159041|gb|EEA90012.1| hypothetical protein COLSTE_01804 [Collinsella stercoris DSM 13279]
          Length = 142

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 65/130 (50%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  R G+A+SD   R A P   L   +V   A      +        + GLP  M 
Sbjct: 5   ALDIGGARTGIAVSDRTGRVASPVKVLPAAEVEGVARTFRMVLEDYEPDVIVCGLPQTMA 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP+    R  V   I R   +P  F DERL++  A++IL +  +S K+   KVD I+
Sbjct: 65  GEEGPQAARVRE-VAGRISRVTGLPVEFIDERLSSTEAKRILREQGLSEKQMRGKVDMIS 123

Query: 141 AALILQEVLD 150
           A+L LQ  LD
Sbjct: 124 ASLFLQAWLD 133


>gi|296535596|ref|ZP_06897777.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Roseomonas cervicalis ATCC 49957]
 gi|296264112|gb|EFH10556.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Roseomonas cervicalis ATCC 49957]
          Length = 159

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 64/123 (52%), Gaps = 1/123 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I+ + +L  +L P+Q +  +D G K IG+A++D     A P   L R K+   A E+ 
Sbjct: 1   MPIINLSELRAALSPDQRLIGLDPGKKIIGVALTDVTLMLASPYRGLARGKLAANAAEIG 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +    E     ++GLPL ++GS GP   + + +    +     +P   WDERL++ +  +
Sbjct: 61  AIARREGAGGLVVGLPLGLDGSFGPAAQAAKDWTR-ALSEATGLPAALWDERLSSSAVNR 119

Query: 121 ILI 123
           +LI
Sbjct: 120 MLI 122


>gi|162452820|ref|YP_001615187.1| putative Hollyday junction resolvase [Sorangium cellulosum 'So ce
           56']
 gi|161163402|emb|CAN94707.1| putative Hollyday junction resolvase [Sorangium cellulosum 'So ce
           56']
          Length = 163

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/130 (40%), Positives = 68/130 (52%), Gaps = 1/130 (0%)

Query: 22  IDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMNG 81
           IDLG  R+G+A++D    +AHPRP L  +        L +    E I  F++GLPL MNG
Sbjct: 33  IDLGKARVGVAVTDELGLYAHPRPLLDGRNRKALLEALAALARDEGITRFLVGLPLEMNG 92

Query: 82  SEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAA 141
            EGP            +     V     DERLTTV A + L D  VS +K  ++VD  AA
Sbjct: 93  DEGPAARRA-LAFAQALADAAGVEVELVDERLTTVEAARRLRDGGVSGRKSKERVDGAAA 151

Query: 142 ALILQEVLDR 151
           AL+LQ  LDR
Sbjct: 152 ALLLQAWLDR 161


>gi|58336756|ref|YP_193341.1| Holliday junction resolvase-like protein [Lactobacillus acidophilus
           NCFM]
 gi|227903317|ref|ZP_04021122.1| crossover junction endodeoxyribonuclease [Lactobacillus acidophilus
           ATCC 4796]
 gi|62900899|sp|Q5FLW4|RUVX_LACAC RecName: Full=Putative Holliday junction resolvase
 gi|58254073|gb|AAV42310.1| hypothetical protein LBA0419 [Lactobacillus acidophilus NCFM]
 gi|227868946|gb|EEJ76367.1| crossover junction endodeoxyribonuclease [Lactobacillus acidophilus
           ATCC 4796]
          Length = 142

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 76/137 (55%), Gaps = 11/137 (8%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFIIGL 75
            +D+G+K +G+AISD           L   ++ +T        L   +   ++  F++GL
Sbjct: 5   GLDVGSKTVGVAISDE---LGITAQKLETIQIDETKYNFGMRPLKKLVRQYDVDGFVLGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNV-SRKKRI 133
           P NM+G+ G  V  ++A+    ++ K  +P  + DERLTT+ ++++LI D  +  RKKR 
Sbjct: 62  PKNMDGTSGNSVARSKAY-GKRLEEKFNLPVYYSDERLTTIESRRVLIEDAGMHDRKKRK 120

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D +AA LILQ  LD
Sbjct: 121 QVIDQMAAVLILQNYLD 137


>gi|310778165|ref|YP_003966498.1| Holliday junction resolvase YqgF [Ilyobacter polytropus DSM 2926]
 gi|309747488|gb|ADO82150.1| Holliday junction resolvase YqgF [Ilyobacter polytropus DSM 2926]
          Length = 139

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 72/131 (54%), Gaps = 2/131 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  RIG+A SD    FAHP   + R K T+    +      EN  + ++G+P +++
Sbjct: 7   ALDVGDVRIGVARSDAMGMFAHPLEVIDRTK-TKAVKRVQELCRQENTKSIVVGIPKSLD 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKVDSI 139
           G E  +    R F+  +      +  +  DERL+T+SA+++L +  N   + + + VD I
Sbjct: 66  GQEKRQAEKVREFIEKLNKSIEGLEIIEIDERLSTISAERMLNETTNKDARGKRKVVDKI 125

Query: 140 AAALILQEVLD 150
           AAA+ILQ  LD
Sbjct: 126 AAAIILQTYLD 136


>gi|294628345|ref|ZP_06706905.1| conserved hypothetical protein [Streptomyces sp. e14]
 gi|292831678|gb|EFF90027.1| conserved hypothetical protein [Streptomyces sp. e14]
          Length = 154

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 66/142 (46%), Gaps = 2/142 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID+G  RIG+A  DP    A P   +  + V      L   +        ++GLP ++ 
Sbjct: 8   AIDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLRQLVEEYEPIEVVVGLPRSLK 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     RAF   +      VP    DER+TTV+A Q L    V  KK    +D  A
Sbjct: 68  GGEGPAAVKVRAFAGELAKGVAPVPVRLVDERMTTVTASQGLRASGVKSKKGRSVIDQAA 127

Query: 141 AALILQEVL--DRISFLESSKG 160
           A +ILQ+ L  +R+S     +G
Sbjct: 128 AVIILQQALESERVSGEPPGEG 149


>gi|257440576|ref|ZP_05616331.1| putative Holliday junction resolvase [Faecalibacterium prausnitzii
           A2-165]
 gi|257196899|gb|EEU95183.1| putative Holliday junction resolvase [Faecalibacterium prausnitzii
           A2-165]
          Length = 143

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 67/134 (50%), Gaps = 6/134 (4%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLSFITTENIAAFIIGLPL 77
           I ++D G  R GLA+ DP      P  P +  K   + A E+      +     ++GLPL
Sbjct: 3   ILAVDYGASRTGLAVCDPTEFLTTPITPQITLKARPKVAAEVCRIAQEQKAELIVVGLPL 62

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVY--VPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           NM+G+EG R   +R     +   +++  +P   WDER +T  A  IL ++      R   
Sbjct: 63  NMDGTEGERAEKSRKLGKTL---QIWSGLPVRMWDERQSTCEAADILDEVGTFGAHRKAI 119

Query: 136 VDSIAAALILQEVL 149
           +DS++A +IL++ L
Sbjct: 120 LDSVSATVILEDYL 133


>gi|297198337|ref|ZP_06915734.1| Holliday junction resolvase YqgF [Streptomyces sviceus ATCC 29083]
 gi|297147063|gb|EDY58423.2| Holliday junction resolvase YqgF [Streptomyces sviceus ATCC 29083]
          Length = 154

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 66/142 (46%), Gaps = 2/142 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID+G  RIG+A  DP    A P   +  + V      L   +        ++GLP ++ 
Sbjct: 8   AIDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLKQLVEEYEPIEVVVGLPRSLK 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     R FV  +      VP    DER+TTV+A Q L    V  KK    +D  A
Sbjct: 68  GGEGPAAVKVRGFVQELARGIAPVPVRLVDERMTTVTASQGLRASGVKSKKGRSVIDQAA 127

Query: 141 AALILQEVL--DRISFLESSKG 160
           A +ILQ+ L  +R+S     +G
Sbjct: 128 AVIILQQALESERVSGKAPGEG 149


>gi|329938947|ref|ZP_08288321.1| Holliday junction resolvase subunit [Streptomyces griseoaurantiacus
           M045]
 gi|329301832|gb|EGG45725.1| Holliday junction resolvase subunit [Streptomyces griseoaurantiacus
           M045]
          Length = 154

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 63/140 (45%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID+G  RIG+A  DP    A P   +  + V      L   +        ++GLP ++ 
Sbjct: 8   AIDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLKQLVEEYEPIEVVVGLPRSLK 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     R F   +      VP    DER+TTV+A Q L    V  KK    +D  A
Sbjct: 68  GGEGPAAVKVRGFAQELAGLIAPVPVRLLDERMTTVTASQGLRASGVKSKKGRSVIDQAA 127

Query: 141 AALILQEVLDRISFLESSKG 160
           A +ILQ+ L+      SS G
Sbjct: 128 AVIILQQALESERVSGSSPG 147


>gi|323465942|gb|ADX69629.1| Putative Holliday junction resolvase [Lactobacillus helveticus H10]
          Length = 142

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 75/137 (54%), Gaps = 11/137 (8%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFIIGL 75
            +D+G+K +G+A+SD           L   K+ +T        L   +    +  F++GL
Sbjct: 5   GLDIGSKTVGVAVSDE---LGITAQKLETIKIDETKYNFGMRPLKKLVRQYEVDGFVLGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNV-SRKKRI 133
           P NM+G+ G  V  ++A+    ++ K  +P  + DERLTT+ ++++L+ D  +  RKKR 
Sbjct: 62  PKNMDGTSGASVARSKAY-GKRLEEKFGLPVHYSDERLTTIESRRVLVEDAGIHDRKKRK 120

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D +AA LILQ  LD
Sbjct: 121 QVIDQMAAVLILQNYLD 137


>gi|229815210|ref|ZP_04445546.1| hypothetical protein COLINT_02256 [Collinsella intestinalis DSM
           13280]
 gi|229809220|gb|EEP44986.1| hypothetical protein COLINT_02256 [Collinsella intestinalis DSM
           13280]
          Length = 142

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 65/130 (50%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  R G+A+SD   R A P   L   +V   A      +        + GLP  M+
Sbjct: 5   ALDIGGTRTGIAVSDRTGRVAMPLKVLPACEVEGMARSFRMILEDHEPDVLVCGLPQTMS 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP+    R  V   I     +P  F DERLT+  A++IL +  ++ K+   KVD I+
Sbjct: 65  GEEGPQAEHIRE-VAGRIAAATGLPLEFIDERLTSTEAKRILREQGLNEKQMRGKVDMIS 123

Query: 141 AALILQEVLD 150
           A+L LQ  LD
Sbjct: 124 ASLFLQAWLD 133


>gi|260102889|ref|ZP_05753126.1| conserved hypothetical protein [Lactobacillus helveticus DSM 20075]
 gi|260083302|gb|EEW67422.1| conserved hypothetical protein [Lactobacillus helveticus DSM 20075]
 gi|328462755|gb|EGF34644.1| Holliday junction resolvase-like protein [Lactobacillus helveticus
           MTCC 5463]
          Length = 142

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 75/137 (54%), Gaps = 11/137 (8%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFIIGL 75
            +D+G+K +G+A+SD           L   K+ +T        L   +    +  F++GL
Sbjct: 5   GLDIGSKTVGVAVSDE---LGITAQKLETIKIDETKYNFGMRPLKKLVRQYEVDGFVLGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNV-SRKKRI 133
           P NM+G+ G  V  ++A+    ++ K  +P  + DERLTT+ ++++L+ D  +  RKKR 
Sbjct: 62  PKNMDGTSGASVTRSKAY-GKRLEEKFGLPVHYSDERLTTIESRRVLVEDAGIHDRKKRK 120

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D +AA LILQ  LD
Sbjct: 121 QVIDQMAAVLILQNYLD 137


>gi|269216087|ref|ZP_06159941.1| putative Holliday junction resolvase [Slackia exigua ATCC 700122]
 gi|269130346|gb|EEZ61424.1| putative Holliday junction resolvase [Slackia exigua ATCC 700122]
          Length = 171

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 64/130 (49%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  RIG+AISDP  R A P   L   +V   A      +      A + GLP  + 
Sbjct: 23  ALDIGDARIGIAISDPAGRVASPLKVLPAAEVLGHAASFRMLVEDWMPDALVCGLPFTLA 82

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G +GP+  S +      I +   +P  F DERL++  A++ L +     +    KVD IA
Sbjct: 83  GEQGPQAASLKERAQR-IAKACDLPLYFSDERLSSSEAKRFLREGGYDERAMRGKVDMIA 141

Query: 141 AALILQEVLD 150
           A++ LQ  LD
Sbjct: 142 ASIFLQSWLD 151


>gi|315037653|ref|YP_004031221.1| Holliday junction resolvase-like protein [Lactobacillus amylovorus
           GRL 1112]
 gi|325956138|ref|YP_004286748.1| Holliday junction resolvase-like protein [Lactobacillus acidophilus
           30SC]
 gi|312275786|gb|ADQ58426.1| Holliday junction resolvase-like protein [Lactobacillus amylovorus
           GRL 1112]
 gi|325332703|gb|ADZ06611.1| Holliday junction resolvase-like protein [Lactobacillus acidophilus
           30SC]
 gi|327182946|gb|AEA31393.1| Holliday junction resolvase-like protein [Lactobacillus amylovorus
           GRL 1118]
          Length = 142

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 75/137 (54%), Gaps = 11/137 (8%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFIIGL 75
            +D+G+K +G+A+SD           L   ++ +T        L   +   +   F++GL
Sbjct: 5   GLDVGSKTVGVAVSD---ELGITAQKLETIQIDETKYNFGMRPLKKLVRQYDPEGFVLGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNV-SRKKRI 133
           P NM+G+ G  V  ++A+    ++ K  +P  + DERLTT+ +Q++L+ D  +  RKKR 
Sbjct: 62  PKNMDGTSGSSVARSKAY-GKRLEEKFGLPVYYSDERLTTIESQRVLVEDAGIHDRKKRK 120

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D +AA LILQ  LD
Sbjct: 121 QVIDQMAAVLILQNYLD 137


>gi|297155786|gb|ADI05498.1| Holliday junction resolvase-like protein [Streptomyces
           bingchenggensis BCW-1]
          Length = 154

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 62/130 (47%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID+G  RIG+A  DP    A P   +  + +      L + +        ++GLP +++
Sbjct: 8   AIDVGDARIGVASCDPDGILATPVETVPGRDIPAAHKRLAAVVEEYEPIEVVVGLPRSLS 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     R F      R   VP    DER+TTV+A Q L    V+ KK    VD  A
Sbjct: 68  GREGPAAAKVRTFAREFARRVAPVPVRLVDERMTTVTAAQGLRASGVTSKKGRSVVDQAA 127

Query: 141 AALILQEVLD 150
           A +ILQ  L+
Sbjct: 128 AVVILQSALE 137


>gi|239907946|ref|YP_002954687.1| putative holliday junction resolvase [Desulfovibrio magneticus
           RS-1]
 gi|239797812|dbj|BAH76801.1| putative holliday junction resolvase [Desulfovibrio magneticus
           RS-1]
          Length = 147

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 70/146 (47%), Gaps = 3/146 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + I +ID G  R+GLA+  PG   A P   +  +        LL+ I  +N    +IG P
Sbjct: 2   EKILAIDYGQARVGLAVCAPGSEIAFPHSTIAWETRDDLFARLLAVIEEQNPGRIVIGYP 61

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
               G EG      R F   +  R+  VP  + DE  +T  A + L +  +S ++ + KV
Sbjct: 62  ARAGGDEGLTGRQVRNFAARLA-RRTAVPLAYADEAHSTEEAAERLREAGLSGRELLAKV 120

Query: 137 DSIAAALILQEVL--DRISFLESSKG 160
           D++AAA+IL+  L    + F  SS G
Sbjct: 121 DAMAAAVILERYLRGGELCFEPSSLG 146


>gi|312195531|ref|YP_004015592.1| Holliday junction resolvase YqgF [Frankia sp. EuI1c]
 gi|311226867|gb|ADP79722.1| Holliday junction resolvase YqgF [Frankia sp. EuI1c]
          Length = 197

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 68/131 (51%), Gaps = 1/131 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIA-AFIIGLPLNM 79
            +D+GT RIG+++SDP    A P   L R     + L  L+ +  E  A A ++GLP+ +
Sbjct: 49  GVDVGTVRIGVSVSDPDGVLALPIGTLRRDVSDNSDLAQLAELVHERRAVAVVVGLPMTL 108

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +G EG      R +  ++  R   +P    DERLTT +A + + +  +S + R   VD  
Sbjct: 109 SGEEGLAAQRIRQYAQSLSARVAPIPVRLVDERLTTAAAHRRMAERGLSSRARRGLVDQE 168

Query: 140 AAALILQEVLD 150
           AA  ILQ  LD
Sbjct: 169 AAVQILQHALD 179


>gi|289643075|ref|ZP_06475206.1| Holliday junction resolvase YqgF [Frankia symbiont of Datisca
           glomerata]
 gi|289507119|gb|EFD28087.1| Holliday junction resolvase YqgF [Frankia symbiont of Datisca
           glomerata]
          Length = 164

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 65/131 (49%), Gaps = 1/131 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAA-FIIGLPLNM 79
            ID+GT RIG+A SDP  R A P   L R     + L+ ++ I  +  A   ++GLP  +
Sbjct: 10  GIDVGTVRIGVAASDPDARIAFPVTTLRRGTRLNSDLDEIAMIVRDRHAVEVVVGLPTRL 69

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +G  GP     R +   +  R   VP    DERLTTV A + + +  +  + R   VD  
Sbjct: 70  SGLPGPAARKAREYADLLAARVAPVPVRLVDERLTTVVAHRRMAERGLRARDRRAVVDQE 129

Query: 140 AAALILQEVLD 150
           AA  ILQ  LD
Sbjct: 130 AAVQILQSALD 140


>gi|145594372|ref|YP_001158669.1| Holliday junction resolvase YqgF [Salinispora tropica CNB-440]
 gi|145303709|gb|ABP54291.1| Holliday junction resolvase YqgF [Salinispora tropica CNB-440]
          Length = 153

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 68/136 (50%), Gaps = 6/136 (4%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKK------VTQTALELLSFITTENIAAFIIG 74
            +D+G  R+G+A SDP    A P   L R +      V     EL + +T       ++G
Sbjct: 11  GVDVGQVRVGVARSDPHGVLATPLVTLARDRAVAPEAVPSDMAELAALVTEHEAVEVVVG 70

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP+N+ G +GP     +A+V  +++    VP    DER++TV A + L +  V  +++  
Sbjct: 71  LPVNLAGRQGPAAVHVQAYVGRLVEVISPVPVTLADERMSTVVASRRLAERGVRGRRQRA 130

Query: 135 KVDSIAAALILQEVLD 150
            VD  AA  ILQ  LD
Sbjct: 131 VVDQAAAVEILQSWLD 146


>gi|169334466|ref|ZP_02861659.1| hypothetical protein ANASTE_00869 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259183|gb|EDS73149.1| hypothetical protein ANASTE_00869 [Anaerofustis stercorihominis DSM
           17244]
          Length = 144

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 71/133 (53%), Gaps = 2/133 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLPL 77
           I ++D G  RIG+A+SD     A     + R K  +  +E +  +I   +    I+G PL
Sbjct: 5   ILALDYGDSRIGVAVSDALHITAQGICVIKRTKNIEEDIEKIKKYIKEYDTGLVILGHPL 64

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           N++G  G R   T  F  +++  K+ +P   WDERL+T  A++ L    V+ +K+ + +D
Sbjct: 65  NLSGERGTRALVTEEFC-DILKEKIDIPVELWDERLSTKEAERALEAGGVNWRKKREVID 123

Query: 138 SIAAALILQEVLD 150
            +AA +IL   LD
Sbjct: 124 MMAAQIILSSYLD 136


>gi|257468001|ref|ZP_05632097.1| DNA integration/recombination/invertion protein [Fusobacterium
           ulcerans ATCC 49185]
 gi|317062287|ref|ZP_07926772.1| DNA integration/recombination/inversion protein [Fusobacterium
           ulcerans ATCC 49185]
 gi|313687963|gb|EFS24798.1| DNA integration/recombination/inversion protein [Fusobacterium
           ulcerans ATCC 49185]
          Length = 139

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 73/133 (54%), Gaps = 6/133 (4%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           S+D+G  RIG+A SD     A P   + RKK T+    +      EN  A ++G+P +++
Sbjct: 7   SLDVGDVRIGVAKSDIMGIVATPLEVIDRKK-TKAVKRIKELCIQENTKALVVGIPKSLD 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK---VD 137
           G+E  +    R F+  +      +  +  DERLTTVSA ++L + N  +K  ++K   VD
Sbjct: 66  GTEKRQAEKVREFIAKLNKEIEGLEIIEVDERLTTVSADRMLNESN--KKGALEKRKVVD 123

Query: 138 SIAAALILQEVLD 150
            IAAA+ILQ  LD
Sbjct: 124 KIAAAIILQTFLD 136


>gi|29375778|ref|NP_814932.1| Holliday junction resolvase-like protein [Enterococcus faecalis
           V583]
 gi|227518457|ref|ZP_03948506.1| crossover junction endodeoxyribonuclease [Enterococcus faecalis
           TX0104]
 gi|227552987|ref|ZP_03983036.1| crossover junction endodeoxyribonuclease [Enterococcus faecalis
           HH22]
 gi|229546119|ref|ZP_04434844.1| crossover junction endodeoxyribonuclease [Enterococcus faecalis
           TX1322]
 gi|229550308|ref|ZP_04439033.1| crossover junction endodeoxyribonuclease [Enterococcus faecalis
           ATCC 29200]
 gi|255973080|ref|ZP_05423666.1| conserved hypothetical protein [Enterococcus faecalis T1]
 gi|255976119|ref|ZP_05426705.1| conserved hypothetical protein [Enterococcus faecalis T2]
 gi|256618786|ref|ZP_05475632.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|256762206|ref|ZP_05502786.1| conserved hypothetical protein [Enterococcus faecalis T3]
 gi|256852851|ref|ZP_05558221.1| conserved hypothetical protein [Enterococcus faecalis T8]
 gi|256958695|ref|ZP_05562866.1| conserved hypothetical protein [Enterococcus faecalis DS5]
 gi|256962207|ref|ZP_05566378.1| conserved hypothetical protein [Enterococcus faecalis Merz96]
 gi|256965397|ref|ZP_05569568.1| conserved hypothetical protein [Enterococcus faecalis HIP11704]
 gi|257077951|ref|ZP_05572312.1| conserved hypothetical protein [Enterococcus faecalis JH1]
 gi|257082840|ref|ZP_05577201.1| conserved hypothetical protein [Enterococcus faecalis E1Sol]
 gi|257085538|ref|ZP_05579899.1| conserved hypothetical protein [Enterococcus faecalis Fly1]
 gi|257086556|ref|ZP_05580917.1| conserved hypothetical protein [Enterococcus faecalis D6]
 gi|257089613|ref|ZP_05583974.1| conserved hypothetical protein [Enterococcus faecalis CH188]
 gi|257415820|ref|ZP_05592814.1| conserved hypothetical protein [Enterococcus faecalis AR01/DG]
 gi|257419029|ref|ZP_05596023.1| conserved hypothetical protein [Enterococcus faecalis T11]
 gi|257422886|ref|ZP_05599876.1| conserved hypothetical protein [Enterococcus faecalis X98]
 gi|293383234|ref|ZP_06629150.1| putative Holliday junction resolvase [Enterococcus faecalis R712]
 gi|293387611|ref|ZP_06632157.1| putative Holliday junction resolvase [Enterococcus faecalis S613]
 gi|294781118|ref|ZP_06746468.1| RNAse YqgF [Enterococcus faecalis PC1.1]
 gi|300859927|ref|ZP_07106015.1| RNAse YqgF [Enterococcus faecalis TUSoD Ef11]
 gi|307268684|ref|ZP_07550053.1| hypothetical protein TIGR00250 [Enterococcus faecalis TX4248]
 gi|307273508|ref|ZP_07554752.1| hypothetical protein TIGR00250 [Enterococcus faecalis TX0855]
 gi|307274473|ref|ZP_07555656.1| hypothetical protein TIGR00250 [Enterococcus faecalis TX2134]
 gi|307279022|ref|ZP_07560080.1| hypothetical protein TIGR00250 [Enterococcus faecalis TX0860]
 gi|307288496|ref|ZP_07568482.1| hypothetical protein TIGR00250 [Enterococcus faecalis TX0109]
 gi|307291186|ref|ZP_07571071.1| hypothetical protein TIGR00250 [Enterococcus faecalis TX0411]
 gi|312899674|ref|ZP_07758998.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX0470]
 gi|312903954|ref|ZP_07763123.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX0635]
 gi|312907178|ref|ZP_07766169.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           DAPTO 512]
 gi|312909797|ref|ZP_07768645.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           DAPTO 516]
 gi|312951035|ref|ZP_07769943.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX0102]
 gi|62901023|sp|Q836B2|RUVX_ENTFA RecName: Full=Putative Holliday junction resolvase
 gi|29343239|gb|AAO81002.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           V583]
 gi|227074135|gb|EEI12098.1| crossover junction endodeoxyribonuclease [Enterococcus faecalis
           TX0104]
 gi|227177878|gb|EEI58850.1| crossover junction endodeoxyribonuclease [Enterococcus faecalis
           HH22]
 gi|229304571|gb|EEN70567.1| crossover junction endodeoxyribonuclease [Enterococcus faecalis
           ATCC 29200]
 gi|229308643|gb|EEN74630.1| crossover junction endodeoxyribonuclease [Enterococcus faecalis
           TX1322]
 gi|255964098|gb|EET96574.1| conserved hypothetical protein [Enterococcus faecalis T1]
 gi|255968991|gb|EET99613.1| conserved hypothetical protein [Enterococcus faecalis T2]
 gi|256598313|gb|EEU17489.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|256683457|gb|EEU23152.1| conserved hypothetical protein [Enterococcus faecalis T3]
 gi|256711310|gb|EEU26348.1| conserved hypothetical protein [Enterococcus faecalis T8]
 gi|256949191|gb|EEU65823.1| conserved hypothetical protein [Enterococcus faecalis DS5]
 gi|256952703|gb|EEU69335.1| conserved hypothetical protein [Enterococcus faecalis Merz96]
 gi|256955893|gb|EEU72525.1| conserved hypothetical protein [Enterococcus faecalis HIP11704]
 gi|256985981|gb|EEU73283.1| conserved hypothetical protein [Enterococcus faecalis JH1]
 gi|256990870|gb|EEU78172.1| conserved hypothetical protein [Enterococcus faecalis E1Sol]
 gi|256993568|gb|EEU80870.1| conserved hypothetical protein [Enterococcus faecalis Fly1]
 gi|256994586|gb|EEU81888.1| conserved hypothetical protein [Enterococcus faecalis D6]
 gi|256998425|gb|EEU84945.1| conserved hypothetical protein [Enterococcus faecalis CH188]
 gi|257157648|gb|EEU87608.1| conserved hypothetical protein [Enterococcus faecalis ARO1/DG]
 gi|257160857|gb|EEU90817.1| conserved hypothetical protein [Enterococcus faecalis T11]
 gi|257164710|gb|EEU94670.1| conserved hypothetical protein [Enterococcus faecalis X98]
 gi|291079412|gb|EFE16776.1| putative Holliday junction resolvase [Enterococcus faecalis R712]
 gi|291082943|gb|EFE19906.1| putative Holliday junction resolvase [Enterococcus faecalis S613]
 gi|294451796|gb|EFG20248.1| RNAse YqgF [Enterococcus faecalis PC1.1]
 gi|300850745|gb|EFK78494.1| RNAse YqgF [Enterococcus faecalis TUSoD Ef11]
 gi|306497840|gb|EFM67372.1| hypothetical protein TIGR00250 [Enterococcus faecalis TX0411]
 gi|306500571|gb|EFM69902.1| hypothetical protein TIGR00250 [Enterococcus faecalis TX0109]
 gi|306504147|gb|EFM73359.1| hypothetical protein TIGR00250 [Enterococcus faecalis TX0860]
 gi|306508867|gb|EFM77954.1| hypothetical protein TIGR00250 [Enterococcus faecalis TX2134]
 gi|306509847|gb|EFM78873.1| hypothetical protein TIGR00250 [Enterococcus faecalis TX0855]
 gi|306514996|gb|EFM83542.1| hypothetical protein TIGR00250 [Enterococcus faecalis TX4248]
 gi|310626206|gb|EFQ09489.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           DAPTO 512]
 gi|310630990|gb|EFQ14273.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX0102]
 gi|310632674|gb|EFQ15957.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX0635]
 gi|311289755|gb|EFQ68311.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           DAPTO 516]
 gi|311293180|gb|EFQ71736.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX0470]
 gi|315027757|gb|EFT39689.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX2137]
 gi|315029152|gb|EFT41084.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX4000]
 gi|315031532|gb|EFT43464.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX0017]
 gi|315035052|gb|EFT46984.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX0027]
 gi|315145514|gb|EFT89530.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX2141]
 gi|315147685|gb|EFT91701.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX4244]
 gi|315151387|gb|EFT95403.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX0012]
 gi|315154072|gb|EFT98088.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX0031]
 gi|315157359|gb|EFU01376.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX0043]
 gi|315158422|gb|EFU02439.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX0312]
 gi|315162577|gb|EFU06594.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX0645]
 gi|315165420|gb|EFU09437.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX1302]
 gi|315166586|gb|EFU10603.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX1341]
 gi|315575738|gb|EFU87929.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX0309B]
 gi|315578303|gb|EFU90494.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX0630]
 gi|315579818|gb|EFU92009.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX0309A]
 gi|327534828|gb|AEA93662.1| crossover junction endodeoxyribonuclease [Enterococcus faecalis
           OG1RF]
 gi|329576586|gb|EGG58091.1| RNAse H domain protein, YqgF family [Enterococcus faecalis TX1467]
          Length = 140

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 73/135 (54%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL--ELLSFITTENIAAFIIGLP 76
           I  +D+G++ +G+A+SD     A     +   +  +      L   +    +  F++GLP
Sbjct: 3   IMGLDVGSRTVGVAVSDLLGWTAQGIEIIRINEEEENFGFERLGELVKEYEVTKFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN S GPR  ++ A+  + I     +P  + DERLTTV A++ L++  + SR KR + 
Sbjct: 63  KNMNNSIGPRAEASMAY-GDKIQELFQLPVDYQDERLTTVQAERFLVEQADASRAKRKKV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA +ILQ  LD
Sbjct: 122 IDKLAAVMILQNYLD 136


>gi|328881149|emb|CCA54388.1| putative Holliday junction resolvase [Streptomyces venezuelae ATCC
           10712]
          Length = 156

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 66/142 (46%), Gaps = 2/142 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  RIG+A  DP    A P   +  + V      L   +        ++GLP +++
Sbjct: 10  AVDVGDARIGVASCDPDGVLATPVETVPGRDVPAAHRRLRQIVEEYEPIEVVVGLPRSLS 69

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     RAF   M      VP    DER+TTV+A Q L    V  KK    +D  A
Sbjct: 70  GREGPAATKVRAFAGEMAKGIAPVPVRLVDERMTTVTATQGLRASGVKAKKGRSVIDQAA 129

Query: 141 AALILQEVL--DRISFLESSKG 160
           A +ILQ  L  +R+S     +G
Sbjct: 130 AVIILQNALEAERVSGNPPGEG 151


>gi|295425853|ref|ZP_06818533.1| crossover junction endodeoxyribonuclease [Lactobacillus
           amylolyticus DSM 11664]
 gi|295064456|gb|EFG55384.1| crossover junction endodeoxyribonuclease [Lactobacillus
           amylolyticus DSM 11664]
          Length = 142

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 75/134 (55%), Gaps = 5/134 (3%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLN 78
            +D+G+K +G+AISD  G          + +      +  L  I  E + A F++GLP N
Sbjct: 5   GLDIGSKTVGVAISDELGITAQKLETIPIDESKFNFGMRPLKKIVREYDPAGFVLGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV--SRKKRIQKV 136
           M+G+ G  V  ++A+   +  +K  +P  + DERLTTV ++++L++      RKKR Q +
Sbjct: 65  MDGTSGHSVDRSKAYGERL-KKKFNLPVYYDDERLTTVESRRVLVEEAGVHDRKKRKQVI 123

Query: 137 DSIAAALILQEVLD 150
           D +AA LILQ  LD
Sbjct: 124 DQMAAVLILQNYLD 137


>gi|148284294|ref|YP_001248384.1| Holliday junction resolvase-like protein [Orientia tsutsugamushi
           str. Boryong]
 gi|167012743|sp|A5CCV6|RUVX_ORITB RecName: Full=Putative Holliday junction resolvase
 gi|146739733|emb|CAM79564.1| holliday junction resolvase [Orientia tsutsugamushi str. Boryong]
          Length = 157

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 78/152 (51%), Gaps = 2/152 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I  I + +++    + I  ID G K++G+AIS+     A P   ++     +   ++ 
Sbjct: 1   MIINSISEFLQAADIKKQILGIDFGEKKVGVAISNIEHTVAMPLQTILATNQDRVN-KIQ 59

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                 NI A +IGLP  ++G+E  + H  + F  N +  K+ +P    DERLT+ +A  
Sbjct: 60  EIAVAYNIGAIVIGLPFKLDGTETSQTHRVKDFA-NKLANKLLLPIFLCDERLTSKAANN 118

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRI 152
           +L   N+ RK R    D +AA++IL+  L R+
Sbjct: 119 LLKIGNIKRKVRNAIDDRVAASIILEGALKRM 150


>gi|302550142|ref|ZP_07302484.1| Holliday junction resolvase YqgF [Streptomyces viridochromogenes
           DSM 40736]
 gi|302467760|gb|EFL30853.1| Holliday junction resolvase YqgF [Streptomyces viridochromogenes
           DSM 40736]
          Length = 154

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 66/142 (46%), Gaps = 2/142 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID+G  RIG+A  DP    A P   +  + +      L   +        ++GLP ++ 
Sbjct: 8   AIDVGDARIGVASCDPDGILATPVETVPGRDIPAAQRRLKGLVEEYEPIEVVVGLPRSLK 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     R FV  +      VP    DER+TTV+A Q L    V  KK    +D  A
Sbjct: 68  GGEGPAAVKVRGFVQELARMISPVPVRLVDERMTTVTASQGLRASGVKSKKGRSVIDQAA 127

Query: 141 AALILQEVL--DRISFLESSKG 160
           A +ILQ+ L  +R+S     +G
Sbjct: 128 AVVILQQALESERVSGKAPGEG 149


>gi|329942939|ref|ZP_08291718.1| hypothetical protein G5Q_0615 [Chlamydophila psittaci Cal10]
 gi|332287530|ref|YP_004422431.1| Holliday junction resolvase-like protein [Chlamydophila psittaci
           6BC]
 gi|313848107|emb|CBY17106.1| putative Holliday junction resolvase [Chlamydophila psittaci RD1]
 gi|325506817|gb|ADZ18455.1| Holliday junction resolvase-like protein [Chlamydophila psittaci
           6BC]
 gi|328815199|gb|EGF85188.1| hypothetical protein G5Q_0615 [Chlamydophila psittaci Cal10]
 gi|328914779|gb|AEB55612.1| conserved hypothetical protein TIGR00250 [Chlamydophila psittaci
           6BC]
          Length = 150

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 72/140 (51%), Gaps = 8/140 (5%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLNM 79
            +D G KRIGLA +      + P  F+   K  +   +LL  I  E N++  ++G P+ M
Sbjct: 12  GVDYGEKRIGLAYASSPLCISLPIGFIATGKTLEATAKLLVGIIQERNVSTVVLGNPIPM 71

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQKVDS 138
              +   +      + +++     V  + WDERL++  A+++L  D  +SRKKR  K DS
Sbjct: 72  QKGQKSALQEDILKLSSLLQEFCPVEVILWDERLSSAEAERMLKGDCGLSRKKRKGKTDS 131

Query: 139 IAAALILQEVLDRISFLESS 158
           IAA LIL       SFLESS
Sbjct: 132 IAANLIL------TSFLESS 145


>gi|256379271|ref|YP_003102931.1| Holliday junction resolvase YqgF [Actinosynnema mirum DSM 43827]
 gi|255923574|gb|ACU39085.1| Holliday junction resolvase YqgF [Actinosynnema mirum DSM 43827]
          Length = 170

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 67/131 (51%), Gaps = 1/131 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-LLSFITTENIAAFIIGLPLNM 79
            +D+G  R+G+A+SDPG   A P   L R +     L+ L+      ++   ++GLP  +
Sbjct: 19  GVDVGAVRVGVALSDPGAFLATPLVTLSRDEKNGRDLDDLVGLAAEHDVVEVVVGLPRTL 78

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
            G  GP   +  A+   + +R   +P    DERLTTV+A ++L    V  KK+   VD  
Sbjct: 79  AGKHGPAAQAATAYAAALAERVAPLPVRLTDERLTTVTASRVLAQRGVRGKKQRAVVDQA 138

Query: 140 AAALILQEVLD 150
           AA  ILQ  LD
Sbjct: 139 AAVEILQSWLD 149


>gi|217967412|ref|YP_002352918.1| Holliday junction resolvase YqgF [Dictyoglomus turgidum DSM 6724]
 gi|226725514|sp|B8E227|RUVX_DICTD RecName: Full=Putative Holliday junction resolvase
 gi|217336511|gb|ACK42304.1| Holliday junction resolvase YqgF [Dictyoglomus turgidum DSM 6724]
          Length = 141

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 69/136 (50%), Gaps = 1/136 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + +ID G K IGLAISDP R  A        K        L   I   N++  ++G P++
Sbjct: 3   VLAIDWGEKYIGLAISDPLRIIAQGLDVWEIKDEEDFVNRLKKLIKEYNVSEIVLGYPIS 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           + G E  +      +V   I   V +P  F DER TT+ A+++L++ ++ R+ R    + 
Sbjct: 63  LRGHENEKTKKI-EYVAERIKTVVNLPIKFVDERFTTMEAERVLLEGDIKRRDRKLLKNK 121

Query: 139 IAAALILQEVLDRISF 154
            AA +ILQ+ LD +S 
Sbjct: 122 QAAVIILQKYLDSLSL 137


>gi|29833393|ref|NP_828027.1| hypothetical protein SAV_6851 [Streptomyces avermitilis MA-4680]
 gi|62901021|sp|Q827S3|RUVX_STRAW RecName: Full=Putative Holliday junction resolvase
 gi|29610516|dbj|BAC74562.1| hypothetical protein [Streptomyces avermitilis MA-4680]
          Length = 156

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 66/142 (46%), Gaps = 2/142 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  RIG+A  DP    A P   +  + V      L   +        ++GLP ++ 
Sbjct: 10  AVDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLKQLVEEYEPIEVVLGLPRSLK 69

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     RAF   +      VP    DER+TTV+A Q L    V  KK    +D  A
Sbjct: 70  GGEGPAAVKVRAFAQELARVIAPVPVRLMDERMTTVTASQGLRASGVKSKKGRSVIDQAA 129

Query: 141 AALILQEVL--DRISFLESSKG 160
           A +ILQ+ L  +R+S     +G
Sbjct: 130 AVIILQQALESERVSGKAPGEG 151


>gi|283850501|ref|ZP_06367789.1| Holliday junction resolvase YqgF [Desulfovibrio sp. FW1012B]
 gi|283574072|gb|EFC22044.1| Holliday junction resolvase YqgF [Desulfovibrio sp. FW1012B]
          Length = 152

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 68/133 (51%), Gaps = 5/133 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL--ELLSFITTENIAAFIIGLP 76
           I +ID G  R+GLA+SDP  R A P  F      T+ AL  ELL  IT++ IAA ++G P
Sbjct: 4   ILAIDYGQARVGLAVSDPEGRMAFP--FATVAWQTRDALFRELLDVITSQGIAAIVVGYP 61

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
               G E       R FV  +  R+  +P V  DE  +T  A + L +  +S      +V
Sbjct: 62  ARAGGDESLTGRQVRKFVARL-SRRTDLPIVLVDEAHSTEEAAEQLREAGLSGPALSARV 120

Query: 137 DSIAAALILQEVL 149
           D+ AAA+IL   L
Sbjct: 121 DAQAAAVILTRYL 133


>gi|218259649|ref|ZP_03475312.1| hypothetical protein PRABACTJOHN_00971 [Parabacteroides johnsonii
           DSM 18315]
 gi|218224965|gb|EEC97615.1| hypothetical protein PRABACTJOHN_00971 [Parabacteroides johnsonii
           DSM 18315]
          Length = 140

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 77/143 (53%), Gaps = 11/143 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G KR GLA++D  +  A+    +   ++T+    L  +++ E +  F++GLP  
Sbjct: 4   IIAIDYGRKRTGLAVTDTLQMIANGLTTVPSGELTKF---LADYVSREPVERFVVGLPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           MN      +    AFV ++      +P  ++DER T+V A + ++D  + +KKR  K  V
Sbjct: 61  MNNELSENMKYVEAFVAHLKRTIPDIPVEYYDERFTSVLAHKAMLDGGLKKKKRQDKGLV 120

Query: 137 DSIAAALILQEVLDRISFLESSK 159
           D I+A +ILQ      S+LE+ K
Sbjct: 121 DEISAVIILQ------SYLENKK 137


>gi|325105793|ref|YP_004275447.1| Holliday junction resolvase YqgF [Pedobacter saltans DSM 12145]
 gi|324974641|gb|ADY53625.1| Holliday junction resolvase YqgF [Pedobacter saltans DSM 12145]
          Length = 138

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 73/136 (53%), Gaps = 5/136 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I S D GTKRIG+A++DP +  A+    +  K + +    L  ++ TE++  F++G P  
Sbjct: 4   IMSFDFGTKRIGIAVTDPMKIIANGLTTVHPKDIVEF---LKKYLLTESVETFVVGEPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           M+G++       RAFV+ +      +P    DER T+  A   ++     +K R  K  V
Sbjct: 61  MDGTDSQSAVHVRAFVNLLKKNFSEIPVEMMDERFTSKMASAAILQSGAKKKTRQDKALV 120

Query: 137 DSIAAALILQEVLDRI 152
           D+++A +ILQ  ++++
Sbjct: 121 DTVSATIILQSYMEKL 136


>gi|73667182|ref|YP_303198.1| hypothetical protein Ecaj_0565 [Ehrlichia canis str. Jake]
 gi|146325572|sp|Q3YRQ5|RUVX_EHRCJ RecName: Full=Putative Holliday junction resolvase
 gi|72394323|gb|AAZ68600.1| Conserved hypothetical protein 250 [Ehrlichia canis str. Jake]
          Length = 156

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 70/145 (48%), Gaps = 1/145 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           I++ VK +   + I  +D G K+IG+A+SD     A P    +++   +    L +    
Sbjct: 6   IDEFVKVIDKKKRIIGLDFGEKKIGIALSDKTNLVAIPYSVYIKRSTRKDLGSLYNIFVE 65

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
            N+ + +IG P+ ++G E          + N I  K  +     DER +T  A ++    
Sbjct: 66  NNVGSMVIGWPIELSGIESELCQKV-VLLANRIIAKYKINIYLHDERYSTAMATRVAKLA 124

Query: 126 NVSRKKRIQKVDSIAAALILQEVLD 150
           N+ RK+     D IAA LILQ+VLD
Sbjct: 125 NIKRKESQSIDDKIAAMLILQQVLD 149


>gi|194334951|ref|YP_002016811.1| Holliday junction resolvase YqgF [Prosthecochloris aestuarii DSM
           271]
 gi|226731637|sp|B4S5W7|RUVX_PROA2 RecName: Full=Putative Holliday junction resolvase
 gi|194312769|gb|ACF47164.1| Holliday junction resolvase YqgF [Prosthecochloris aestuarii DSM
           271]
          Length = 142

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 72/135 (53%), Gaps = 5/135 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D GTKRIGLA +DP + FA P      + + +   E+      + I   +IG PLN
Sbjct: 9   IIAVDYGTKRIGLAKTDPLQLFAQPVGTFSEEALFRAIKEISGL---DGIGRILIGYPLN 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
            +GS         AF   + +    +P    +E  ++ SA QILI+  +SRKKR +K  +
Sbjct: 66  ADGSHNRMTDIVDAFAARVHNEFPDIPLELVNEHGSSRSAGQILINSGLSRKKRHEKGRL 125

Query: 137 DSIAAALILQEVLDR 151
           DS +A ++LQ  LD+
Sbjct: 126 DSASACVLLQAHLDK 140


>gi|218294685|ref|ZP_03495539.1| Holliday junction resolvase YqgF [Thermus aquaticus Y51MC23]
 gi|218244593|gb|EED11117.1| Holliday junction resolvase YqgF [Thermus aquaticus Y51MC23]
          Length = 135

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 68/133 (51%), Gaps = 2/133 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + ++D+G  RIGLA+ + G  FA  R +LVR+ + +    LL F+  E +A  I+GLPL 
Sbjct: 3   LGALDVGEARIGLAVGEEGLPFAFGRGYLVRRSLEEDVEALLDFVRREGLAKLIVGLPLR 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
            +  E  +       V  +  R V V    WDER TT +A   L       ++   K+D 
Sbjct: 63  TDLKESAQAKRVLPLVEALRARGVEVE--LWDERYTTKAAMARLRHAPRRVREDKGKLDE 120

Query: 139 IAAALILQEVLDR 151
           ++A ++L+  L R
Sbjct: 121 MSAVVLLEGYLAR 133


>gi|320528373|ref|ZP_08029535.1| conserved hypothetical protein TIGR00250 [Solobacterium moorei
           F0204]
 gi|320131287|gb|EFW23855.1| conserved hypothetical protein TIGR00250 [Solobacterium moorei
           F0204]
          Length = 139

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-LLSFITTENIAAFIIGLPLNM 79
            +DLG+   G++ SD G           +      AL+ +L  +  E     ++GLPL +
Sbjct: 6   GLDLGSVTCGVSFSDTGFIARTIETIRFKPDDYNMALDKVLDIVDREKPDVIVLGLPLLL 65

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           N   GPR      F   +++++  +P    DER TT  A+ IL++ +VSRKKR +K+D +
Sbjct: 66  NDDVGPRAQICLEF-GEVLEQESGIPVKMQDERFTTAVAESILLEADVSRKKRKKKIDQL 124

Query: 140 AAALILQEVLDR 151
           AA  ILQ  LDR
Sbjct: 125 AAVQILQTWLDR 136


>gi|161506985|ref|YP_001576939.1| putative DNA recombination protein [Lactobacillus helveticus DPC
           4571]
 gi|172048187|sp|A8YTJ2|RUVX_LACH4 RecName: Full=Putative Holliday junction resolvase
 gi|160347974|gb|ABX26648.1| putative DNA recombination protein [Lactobacillus helveticus DPC
           4571]
          Length = 142

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (54%), Gaps = 11/137 (8%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFIIGL 75
            +D+G+K +G+++SD           L   K+ +T        L   +    +  F++GL
Sbjct: 5   GLDIGSKTVGVSVSDE---LGITAQKLETIKIDETKYNFGMRPLKKLVRQYEVDGFVLGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNV-SRKKRI 133
           P NM+G+ G  V  ++A+    ++ K  +P  + DERLTT+ ++++L+ D  +  RKKR 
Sbjct: 62  PKNMDGTSGASVARSKAY-GKRLEEKFGLPVHYSDERLTTIESRRVLVEDAGIHDRKKRK 120

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D +AA LILQ  LD
Sbjct: 121 QVIDQMAAVLILQNYLD 137


>gi|85057698|ref|YP_456614.1| Holliday junction resolvase [Aster yellows witches'-broom
           phytoplasma AYWB]
 gi|146325552|sp|Q2NJ58|RUVX_AYWBP RecName: Full=Putative Holliday junction resolvase
 gi|84789803|gb|ABC65535.1| Holliday junction resolvase [Aster yellows witches'-broom
           phytoplasma AYWB]
          Length = 151

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 67/140 (47%), Gaps = 1/140 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRP-FLVRKKVTQTALELLSFITTENIAAFIIG 74
           N     +DLG K +G+A+S  G    + +  F    K  Q    L   I+   I   I+G
Sbjct: 6   NNASLGLDLGEKTLGIALSQTGIIAQNLKTIFFDTHKYDQLIAPLQKIISQYQIKKIILG 65

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P +MN   G +   +  F   + ++   V  + WDERL+TV A QIL   N  + K +Q
Sbjct: 66  YPKHMNNDIGIKAKISNYFKKTLENKFGQVKVILWDERLSTVQAIQILKTNNKKKGKILQ 125

Query: 135 KVDSIAAALILQEVLDRISF 154
             D IAA++ILQ  LD I  
Sbjct: 126 MKDEIAASIILQNYLDYIKL 145


>gi|295106658|emb|CBL04201.1| conserved hypothetical protein TIGR00250 [Gordonibacter pamelaeae
           7-10-1-b]
          Length = 136

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 65/132 (49%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D+G  R+G+A+ DPG R A P   L   +V   A      +        + GLP  
Sbjct: 3   IMALDIGETRVGVAVCDPGERVASPVCVLPAAEVLSCAKPFRRLLEDWEPELLLCGLPYT 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           + G EGP+         + + +   +P  F DERL++  A++ L +  +  ++   K+D 
Sbjct: 63  LAGQEGPQAARI-RAAADAVTKACGIPHEFADERLSSQEAKRSLREKGLGEREMRGKIDM 121

Query: 139 IAAALILQEVLD 150
           IAA+L LQ  LD
Sbjct: 122 IAASLFLQAWLD 133


>gi|154490275|ref|ZP_02030536.1| hypothetical protein PARMER_00507 [Parabacteroides merdae ATCC
           43184]
 gi|154089167|gb|EDN88211.1| hypothetical protein PARMER_00507 [Parabacteroides merdae ATCC
           43184]
          Length = 140

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 77/143 (53%), Gaps = 11/143 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G KR GLA++D  +  A+    +   ++T+    L  +++ E +  F++GLP  
Sbjct: 4   IIAIDYGRKRTGLAVTDTLQMIANGLTTVPSGELTRF---LADYVSREPVERFVVGLPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           MN      +    AFV ++      +P  ++DER T+V A + ++D  + +KKR  K  V
Sbjct: 61  MNNELSENMRYVEAFVTHLKRTIPDIPVEYYDERFTSVLAHKAMLDGGLKKKKRQDKGLV 120

Query: 137 DSIAAALILQEVLDRISFLESSK 159
           D I+A +ILQ      S+LE+ K
Sbjct: 121 DEISAVIILQ------SYLENKK 137


>gi|21220001|ref|NP_625780.1| Holliday junction resolvase-like protein [Streptomyces coelicolor
           A3(2)]
 gi|32130071|sp|Q9KXQ0|RUVX_STRCO RecName: Full=Putative Holliday junction resolvase
 gi|8249959|emb|CAB93380.1| conserved hypothetical protein [Streptomyces coelicolor A3(2)]
          Length = 167

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 65/142 (45%), Gaps = 2/142 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  RIG+A  DP    A P   +  + V      L   +        ++GLP ++ 
Sbjct: 21  AVDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLRQLVAEYEPIEVVVGLPRSLK 80

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     R F   +      VP    DER+TTV+A Q L    V  KK    +D  A
Sbjct: 81  GGEGPAAAKVRRFTQELAKGIAPVPVRLVDERMTTVTASQGLRASGVKSKKGRSVIDQAA 140

Query: 141 AALILQEVL--DRISFLESSKG 160
           A +ILQ+ L  +R+S     +G
Sbjct: 141 AVIILQQALESERVSGRPPGEG 162


>gi|315169885|gb|EFU13902.1| conserved hypothetical protein TIGR00250 [Enterococcus faecalis
           TX1342]
          Length = 140

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 73/135 (54%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL--ELLSFITTENIAAFIIGLP 76
           I  +D+G++ +G+A+SD     A     +   +  +      L   +    +  F++GLP
Sbjct: 3   IMGLDVGSRTVGVAVSDLLGWTAQGIEIIRINEEEENFGFERLGELVKEYEVTKFVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMN S GPR  ++ A+  + I     +P  + DERLTTV A++ L++  + SR KR + 
Sbjct: 63  KNMNNSIGPRAEASIAY-GDKIQELFQLPVDYQDERLTTVQAERFLVEQADASRAKRKKV 121

Query: 136 VDSIAAALILQEVLD 150
           +D +AA +ILQ  LD
Sbjct: 122 IDKLAAVMILQNYLD 136


>gi|315655397|ref|ZP_07908297.1| Holliday junction resolvase [Mobiluncus curtisii ATCC 51333]
 gi|315490337|gb|EFU79962.1| Holliday junction resolvase [Mobiluncus curtisii ATCC 51333]
          Length = 152

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 67/133 (50%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID+G  RIG+A S  G   A P   L  +       ELL+ IT  N AA  +GLP  M+
Sbjct: 8   AIDVGKARIGVARSVSGTSLALPVETLQVQTDGSELDELLAIITESNPAAVFVGLPKLMS 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EG      R++   ++ R   +P    DERL++  A   L  + V  +++ + VD +A
Sbjct: 68  GKEGEAARMARSYARRLVRRLGELPVHLIDERLSSADAHAKLQQVGVCARRQKEMVDQLA 127

Query: 141 AALILQEVLDRIS 153
           A  IL   L+ ++
Sbjct: 128 AVTILTRALETLT 140


>gi|194337777|ref|YP_002019571.1| Holliday junction resolvase YqgF [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194310254|gb|ACF44954.1| Holliday junction resolvase YqgF [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 145

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 74/140 (52%), Gaps = 5/140 (3%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           L P + + +ID GTKRIG+A SDP   FA P     R  +++    L + I +++IA  I
Sbjct: 3   LTPKKRVVAIDYGTKRIGMAQSDPLWLFAQPVGTFDRAGLSKA---LGTMIQSDDIALVI 59

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +G PL+ NG +         F+  + +    +     DE  ++  A+ IL+    SRK R
Sbjct: 60  VGYPLSENGEKNAMTGVIDRFLETLHEEFPQLRIETLDEHHSSKDARSILVASGKSRKVR 119

Query: 133 IQK--VDSIAAALILQEVLD 150
            QK  VDS AA ++L+E L+
Sbjct: 120 QQKGRVDSAAACILLREYLE 139


>gi|108799314|ref|YP_639511.1| Holliday junction resolvase-like protein [Mycobacterium sp. MCS]
 gi|119868430|ref|YP_938382.1| Holliday junction resolvase-like protein [Mycobacterium sp. KMS]
 gi|122977019|sp|Q1B9H9|RUVX_MYCSS RecName: Full=Putative Holliday junction resolvase
 gi|167012737|sp|A1UFI4|RUVX_MYCSK RecName: Full=Putative Holliday junction resolvase
 gi|108769733|gb|ABG08455.1| Holliday junction resolvase YqgF [Mycobacterium sp. MCS]
 gi|119694519|gb|ABL91592.1| Holliday junction resolvase YqgF [Mycobacterium sp. KMS]
          Length = 169

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 65/131 (49%), Gaps = 1/131 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLNM 79
            ID+G+ R+G+A SDP    A P   + R+K +   +  L+ + TE      ++GLP  +
Sbjct: 24  GIDVGSVRVGVATSDPDGVLATPVETVRREKSSDRHVRRLAQLVTELEAVEVVVGLPRTL 83

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
               GP  H        +  R   VP    DERLTTVSAQ+ L +  V  K +   +D +
Sbjct: 84  ADRTGPAAHDAIDVAEALARRIAPVPVRMADERLTTVSAQRSLREAGVRAKGQRAMIDQV 143

Query: 140 AAALILQEVLD 150
           AA  ILQ  LD
Sbjct: 144 AAVGILQSWLD 154


>gi|288925814|ref|ZP_06419745.1| Holliday junction resolvase [Prevotella buccae D17]
 gi|315608231|ref|ZP_07883221.1| Holliday junction resolvase [Prevotella buccae ATCC 33574]
 gi|288337469|gb|EFC75824.1| Holliday junction resolvase [Prevotella buccae D17]
 gi|315250012|gb|EFU30011.1| Holliday junction resolvase [Prevotella buccae ATCC 33574]
          Length = 139

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 69/138 (50%), Gaps = 14/138 (10%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT----ENIAAFIIG 74
           I SID G KR GLA++DP +  A+          T +++EL  F+ T    E +   +IG
Sbjct: 3   IVSIDYGKKRTGLAVTDPLQIIANGL-------ATVSSVELFGFLETYVKKEGVERIVIG 55

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P  MNG     +     F +        +P  ++DER T+V A + +ID  V +K R +
Sbjct: 56  RPTQMNGQPSENLVRVENFYNRWCKAHPEIPIEYYDERFTSVIAHRAMIDGGVKKKVRQE 115

Query: 135 K---VDSIAAALILQEVL 149
               VD I+A +ILQ+ +
Sbjct: 116 NKGLVDEISATIILQDYM 133


>gi|229820506|ref|YP_002882032.1| Holliday junction resolvase YqgF [Beutenbergia cavernae DSM 12333]
 gi|229566419|gb|ACQ80270.1| Holliday junction resolvase YqgF [Beutenbergia cavernae DSM 12333]
          Length = 163

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 64/130 (49%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+G+ R+G+A  DP    A P   L R+       E+   +  ++    +IGLP  ++
Sbjct: 4   GVDVGSVRVGVARCDPSGVIATPVTTLARRGKRGGVAEIAGLVREDSAIEVVIGLPRALD 63

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EG      RA+   +      VP    DERL+TV+A + + +   + ++  + VD  A
Sbjct: 64  GHEGSSARQARAYAGQVARAVEPVPVRLVDERLSTVAAHRAMHEAGRAGRRHREVVDQAA 123

Query: 141 AALILQEVLD 150
           A +ILQ  LD
Sbjct: 124 AVVILQSALD 133


>gi|295112760|emb|CBL31397.1| conserved hypothetical protein TIGR00250 [Enterococcus sp. 7L76]
 gi|323480436|gb|ADX79875.1| conserved hypothetical protein [Enterococcus faecalis 62]
          Length = 137

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 72/133 (54%), Gaps = 4/133 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL--ELLSFITTENIAAFIIGLPLN 78
            +D+G++ +G+A+SD     A     +   +  +      L   +    +  F++GLP N
Sbjct: 2   GLDVGSRTVGVAVSDLLGWTAQGIEIIRINEEEENFGFERLGELVKEYEVTKFVVGLPKN 61

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKVD 137
           MN S GPR  ++ A+  + I     +P  + DERLTTV A++ L++  + SR KR + +D
Sbjct: 62  MNNSIGPRAEASMAY-GDKIQELFQLPVDYQDERLTTVQAERFLVEQADASRAKRKKVID 120

Query: 138 SIAAALILQEVLD 150
            +AA +ILQ  LD
Sbjct: 121 KLAAVMILQNYLD 133


>gi|224282911|ref|ZP_03646233.1| Putative endonuclease for recombination [Bifidobacterium bifidum
           NCIMB 41171]
          Length = 145

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 75/140 (53%), Gaps = 13/140 (9%)

Query: 24  LGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-LLSFITTENIAAFIIGLPLNMNGS 82
           +G  R+GLA+SDP   FAHP   +     +  AL+ +++ I  E +   ++GLPL ++G+
Sbjct: 1   MGDARVGLALSDPELTFAHPYGNIQAYGDSFRALDDVITVIEDEAVDHIVVGLPLQLDGT 60

Query: 83  EGPRVHSTRAF-------VHNMIDRK----VYVPFV-FWDERLTTVSAQQILIDMNVSRK 130
           EG      R +       + N++D       ++P V   DERLTTVSA + L++  +  +
Sbjct: 61  EGKSAKKARRWSANLEKRMRNLMDEHDFALYHIPQVTLLDERLTTVSAHRQLLEAQLGSR 120

Query: 131 KRIQKVDSIAAALILQEVLD 150
           +    VD  +A +ILQ  LD
Sbjct: 121 RHRPVVDQQSAVVILQTALD 140


>gi|189501335|ref|YP_001960805.1| Holliday junction resolvase YqgF [Chlorobium phaeobacteroides BS1]
 gi|226725499|sp|B3EPT4|RUVX_CHLPB RecName: Full=Putative Holliday junction resolvase
 gi|189496776|gb|ACE05324.1| Holliday junction resolvase YqgF [Chlorobium phaeobacteroides BS1]
          Length = 144

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 72/138 (52%), Gaps = 5/138 (3%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P + I +ID G KR GLA +DP   FA P      +K+      + SF+   ++   I+G
Sbjct: 5   PIKRILAIDYGKKRTGLAKTDPFCSFAQPVGTFPPEKIITI---IKSFLQENSVEKIIVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            PLN +G++ P       F+  +      +P    DE  ++  A ++LI+  +SRKKR +
Sbjct: 62  YPLNSDGTKNPMTGIIDGFIEELSAAFPDIPVEPIDEHGSSKQAGKVLIESGLSRKKRQR 121

Query: 135 K--VDSIAAALILQEVLD 150
           K  +DS AA L+LQ  L+
Sbjct: 122 KGRLDSAAACLLLQHYLE 139


>gi|317050665|ref|YP_004111781.1| Holliday junction resolvase YqgF [Desulfurispirillum indicum S5]
 gi|316945749|gb|ADU65225.1| Holliday junction resolvase YqgF [Desulfurispirillum indicum S5]
          Length = 152

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 74/134 (55%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D+G++R+G+A+SD  RR A     L R+   Q    +  +I    +   ++G+PL+
Sbjct: 4   ILALDIGSRRVGVAVSDSQRRMASTLKTLERQDYQQMLHRIGKYIEEYGVDLLVVGIPLD 63

Query: 79  -MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQKV 136
             +GS  P+     A    + +R   VP +  DER +T  +   LI + ++SRKKR + V
Sbjct: 64  SRDGSFTPKAMEIGAEARQLQER-FAVPVIGVDERFSTSKSNDFLIGVADLSRKKRKKVV 122

Query: 137 DSIAAALILQEVLD 150
           D++AA  ILQ  LD
Sbjct: 123 DTMAAQNILQGYLD 136


>gi|126434972|ref|YP_001070663.1| Holliday junction resolvase-like protein [Mycobacterium sp. JLS]
 gi|167012736|sp|A3PZ45|RUVX_MYCSJ RecName: Full=Putative Holliday junction resolvase
 gi|126234772|gb|ABN98172.1| Holliday junction resolvase YqgF [Mycobacterium sp. JLS]
          Length = 169

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 64/131 (48%), Gaps = 1/131 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLNM 79
            ID+G  R+G+A SDP    A P   + R+K +   +  L+ + TE      ++GLP  +
Sbjct: 24  GIDVGCVRVGVATSDPDGVLATPVETVRREKSSDRHVRRLAQLVTELEAVEVVVGLPRTL 83

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
               GP  H        +  R   VP    DERLTTVSAQ+ L +  V  K +   +D +
Sbjct: 84  ADRTGPAAHDAIDVAEALARRIAPVPVRMADERLTTVSAQRSLREAGVRAKGQRAMIDQV 143

Query: 140 AAALILQEVLD 150
           AA  ILQ  LD
Sbjct: 144 AAVGILQSWLD 154


>gi|330719458|gb|EGG98088.1| Putative Holliday junction resolvase [gamma proteobacterium
           IMCC2047]
          Length = 142

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 65/128 (50%), Gaps = 4/128 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I + D GT RIG+A        A P P L  +       +L   I      AF++G+PLN
Sbjct: 9   ILAFDFGTHRIGMAFGQALTGTASPLPILPARDGIPDWQKLGKIIEEWQPDAFVVGVPLN 68

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+G+EGP     R F  N +  + + P    DERL+T+ A++ L + N    K    +DS
Sbjct: 69  MDGTEGPITPRARKFA-NRLHGRFHKPIYTMDERLSTIEAKEKLAEFN---NKNSIGLDS 124

Query: 139 IAAALILQ 146
           +AA LIL+
Sbjct: 125 MAATLILE 132


>gi|184200991|ref|YP_001855198.1| putative Holliday junction resolvase [Kocuria rhizophila DC2201]
 gi|183581221|dbj|BAG29692.1| putative Holliday junction resolvase [Kocuria rhizophila DC2201]
          Length = 165

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 67/138 (48%), Gaps = 7/138 (5%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE---LLSFITTENIAAFIIGLPL 77
            +D+GT R+G+A++DP    A P   L R    + A +   +       ++    +GLP 
Sbjct: 12  GVDVGTVRVGIALTDPDCVLATPHQTLTRDPNPRKAFDVKIITKLCEQRDVRTVYVGLPR 71

Query: 78  NMNGSEGPRVHSTRAFVHNMI----DRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           ++NG E       R +   ++     R         DERL+TV+A + L+D  VSR++ +
Sbjct: 72  SLNGHENDSTRMARDYAAGLLRRLGSRGCTTEVRLVDERLSTVTAHRSLLDSGVSRREHM 131

Query: 134 QKVDSIAAALILQEVLDR 151
            +VD  AA   LQ  +D+
Sbjct: 132 DRVDQAAAVTFLQTAVDQ 149


>gi|295111267|emb|CBL28017.1| conserved hypothetical protein TIGR00250 [Synergistetes bacterium
           SGP1]
          Length = 146

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 71/142 (50%), Gaps = 11/142 (7%)

Query: 17  QP--IASIDLGTKRIGLAISDPGRRFAHP---RPFLVRKKVTQTALE--LLSFITTENIA 69
           QP  + ++D+G+ R+G AISDP R  A      P + R    +   E  L+ +  T    
Sbjct: 5   QPGRVLALDVGSARVGAAISDPMRLIAQGLAVWPVVDRDGGWRRKFEACLVQYAPT---- 60

Query: 70  AFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR 129
             ++G+P   +G+ GP        V  +      + F  WDER TTV A + +I+  VSR
Sbjct: 61  LVLVGMPTRTDGTRGPEAERVAKLVDLLRAGHPDLAFDTWDERFTTVMAHRAMIEGGVSR 120

Query: 130 KKRIQKVDSIAAALILQEVLDR 151
             R Q+VD IAA LIL+  L R
Sbjct: 121 SGRRQRVDKIAAVLILESWLAR 142


>gi|258653459|ref|YP_003202615.1| Holliday junction resolvase YqgF [Nakamurella multipartita DSM
           44233]
 gi|258556684|gb|ACV79626.1| Holliday junction resolvase YqgF [Nakamurella multipartita DSM
           44233]
          Length = 169

 Score = 70.5 bits (171), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 67/142 (47%), Gaps = 12/142 (8%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAF--------- 71
            +D+GT R+G+A SDP    A P   L R     +         T +++A          
Sbjct: 20  GVDVGTVRVGVARSDPAGILATPVTTLQRSAAPSSGKSGDRAEPTADLSALRDLVVEHDV 79

Query: 72  ---IIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVS 128
              ++GLP  + G EG  V + RA+   +      VP V+ DERLTTV+A ++L    + 
Sbjct: 80  VEVVVGLPTTLRGMEGSAVTAARAYGQALAALIAPVPVVYVDERLTTVTADRVLAQAGIK 139

Query: 129 RKKRIQKVDSIAAALILQEVLD 150
            K R   VD +AA  ILQ  LD
Sbjct: 140 GKARRAVVDQVAATRILQNRLD 161


>gi|323698536|ref|ZP_08110448.1| Holliday junction resolvase YqgF [Desulfovibrio sp. ND132]
 gi|323458468|gb|EGB14333.1| Holliday junction resolvase YqgF [Desulfovibrio desulfuricans
           ND132]
          Length = 138

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 68/132 (51%), Gaps = 5/132 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL--ELLSFITTENIAAFIIGLPLN 78
            ID G KR+GLA+SD       P   L  ++ T+ AL  EL   I  E I A ++GLPL 
Sbjct: 5   GIDFGLKRVGLAVSDRTGTLVSPLKTL--ERTTRQALFDELTEIIHDEAIEAVVVGLPLA 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           ++G +       R F  ++  R++  P    DERLT+  A++ L    +   KR   +DS
Sbjct: 63  LSGEDTLTTRQARNFAESL-GRRIDAPVHLMDERLTSAQAEEELNAAGLRGAKRKAALDS 121

Query: 139 IAAALILQEVLD 150
            AA +IL+  LD
Sbjct: 122 QAAVVILRSWLD 133


>gi|269925209|ref|YP_003321832.1| Holliday junction resolvase YqgF [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269788869|gb|ACZ41010.1| Holliday junction resolvase YqgF [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 149

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 71/138 (51%), Gaps = 8/138 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  ID G KRIG+A+SDP    A     + R    +   E+      EN+   ++GLPL+
Sbjct: 3   VMGIDPGRKRIGIALSDPTGLLATAYKVIHRTTSDRDLEEIRRIAEHENVEKIVVGLPLH 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-----NVSRKKRI 133
           M+G EG      R      I+    +P    DERLT+V A++ L++       + RKK  
Sbjct: 63  MSGYEGEEAVRARELA-KQIETATGLPVELVDERLTSVEAERRLLESRRKLGKLGRKK-- 119

Query: 134 QKVDSIAAALILQEVLDR 151
             +D+ AAA++LQ+ LD+
Sbjct: 120 LAIDAEAAAVLLQDYLDQ 137


>gi|302561724|ref|ZP_07314066.1| Holliday junction resolvase [Streptomyces griseoflavus Tu4000]
 gi|302479342|gb|EFL42435.1| Holliday junction resolvase [Streptomyces griseoflavus Tu4000]
          Length = 163

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 65/142 (45%), Gaps = 2/142 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID+G  RIG+A  DP    A P   +  + V      L   +        ++GLP ++ 
Sbjct: 17  AIDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLGLLVQEYEPIEVVVGLPRSLK 76

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     R F   +      VP    DER+TTV+A Q L    V  KK    +D  A
Sbjct: 77  GGEGPAAAKVRGFARELARGIAPVPVRLVDERMTTVTASQGLRASGVKSKKGRSVIDQAA 136

Query: 141 AALILQEVL--DRISFLESSKG 160
           A +ILQ+ L  +R+S     +G
Sbjct: 137 AVIILQQALESERVSGRPPGEG 158


>gi|294811564|ref|ZP_06770207.1| Putative Holliday junction resolvase [Streptomyces clavuligerus
           ATCC 27064]
 gi|326440051|ref|ZP_08214785.1| Holliday junction resolvase-like protein [Streptomyces clavuligerus
           ATCC 27064]
 gi|294324163|gb|EFG05806.1| Putative Holliday junction resolvase [Streptomyces clavuligerus
           ATCC 27064]
          Length = 157

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 61/130 (46%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  RIG+A  DP    A P   +  + V      + + +        ++GLP ++N
Sbjct: 11  ALDVGDARIGVASCDPDGVLATPVETVPGRDVPAAHRRIRALVEEYEPIEIVVGLPRSLN 70

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     R F   +      VP    DER+TTV+A Q L    V  KK    VD  A
Sbjct: 71  GREGPAAKKVRTFAGEVARGVAPVPVRLVDERMTTVTATQGLRASGVKAKKGRSVVDQAA 130

Query: 141 AALILQEVLD 150
           A +ILQ  L+
Sbjct: 131 AVVILQNALE 140


>gi|187735685|ref|YP_001877797.1| Holliday junction resolvase YqgF [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187425737|gb|ACD05016.1| Holliday junction resolvase YqgF [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 141

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 63/134 (47%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
            P   ID G  RIG+A +DP    AHP   + R + T     ++  +    I   ++GLP
Sbjct: 5   HPALGIDYGEARIGIAATDPVGIMAHPVETIHRHQ-TDGISRIVQLVQERGIRTLVLGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           + M+G+EG      RAF   +      +P +F DE LTTV AQ+ L       K     +
Sbjct: 64  VRMDGTEGTAAAKVRAFGRELAAALPGLPLIFMDECLTTVIAQEKLHAAGKKAKNFRPII 123

Query: 137 DSIAAALILQEVLD 150
           D +AA  IL   LD
Sbjct: 124 DQVAAVEILNTWLD 137


>gi|291166998|gb|EFE29044.1| Holliday junction resolvase [Filifactor alocis ATCC 35896]
          Length = 140

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 73/134 (54%), Gaps = 5/134 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I ++D+G +RIG+A+SD       P   + R K  +   +++  I   +I   + GLP N
Sbjct: 6   ILALDVGDRRIGMAMSDLLGWTPQPLYTIHRTKDEEDLGKIVEVIKQYDIGTIVCGLPKN 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVP---FVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           M+G+ G +   T  FV  +  +++  P    VF DERL+T SA+Q++    V +K +   
Sbjct: 66  MDGTVGFQGEKTMQFVEQL--QQLIPPEIKVVFQDERLSTKSAKQVMHTSGVKKKNKKNM 123

Query: 136 VDSIAAALILQEVL 149
           +D+IAA  IL+  L
Sbjct: 124 IDTIAAVFILETYL 137


>gi|260912123|ref|ZP_05918679.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260633729|gb|EEX51863.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 138

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 71/143 (49%), Gaps = 11/143 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I S+D G KR G+A++DP +   +    LV    +     LL +I  E +   ++G P  
Sbjct: 4   ILSVDYGKKRTGIAVTDPLQIICNG---LVTVSSSTLVDFLLDYIQKEEVELIVVGEPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
            NG     +   + FV         +P V++DER T+V A + +ID  + +K R  K  V
Sbjct: 61  TNGQPSENLERVKQFVARWKKVCPTIPIVYYDERFTSVLAHRAMIDGGLKKKARQDKALV 120

Query: 137 DSIAAALILQEVLDRISFLESSK 159
           D I+A +ILQ      S+LES +
Sbjct: 121 DEISATIILQ------SYLESKR 137


>gi|227877598|ref|ZP_03995652.1| crossover junction endodeoxyribonuclease [Lactobacillus crispatus
           JV-V01]
 gi|256844559|ref|ZP_05550045.1| conserved hypothetical protein [Lactobacillus crispatus 125-2-CHN]
 gi|256849052|ref|ZP_05554485.1| conserved hypothetical protein [Lactobacillus crispatus MV-1A-US]
 gi|262047534|ref|ZP_06020489.1| conserved hypothetical protein [Lactobacillus crispatus MV-3A-US]
 gi|293381588|ref|ZP_06627575.1| RNAse H-fold protein YqgF [Lactobacillus crispatus 214-1]
 gi|295692278|ref|YP_003600888.1| holliday junction resolvase [Lactobacillus crispatus ST1]
 gi|312977881|ref|ZP_07789627.1| putative Holliday junction resolvase [Lactobacillus crispatus
           CTV-05]
 gi|227862792|gb|EEJ70257.1| crossover junction endodeoxyribonuclease [Lactobacillus crispatus
           JV-V01]
 gi|256613637|gb|EEU18840.1| conserved hypothetical protein [Lactobacillus crispatus 125-2-CHN]
 gi|256713828|gb|EEU28816.1| conserved hypothetical protein [Lactobacillus crispatus MV-1A-US]
 gi|260572110|gb|EEX28675.1| conserved hypothetical protein [Lactobacillus crispatus MV-3A-US]
 gi|290921858|gb|EFD98873.1| RNAse H-fold protein YqgF [Lactobacillus crispatus 214-1]
 gi|295030384|emb|CBL49863.1| Holliday junction resolvase [Lactobacillus crispatus ST1]
 gi|310895188|gb|EFQ44256.1| putative Holliday junction resolvase [Lactobacillus crispatus
           CTV-05]
          Length = 142

 Score = 70.1 bits (170), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 74/134 (55%), Gaps = 5/134 (3%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALE-LLSFITTENIAAFIIGLPLN 78
            +D+G+K +G+AISD  G          + +      +  L   +    +  F++GLP N
Sbjct: 5   GLDVGSKTVGVAISDELGITAQKLETIQIDESRYNFGMRPLKKLVRQYEVDGFVLGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNV-SRKKRIQKV 136
           M+G+ G  V  ++A+    ++ K  +P  + DERLTT+ ++++L+ D  +  RKKR Q +
Sbjct: 65  MDGTSGSSVARSKAY-GKRLEEKFGLPVHYSDERLTTIESRRVLVEDAGIHDRKKRKQVI 123

Query: 137 DSIAAALILQEVLD 150
           D +AA LILQ  LD
Sbjct: 124 DQMAAVLILQNYLD 137


>gi|189184333|ref|YP_001938118.1| Holliday junction resolvase-like protein [Orientia tsutsugamushi
           str. Ikeda]
 gi|226731634|sp|B3CU37|RUVX_ORITI RecName: Full=Putative Holliday junction resolvase
 gi|189181104|dbj|BAG40884.1| putative Hollyday junction resolvase [Orientia tsutsugamushi str.
           Ikeda]
          Length = 157

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 71/137 (51%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGL 75
           + I  ID G K++G+AIS+     A P   +      Q  +  +  I    NI A +IGL
Sbjct: 17  KQILGIDFGEKKVGVAISNIEHTVAMPLQTIF--ATNQDRINKIQEIAVAYNIGAIVIGL 74

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P  ++G+E  + H  + F  N +  K+ +P    DERLT+ +A  +L   N+ RK R   
Sbjct: 75  PFKLDGTETSQTHRVKDFA-NKLANKLLLPIFLCDERLTSKAANNLLKMGNIKRKVRNAI 133

Query: 136 VDSIAAALILQEVLDRI 152
            D +AA++IL+  L R+
Sbjct: 134 DDRVAASIILEGTLKRM 150


>gi|298346852|ref|YP_003719539.1| putative Holliday junction resolvase [Mobiluncus curtisii ATCC
           43063]
 gi|315656690|ref|ZP_07909577.1| Holliday junction resolvase [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
 gi|298236913|gb|ADI68045.1| possible Holliday junction resolvase [Mobiluncus curtisii ATCC
           43063]
 gi|315492645|gb|EFU82249.1| Holliday junction resolvase [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
          Length = 152

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 66/133 (49%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID+G  RIG+A S  G   A P   L  +       ELL+ IT  N AA  +GLP  M+
Sbjct: 8   AIDVGKARIGVARSVSGTSLALPVKTLQVQPDGSELDELLAIITDSNPAAVFVGLPKLMS 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EG      R++   ++ R   +P    DERL++  A   L    V  +++ + VD +A
Sbjct: 68  GKEGEAARMARSYARRLVRRLGELPVHLIDERLSSADAHAKLQQAGVCARRQKEMVDQLA 127

Query: 141 AALILQEVLDRIS 153
           A  IL   L+ ++
Sbjct: 128 AVTILTRALETLT 140


>gi|258647931|ref|ZP_05735400.1| putative Holliday junction resolvase [Prevotella tannerae ATCC
           51259]
 gi|260851770|gb|EEX71639.1| putative Holliday junction resolvase [Prevotella tannerae ATCC
           51259]
          Length = 138

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 75/148 (50%), Gaps = 21/148 (14%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL-ELLSFI----TTENIAAFII 73
           I +ID G KR G+A++D  +        ++   +T  A  ELL+F+    T E++  F+I
Sbjct: 4   ILAIDYGKKRTGIAVTDILQ--------IIPNGLTTVATHELLNFLKAYTTKEDVERFVI 55

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP   NG          AF   +      +P  F+DER T+  A Q ++   + +K+R 
Sbjct: 56  GLPRQTNGKPSENFPRVEAFAKQLEQHFPTIPITFYDERYTSTLAHQAMLAGGLGKKRRQ 115

Query: 134 QK--VDSIAAALILQEVLDRISFLESSK 159
           +K  VD I+A +ILQ      S++ES K
Sbjct: 116 EKALVDEISACIILQ------SYMESKK 137


>gi|332830441|gb|EGK03069.1| Holliday junction resolvase [Dysgonomonas gadei ATCC BAA-286]
          Length = 141

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 73/140 (52%), Gaps = 13/140 (9%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL-SFITTENIAAFIIGLPLNM 79
           ++D GTKR G+A+SD  +  A+     +    T T  + L +++  E++   I+GLP  M
Sbjct: 6   ALDYGTKRTGIAVSDTLKIIANG----LTTVPTHTLFDYLKTYLEREDVECIIVGLPKQM 61

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--VD 137
           N      +   R FV  + +    +P   +DER T+  AQ+ +ID  + +K R  K  VD
Sbjct: 62  NNEYSENMKHIRPFVKKLQNLYPDIPVEMYDERFTSALAQKTMIDAGLRKKDRQNKALVD 121

Query: 138 SIAAALILQEVLDRISFLES 157
            I+A +ILQ      S++ES
Sbjct: 122 EISAVIILQ------SYMES 135


>gi|288817797|ref|YP_003432144.1| Holliday junction resolvase [Hydrogenobacter thermophilus TK-6]
 gi|288787196|dbj|BAI68943.1| Holliday junction resolvase [Hydrogenobacter thermophilus TK-6]
 gi|308751395|gb|ADO44878.1| Holliday junction resolvase YqgF [Hydrogenobacter thermophilus
           TK-6]
          Length = 133

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 75/136 (55%), Gaps = 7/136 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRP-FLVRKKVTQTALELLSFITTENIAAFIIGLPL 77
           + ++D G+KRIGLA+ D     A P   F  R+ V +   ++ + I+   ++  I+GLPL
Sbjct: 3   VLALDYGSKRIGLALGDTSLNIASPLGVFENREGVVE---KIRNLISEYRVSLLIVGLPL 59

Query: 78  NMNGSEGPRVHSTRAFVHNMIDR-KVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
              G +G R      FV  + +     +  + WDER TT  A  +L D+  +++K+++  
Sbjct: 60  TPRGQKGQRAKEVEEFVKKLRESLPEEIELLMWDERYTTKEAYWLLQDLPPTKRKKLK-- 117

Query: 137 DSIAAALILQEVLDRI 152
           DS++A +IL+E L+ +
Sbjct: 118 DSLSAYIILKEYLESL 133


>gi|302517972|ref|ZP_07270314.1| Holliday junction resolvase YqgF [Streptomyces sp. SPB78]
 gi|302426867|gb|EFK98682.1| Holliday junction resolvase YqgF [Streptomyces sp. SPB78]
          Length = 157

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 62/130 (47%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID+G  RIG+A  DP    A P   +  + V      + + +        ++GLP ++ 
Sbjct: 11  AIDVGDARIGVASCDPDGILATPVETVPGRDVPAARRRIKALVDEYEPIELVVGLPRSLR 70

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     RAF   +      VP    DER+TTV+A Q L    V+ KK    +D  A
Sbjct: 71  GGEGPAAKKVRAFAGGLALLVAPVPVRLVDERMTTVTAGQGLRASGVNTKKGRSVIDQAA 130

Query: 141 AALILQEVLD 150
           A +ILQ  L+
Sbjct: 131 AVIILQTALE 140


>gi|188995932|ref|YP_001930184.1| Holliday junction resolvase-like protein [Porphyromonas gingivalis
           ATCC 33277]
 gi|188595612|dbj|BAG34587.1| probable endonuclease [Porphyromonas gingivalis ATCC 33277]
          Length = 150

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 70/135 (51%), Gaps = 7/135 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL-SFITTENIAAFIIGLPL 77
           I +ID G KR GLA++DP +      P  +    T T L+ L  +++ E +  F++GLP 
Sbjct: 16  ILAIDYGRKRTGLAVTDPLKII----PGGLTTVPTHTLLDFLRDYVSREPVERFVLGLPR 71

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK-- 135
            MN  E   +   R F   +      +P  + DER T+  AQ+ +++  + + KR  K  
Sbjct: 72  RMNYEESESMTYIRPFAVKLAQAFPSIPITYVDERFTSRMAQRTILEAGIGKMKRRDKAL 131

Query: 136 VDSIAAALILQEVLD 150
           VD ++A +ILQ  LD
Sbjct: 132 VDEVSAVIILQSYLD 146


>gi|34541766|ref|NP_906245.1| Holliday junction resolvase-like protein [Porphyromonas gingivalis
           W83]
 gi|62901001|sp|Q7MT06|RUVX_PORGI RecName: Full=Putative Holliday junction resolvase
 gi|34398084|gb|AAQ67144.1| conserved hypothetical protein TIGR00250 [Porphyromonas gingivalis
           W83]
          Length = 138

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 70/135 (51%), Gaps = 7/135 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL-SFITTENIAAFIIGLPL 77
           I +ID G KR GLA++DP +      P  +    T T L+ L  +++ E +  F++GLP 
Sbjct: 4   ILAIDYGRKRTGLAVTDPLKII----PGGLTTVPTHTLLDFLRDYVSREPVERFVLGLPR 59

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK-- 135
            MN  E   +   R F   +      +P  + DER T+  AQ+ +++  + + KR  K  
Sbjct: 60  RMNYEESESMTYIRPFAVKLAQAFPSIPITYVDERFTSRMAQRTILEAGIGKMKRRDKAL 119

Query: 136 VDSIAAALILQEVLD 150
           VD ++A +ILQ  LD
Sbjct: 120 VDEVSAVIILQSYLD 134


>gi|118595162|ref|ZP_01552509.1| Holliday junction resolvase-like protein [Methylophilales bacterium
           HTCC2181]
 gi|118440940|gb|EAV47567.1| Holliday junction resolvase-like protein [Methylophilales bacterium
           HTCC2181]
          Length = 148

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 77/142 (54%), Gaps = 5/142 (3%)

Query: 12  SLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAA 70
           +++PN  + + D G K+IG+AI +   + AHP    +RK      +E++  +  E     
Sbjct: 9   NIRPNTNVIAFDFGEKKIGVAIGNSITKTAHPLE-TIRKVKKSERIEIIENLLNEWEPGI 67

Query: 71  FIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV-SR 129
            ++GLPLN +G+E       + F   + +R   VP V  DER T+V A +IL++ NV S 
Sbjct: 68  VVVGLPLNEDGTESRLTLLAQNFAKKIKNR-FQVPIVMVDERYTSVEA-KILLNENVKSI 125

Query: 130 KKRIQKVDSIAAALILQEVLDR 151
           KK  Q +D +AA +IL    DR
Sbjct: 126 KKGNQVIDQVAAQIILGSYFDR 147


>gi|15672125|ref|NP_266299.1| hypothetical protein L141748 [Lactococcus lactis subsp. lactis
           Il1403]
 gi|12722992|gb|AAK04241.1|AE006252_3 hypothetical protein L141748 [Lactococcus lactis subsp. lactis
           Il1403]
          Length = 119

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 51/79 (64%), Gaps = 1/79 (1%)

Query: 72  IIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           ++GLP +MNG EG R  ++R +   + + +  +   + DERLTT  A+++LID  V RK+
Sbjct: 36  VLGLPKHMNGDEGIRAEASRDYGTKLAN-EFGLEVAYQDERLTTAQAEKVLIDGGVRRKE 94

Query: 132 RIQKVDSIAAALILQEVLD 150
           R + +D +AA LILQ  LD
Sbjct: 95  RKKSIDKLAAVLILQNYLD 113


>gi|311748399|ref|ZP_07722184.1| putative Holliday junction resolvase [Algoriphagus sp. PR1]
 gi|126576911|gb|EAZ81159.1| putative Holliday junction resolvase [Algoriphagus sp. PR1]
          Length = 137

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 76/140 (54%), Gaps = 14/140 (10%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + +IDLGTKR GLA++DP +  A+P   +   K+      + ++I  E +   ++GLP  
Sbjct: 4   VLAIDLGTKRTGLAVTDPLKMLANPLETIETFKLIDF---IKAYIAKEEVDTLVLGLPTK 60

Query: 79  MNGSEG---PRVHSTRAFVH-NMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           +NG +    P+V + +  +  N   +KV       DER T+  A Q +I M   +K R +
Sbjct: 61  LNGKDNEMTPKVMAMKTKLEKNFPSQKVE----LVDERFTSKMAMQSMITMGSKKKDRRE 116

Query: 135 K---VDSIAAALILQEVLDR 151
           K   +D ++AA+ILQ  L+R
Sbjct: 117 KAGNLDKVSAAIILQSYLER 136


>gi|326798192|ref|YP_004316011.1| Holliday junction resolvase [Sphingobacterium sp. 21]
 gi|326548956|gb|ADZ77341.1| Holliday junction resolvase [Sphingobacterium sp. 21]
          Length = 137

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 74/136 (54%), Gaps = 5/136 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I + D GTKRIG+A++DP +  A     +  K V +    L  +++ E + +F++G+P  
Sbjct: 3   IMAFDYGTKRIGVAVTDPLQIIATALTTIHPKDVIEY---LKKYVSQEQVESFVVGMPKQ 59

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           ++GS+       + F++ +      +P V  DER T+  A   + +  + R KR +K  V
Sbjct: 60  LDGSDSQSAVHVKGFINLLKKSFPQMPIVTMDERFTSKMASASIAESGLRRSKRQEKGLV 119

Query: 137 DSIAAALILQEVLDRI 152
           D+I+A +ILQ+ L  I
Sbjct: 120 DAISAVIILQDYLKTI 135


>gi|288928224|ref|ZP_06422071.1| Holliday junction resolvase [Prevotella sp. oral taxon 317 str.
           F0108]
 gi|288331058|gb|EFC69642.1| Holliday junction resolvase [Prevotella sp. oral taxon 317 str.
           F0108]
          Length = 138

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 70/143 (48%), Gaps = 11/143 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I S+D G KR G+A++DP +   +    LV    +     LL +   E +   ++G P  
Sbjct: 4   ILSVDYGQKRTGIAVTDPLQIICNG---LVTVSSSTLVDFLLDYTKREEVELIVVGEPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
            NG     +   R FV         +P V++DER T+V A + +ID  + +K R  K  V
Sbjct: 61  TNGQPSENLERVRQFVARWKKACPTIPVVYYDERFTSVLAHRAMIDGGLKKKARQDKALV 120

Query: 137 DSIAAALILQEVLDRISFLESSK 159
           D I+A +ILQ      S+LES +
Sbjct: 121 DEISATIILQ------SYLESKR 137


>gi|333028350|ref|ZP_08456414.1| putative holliday junction resolvase YqgF [Streptomyces sp. Tu6071]
 gi|332748202|gb|EGJ78643.1| putative holliday junction resolvase YqgF [Streptomyces sp. Tu6071]
          Length = 154

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 62/130 (47%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID+G  RIG+A  DP    A P   +  + V      + + +        ++GLP ++ 
Sbjct: 8   AIDVGDARIGVASCDPDGILATPVETVPGRDVPAARRRIKALVDEYEPIELVVGLPRSLR 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     RAF   +      VP    DER+TTV+A Q L    V+ KK    +D  A
Sbjct: 68  GGEGPAAKKVRAFAGGLALLVAPVPVRLVDERMTTVTAGQGLRASGVNTKKGRSVIDQAA 127

Query: 141 AALILQEVLD 150
           A +ILQ  L+
Sbjct: 128 AVIILQTALE 137


>gi|237736820|ref|ZP_04567301.1| DNA integration/recombination/invertion protein [Fusobacterium
           mortiferum ATCC 9817]
 gi|229420682|gb|EEO35729.1| DNA integration/recombination/invertion protein [Fusobacterium
           mortiferum ATCC 9817]
          Length = 139

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 74/134 (55%), Gaps = 6/134 (4%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  RIG+A SD     A P   + R+KV +    +   +  EN  + +IG+P +++
Sbjct: 7   ALDVGDVRIGVAKSDIMGILATPLEVIDRRKV-KAVKRIEEILIQENTKSLVIGIPKSLD 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK---VD 137
           G+E  +    R F+  +      +     DERLTTVSA ++L + N  +K  ++K   VD
Sbjct: 66  GTEKRQAEKVREFIEKLNKSIEGLEIFEVDERLTTVSADRLLNETN--KKGALEKRKVVD 123

Query: 138 SIAAALILQEVLDR 151
            +AAA+ILQ  LDR
Sbjct: 124 KVAAAIILQTFLDR 137


>gi|320011911|gb|ADW06761.1| Holliday junction resolvase YqgF [Streptomyces flavogriseus ATCC
           33331]
          Length = 157

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 59/130 (45%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID+G  RIG+A  DP    A P   +  + V      L   +        I+GLP ++ 
Sbjct: 11  AIDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLGQIVEEYEPIEVIVGLPRSLG 70

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     RAF          +P    DER+TTV+A Q L    V  KK    +D  A
Sbjct: 71  GGEGPAAAKVRAFAQVFARAVAPIPVRLLDERMTTVTATQGLRASGVKSKKGRSVIDQAA 130

Query: 141 AALILQEVLD 150
           A +ILQ  L+
Sbjct: 131 AVVILQNALE 140


>gi|304389443|ref|ZP_07371406.1| possible Holliday junction resolvase [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|304327253|gb|EFL94488.1| possible Holliday junction resolvase [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
          Length = 152

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 66/133 (49%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID+G  RIG+A S  G   A P   L  +       ELL+ IT  N AA  +GLP  M+
Sbjct: 8   AIDVGKARIGVARSVSGTSLALPVKTLQVQLDGSELDELLAIITDSNPAAVFVGLPKLMS 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EG      R++   ++ R   +P    DERL++  A   L    V  +++ + VD +A
Sbjct: 68  GKEGEAARMARSYARRLVRRLGELPVHLIDERLSSADAHAKLQQAGVCARRQKEMVDQLA 127

Query: 141 AALILQEVLDRIS 153
           A  IL   L+ ++
Sbjct: 128 AVTILTRALETLT 140


>gi|323344259|ref|ZP_08084485.1| crossover junction endodeoxyribonuclease [Prevotella oralis ATCC
           33269]
 gi|323094988|gb|EFZ37563.1| crossover junction endodeoxyribonuclease [Prevotella oralis ATCC
           33269]
          Length = 137

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 68/133 (51%), Gaps = 5/133 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I SID G KR G+A++DP +  A     L     ++    L+ ++  E +   +IG P+ 
Sbjct: 4   ILSIDYGRKRTGVAVTDPLQLIAGG---LATVATSELFNYLMQYVQHEEVERIVIGKPMQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
            NG     +     FV         +P  ++DER T+V AQ+++ID  + +K R  K  V
Sbjct: 61  TNGQPSENLQRVEQFVDRWRKAMPQIPIEYYDERFTSVIAQRVIIDSGLKKKARQNKALV 120

Query: 137 DSIAAALILQEVL 149
           D I+A +IL++ +
Sbjct: 121 DEISATIILEDWM 133


>gi|229495944|ref|ZP_04389668.1| conserved hypothetical protein [Porphyromonas endodontalis ATCC
           35406]
 gi|229317036|gb|EEN82945.1| conserved hypothetical protein [Porphyromonas endodontalis ATCC
           35406]
          Length = 148

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 73/139 (52%), Gaps = 7/139 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLPL 77
           I +ID G KR GLA++DP R      P  +    +   L+ LS +I  E +   ++G P 
Sbjct: 4   ILAIDYGKKRTGLAVTDPLRI----TPGGLATVASSELLQYLSEYIPREGVDLVVVGYPR 59

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK-- 135
            MN  E   +     FV  +  R   +  V++DER T+  AQ+ +++  + ++KR  K  
Sbjct: 60  QMNNEESESMRYIGPFVAKLEKRFPQLRIVYYDERFTSCLAQKTILESGIGKQKRRNKAL 119

Query: 136 VDSIAAALILQEVLDRISF 154
           VD ++A +ILQ  ++ +++
Sbjct: 120 VDEVSAIIILQSYMESLAY 138


>gi|302344298|ref|YP_003808827.1| Holliday junction resolvase YqgF [Desulfarculus baarsii DSM 2075]
 gi|301640911|gb|ADK86233.1| Holliday junction resolvase YqgF [Desulfarculus baarsii DSM 2075]
          Length = 136

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 72/132 (54%), Gaps = 6/132 (4%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  RIG+A+SD     A P   L R+   +    +      E     ++GLPL+ +
Sbjct: 2   ALDVGRARIGVAVSDEAGLTAQPLCVLRRQGRDEDVRAIGRLAQREGARLIVLGLPLHND 61

Query: 81  --GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
             G E  RV S    +   + R++ +P  F +E  TT+ A + +++ ++SRK+R + VD 
Sbjct: 62  QIGPEAQRVIS----LGRRLQRRLGLPVGFTNEEDTTIEAHEAMLEADLSRKRRAEVVDK 117

Query: 139 IAAALILQEVLD 150
           +AAALIL+  LD
Sbjct: 118 VAAALILRRWLD 129


>gi|255537457|ref|XP_002509795.1| conserved hypothetical protein [Ricinus communis]
 gi|223549694|gb|EEF51182.1| conserved hypothetical protein [Ricinus communis]
          Length = 168

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 84/157 (53%), Gaps = 10/157 (6%)

Query: 3   ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELL 60
           I L  DL+KS K N  +  +D+G K +GLAISD   + A P   L+RKK  +   A +  
Sbjct: 7   IALFNDLMKS-KSNGRLLGLDVGDKYVGLAISDRHNKIASPLSVLLRKKSNIDLVATDFQ 65

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNM--IDRKVYVPFVFWDERLTTVSA 118
           S I+  ++A F++G P +   S    +H  + F+ ++  I +   + + FWDE  T+ + 
Sbjct: 66  SLISELSLAGFVVGYPFDRQRSTPDALH-VKLFIDDLRKIGKLEGLKYTFWDECFTSKNV 124

Query: 119 QQIL--IDMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
           + ++  +D++    K I  +D  AA  ILQ  LD ++
Sbjct: 125 ELLVQPLDLHPVEAKTI--MDKFAAVGILQGYLDYVN 159


>gi|104774411|ref|YP_619391.1| putative Hollyday junction resolvase [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC 11842]
 gi|118597212|sp|Q1G949|RUVX_LACDA RecName: Full=Putative Holliday junction resolvase
 gi|103423492|emb|CAI98394.1| Putative Hollyday junction resolvase [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC 11842]
          Length = 142

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 76/134 (56%), Gaps = 5/134 (3%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTENIA-AFIIGLPLN 78
            +D+G+K IG+A+SDP G          + +      +  L  +  E  A  F++GLP N
Sbjct: 5   GLDVGSKTIGVAVSDPLGITAQSVMTIPIDEDRHNFGMRSLKKLVREYEANGFVLGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV--SRKKRIQKV 136
           M+G+ G  V  ++A     +++K  +P  + DERLTTV++++IL++      R++R + V
Sbjct: 65  MDGTAGRSVSRSKAMGER-LEQKFGLPVYYDDERLTTVASERILVEEAGMHDRRQRKEVV 123

Query: 137 DSIAAALILQEVLD 150
           D +AA LILQ  LD
Sbjct: 124 DQMAAVLILQNYLD 137


>gi|319790615|ref|YP_004152248.1| Holliday junction resolvase YqgF [Thermovibrio ammonificans HB-1]
 gi|317115117|gb|ADU97607.1| Holliday junction resolvase YqgF [Thermovibrio ammonificans HB-1]
          Length = 134

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 73/134 (54%), Gaps = 8/134 (5%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G KRIG+A+SDP +  A P   L RK   +T  ELL  +  + +   ++G+P+N  
Sbjct: 2   ALDVGFKRIGVALSDPLKLTASPYRILYRKSNRETFEELLKIVLDKGVEEIVVGIPINAQ 61

Query: 81  GSE---GPRVHSTRAFVHNMIDRKVY-VPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           G +   G ++    A + + +  + Y +P    DE  +T  A+++   +     K  +++
Sbjct: 62  GEKTKIGQKIEKFTAKLQSFLRERGYQIPIYTHDESFSTQEAREVARSLG----KEKEEL 117

Query: 137 DSIAAALILQEVLD 150
           D  AAALIL+E L+
Sbjct: 118 DDYAAALILKEWLE 131


>gi|284040266|ref|YP_003390196.1| Holliday junction resolvase YqgF [Spirosoma linguale DSM 74]
 gi|283819559|gb|ADB41397.1| Holliday junction resolvase YqgF [Spirosoma linguale DSM 74]
          Length = 142

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 74/133 (55%), Gaps = 5/133 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID G KR G+A++DP +  A     +   +V +    L +++  E + AF++GLP  ++
Sbjct: 6   AIDYGMKRTGIAVTDPLQLIASALETVPSHEVLKF---LKAYLVREPVEAFVVGLPKGLD 62

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--VDS 138
           G +       R FV ++ +    +P  + DER T+V A Q +I    ++K R +K  +D 
Sbjct: 63  GEDTDNTPRVRKFVTHLQNAFPDIPVYWHDERFTSVMALQAMIAGGSTKKDRREKGNIDK 122

Query: 139 IAAALILQEVLDR 151
           ++AA+ILQ  ++R
Sbjct: 123 VSAAIILQSYMER 135


>gi|291544813|emb|CBL17922.1| conserved hypothetical protein TIGR00250 [Ruminococcus sp. 18P13]
          Length = 140

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 63/137 (45%), Gaps = 13/137 (9%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-----NIAAFII 73
           I ++D G  R GLA  D     A P        +++T  E+    T E          ++
Sbjct: 3   ILAVDFGDARTGLACCDRSELLASPAGV-----ISETDFEVCIQKTAEAAREHRAEQIVV 57

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVY-VPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           G P NMNG+ G R      F   +  R +  +  V WDER TTVSA + L   N   KKR
Sbjct: 58  GYPKNMNGTIGERAEKCALFAEKL--RTLAGIETVLWDERCTTVSAHRYLNQTNTRGKKR 115

Query: 133 IQKVDSIAAALILQEVL 149
              VD++AA +IL+  L
Sbjct: 116 KAVVDAVAATIILESYL 132


>gi|302525837|ref|ZP_07278179.1| Holliday junction resolvase YqgF [Streptomyces sp. AA4]
 gi|302434732|gb|EFL06548.1| Holliday junction resolvase YqgF [Streptomyces sp. AA4]
          Length = 166

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 72/141 (51%), Gaps = 1/141 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN-IAAFIIGLPLNM 79
           ++D+G+ R+G+A+SDP    A P   L R     + L+ L+ + TE+ +   I+GLP  +
Sbjct: 24  AVDVGSVRVGVALSDPAPVLASPLVTLSRDAKDDSDLDRLAELVTEHEVVEVIVGLPRTL 83

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
              +G       A+   +  R   VP    DERLTTV+A ++L    V  +K+   VD  
Sbjct: 84  ANRQGAAADLALAYAEKLAGRVGDVPVRLADERLTTVTASRMLSQRGVKGRKQRAVVDQA 143

Query: 140 AAALILQEVLDRISFLESSKG 160
           AA  ILQ  LD  +   + KG
Sbjct: 144 AAVEILQAWLDAAAAHRARKG 164


>gi|290961839|ref|YP_003493021.1| Holliday junction resolvase subunit [Streptomyces scabiei 87.22]
 gi|260651365|emb|CBG74487.1| putative holliday junction resolvase subunit [Streptomyces scabiei
           87.22]
          Length = 154

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 60/130 (46%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  RIG+A  DP    A P   +  + V      L   +        I+GLP ++ 
Sbjct: 8   ALDVGDARIGVASCDPDGILATPVETVPGRDVPAAQRRLRQLVDEYVPMEVIVGLPRSLK 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     R F   +      VP    DER+TTV+A Q L    V  KK    +D  A
Sbjct: 68  GGEGPAAVKVRGFAQELARMIAPVPVRLLDERMTTVTAGQGLRASGVKSKKGRSVIDQAA 127

Query: 141 AALILQEVLD 150
           A +ILQ+ L+
Sbjct: 128 AVIILQQALE 137


>gi|298530269|ref|ZP_07017671.1| Holliday junction resolvase YqgF [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298509643|gb|EFI33547.1| Holliday junction resolvase YqgF [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 140

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 67/137 (48%), Gaps = 1/137 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            ID G KR+GLA+SD   +   P   + R       LELL+ I    I A ++GLPL  +
Sbjct: 5   GIDFGIKRVGLAVSDEKGKMVFPLKTIHRSTRENLFLELLNIIQERGIEAIVLGLPLGPD 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G +         F+ ++ DR+  +P    +E  T++ A+ IL    +  +K+ + +D  A
Sbjct: 65  GEKSLTCRQAENFMQSL-DRRTDLPIYTVNEAYTSMEAEDILNRCGIRVEKQKESLDQAA 123

Query: 141 AALILQEVLDRISFLES 157
           A +IL+  L  I   E 
Sbjct: 124 AVIILESFLAGIPLREG 140


>gi|212716058|ref|ZP_03324186.1| hypothetical protein BIFCAT_00971 [Bifidobacterium catenulatum DSM
           16992]
 gi|212661425|gb|EEB22000.1| hypothetical protein BIFCAT_00971 [Bifidobacterium catenulatum DSM
           16992]
          Length = 151

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 72/144 (50%), Gaps = 13/144 (9%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL-ELLSFITTENIAAFIIGLPLNM 79
            IDLG  R+GLA+SDPG   A+P   +     +  AL E++  I  E +   I+GLPL +
Sbjct: 5   GIDLGDARVGLALSDPGITLAYPAGNIQVYGDSFRALDEVVDVIEDELVDHVIVGLPLLL 64

Query: 80  NGSEGPRVHSTRAFVHNM-------IDRKVY----VPFV-FWDERLTTVSAQQILIDMNV 127
           +G EG      R +  N+       ++   Y    VP +   DERLTTV+A   L D  +
Sbjct: 65  SGEEGKSAKKARRWTVNLERRLRAAVEDDEYSLTQVPTIELVDERLTTVTAHHQLFDAQI 124

Query: 128 SRKKRIQKVDSIAAALILQEVLDR 151
              +    VD  +A +ILQ  +DR
Sbjct: 125 GGHEHRPMVDQQSAVVILQTAIDR 148


>gi|119484674|ref|ZP_01619156.1| Holliday junction resolvase-like protein [Lyngbya sp. PCC 8106]
 gi|119457492|gb|EAW38616.1| Holliday junction resolvase-like protein [Lyngbya sp. PCC 8106]
          Length = 149

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 69/131 (52%), Gaps = 1/131 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+G KRIG+A  D    FA     L R    +   +L   +    +   ++GLP +MN
Sbjct: 14  GLDIGQKRIGVAGCDGLGLFATGLMTLKRSAFERDVAQLRELVEDRRVQVLVVGLPYSMN 73

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G+ G +    + +   +  + + +P  + DERLT+  A+Q+L D ++S  +    +D  A
Sbjct: 74  GTIGFQAKKVQKYATGLA-KALDLPLEYVDERLTSFQAEQMLRDAHISPSRNKGLIDRKA 132

Query: 141 AALILQEVLDR 151
           AA+ILQ+ LD+
Sbjct: 133 AAIILQQWLDQ 143


>gi|300811591|ref|ZP_07092075.1| RNAse YqgF [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
 gi|313124258|ref|YP_004034517.1| holliday junction resolvase [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|300497451|gb|EFK32489.1| RNAse YqgF [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
 gi|312280821|gb|ADQ61540.1| Putative Holliday junction resolvase [Lactobacillus delbrueckii
           subsp. bulgaricus ND02]
 gi|325126221|gb|ADY85551.1| Putative Holliday junction resolvase [Lactobacillus delbrueckii
           subsp. bulgaricus 2038]
 gi|325685731|gb|EGD27809.1| crossover junction endodeoxyribonuclease [Lactobacillus delbrueckii
           subsp. lactis DSM 20072]
          Length = 142

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 76/134 (56%), Gaps = 5/134 (3%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTENIA-AFIIGLPLN 78
            +D+G+K IG+A+SDP G          + +      +  L  +  E  A  F++GLP N
Sbjct: 5   GLDVGSKTIGVAVSDPLGITAQAVMTIPIDEDRHNFGMRSLKKLVREYEADGFVLGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV--SRKKRIQKV 136
           M+G+ G  V  ++A     +++K  +P  + DERLTTV++++IL++      R++R + V
Sbjct: 65  MDGTAGRSVSRSKAMGER-LEQKFGLPVYYDDERLTTVASERILVEEAGMHDRRQRKEVV 123

Query: 137 DSIAAALILQEVLD 150
           D +AA LILQ  LD
Sbjct: 124 DQMAAVLILQNYLD 137


>gi|116514509|ref|YP_813415.1| Holliday junction resolvase-like protein [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
 gi|122274759|sp|Q048Z5|RUVX_LACDB RecName: Full=Putative Holliday junction resolvase
 gi|116093824|gb|ABJ58977.1| RNase H-like ribonuclease [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
          Length = 142

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 76/134 (56%), Gaps = 5/134 (3%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTENIA-AFIIGLPLN 78
            +D+G+K IG+A+SDP G          + +      +  L  +  E  A  F++GLP N
Sbjct: 5   GLDVGSKTIGVAVSDPLGITAQAVMTIPIDEDRHNFGMRSLKKLVREYEANGFVLGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV--SRKKRIQKV 136
           M+G+ G  V  ++A     +++K  +P  + DERLTTV++++IL++      R++R + V
Sbjct: 65  MDGTAGRSVSRSKAMGER-LEQKFGLPVYYDDERLTTVASERILVEEAGMHDRRQRKEVV 123

Query: 137 DSIAAALILQEVLD 150
           D +AA LILQ  LD
Sbjct: 124 DQMAAVLILQNYLD 137


>gi|67923975|ref|ZP_00517429.1| Conserved hypothetical protein 250 [Crocosphaera watsonii WH 8501]
 gi|67854195|gb|EAM49500.1| Conserved hypothetical protein 250 [Crocosphaera watsonii WH 8501]
          Length = 143

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 69/137 (50%), Gaps = 3/137 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+G KRIG+A  D     A     + RK   Q   +L + +T  N+   ++GLP  M+
Sbjct: 8   GLDVGKKRIGVAGCDGTGLIATGLTTIERKSFPQDVQQLQALVTERNVQLLVVGLPYCMD 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GS G +    + F    I + + +P  + DERLT+V A+  L       +     VD +A
Sbjct: 68  GSIGFQAKQVQKFAKR-ISKALELPVEYMDERLTSVEAETHLKAQKKYSRHNKGLVDRLA 126

Query: 141 AALILQEVLD--RISFL 155
           A +ILQ+ LD  R SF+
Sbjct: 127 ATIILQQWLDQRRASFV 143


>gi|82703594|ref|YP_413160.1| Holliday junction resolvase-like protein [Nitrosospira multiformis
           ATCC 25196]
 gi|146325582|sp|Q2Y653|RUVX_NITMU RecName: Full=Putative Holliday junction resolvase
 gi|82411659|gb|ABB75768.1| Holliday junction resolvase YqgF [Nitrosospira multiformis ATCC
           25196]
          Length = 151

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 74/147 (50%), Gaps = 2/147 (1%)

Query: 6   IEDLVKSLKPNQPIA-SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFIT 64
           +E+  K+ +P+   A + D G KRIG+AI +     AHP   L  K   +    +   + 
Sbjct: 1   MEEAEKASQPHAGTALAFDFGEKRIGVAIGNLELGLAHPLVTLSNKNKEECLKSIARLMD 60

Query: 65  TENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID 124
                  ++GLP++ +G+E      +R F H +  R   +  V  DER T++SA   L +
Sbjct: 61  EWKPVLLVVGLPVHADGTEHELTRRSRRFAHRLQAR-FGIRTVLEDERYTSISASSALDE 119

Query: 125 MNVSRKKRIQKVDSIAAALILQEVLDR 151
            +V  +++ Q +D IAA LILQ   D+
Sbjct: 120 ASVRGRRQKQVLDQIAAQLILQSYFDQ 146


>gi|284991580|ref|YP_003410134.1| Holliday junction resolvase YqgF [Geodermatophilus obscurus DSM
           43160]
 gi|284064825|gb|ADB75763.1| Holliday junction resolvase YqgF [Geodermatophilus obscurus DSM
           43160]
          Length = 222

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 64/130 (49%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            ID+GT R+G+AISDP    A P   + R +       + + +    +   I+G P +++
Sbjct: 87  GIDVGTVRVGVAISDPTGTLASPLETVQRARDESDLDRIAALVVEHEVTEVIVGEPRHLS 146

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G+ G      RA+   +  R   VP    DERL+TV+A   L    +  +++   +D  A
Sbjct: 147 GASGASAKEARAYSRALAGRIGSVPVHLVDERLSTVTAASSLRANGLDSRRQRPVIDQAA 206

Query: 141 AALILQEVLD 150
           A +ILQ  LD
Sbjct: 207 AVVILQAYLD 216


>gi|166154394|ref|YP_001654512.1| Holliday junction resolvase-like protein [Chlamydia trachomatis
           434/Bu]
 gi|166155269|ref|YP_001653524.1| Holliday junction resolvase-like protein [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|255348541|ref|ZP_05380548.1| Holliday junction resolvase-like protein [Chlamydia trachomatis 70]
 gi|255503081|ref|ZP_05381471.1| Holliday junction resolvase-like protein [Chlamydia trachomatis
           70s]
 gi|255506759|ref|ZP_05382398.1| Holliday junction resolvase-like protein [Chlamydia trachomatis
           D(s)2923]
 gi|301335653|ref|ZP_07223897.1| Holliday junction resolvase-like protein [Chlamydia trachomatis
           L2tet1]
 gi|226725500|sp|B0B9T4|RUVX_CHLT2 RecName: Full=Putative Holliday junction resolvase
 gi|226725501|sp|B0BBG4|RUVX_CHLTB RecName: Full=Putative Holliday junction resolvase
 gi|558088|gb|AAA80196.1| unknown [Chlamydia trachomatis]
 gi|165930382|emb|CAP03875.1| putative Holliday junction resolvase [Chlamydia trachomatis 434/Bu]
 gi|165931257|emb|CAP06829.1| putative Holliday junction resolvase [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|289525222|emb|CBJ14698.1| putative Holliday junction resolvase [Chlamydia trachomatis
           Sweden2]
 gi|296434770|gb|ADH16948.1| Holliday junction resolvase-like protein [Chlamydia trachomatis
           E/150]
 gi|296438490|gb|ADH20643.1| Holliday junction resolvase-like protein [Chlamydia trachomatis
           E/11023]
          Length = 148

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 67/142 (47%), Gaps = 8/142 (5%)

Query: 14  KPNQPIASIDLGTKRIGLAI-SDPGRRFAHPRPF---LVRKKVTQTALELLSFITTENIA 69
           K  Q    ID G KRIGLA  S P      P P      R  +T TA  L+S I    + 
Sbjct: 5   KQQQAFLGIDYGKKRIGLAFASSP---LLIPLPIGNVEARSSLTLTAQALVSIIKERAVT 61

Query: 70  AFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL-IDMNVS 128
             + G PL M  +    V S    +  +I     +  + WDERL++  A+++L  D  ++
Sbjct: 62  TVVFGNPLPMQKAYASSVQSEIQELAALIQEMTAIEVILWDERLSSAQAERMLKSDCGLN 121

Query: 129 RKKRIQKVDSIAAALILQEVLD 150
           RK+R    DS+AA LIL   LD
Sbjct: 122 RKQRKNSSDSLAATLILSSFLD 143


>gi|58584953|ref|YP_198526.1| endonuclease [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|81311607|sp|Q5GRU0|RUVX_WOLTR RecName: Full=Putative Holliday junction resolvase
 gi|58419269|gb|AAW71284.1| Predicted endonuclease involved in recombination, RNase H fold,
           yqgF family [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 155

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 73/149 (48%), Gaps = 1/149 (0%)

Query: 8   DLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN 67
           + +KS+  ++ I  +D+G K+IG+A SD  +  A       RK +++    L        
Sbjct: 8   EFLKSIPKDKCIMCLDMGEKQIGIAFSDKTQLIATAHSVYYRKNISKDLGYLNRIFKKNE 67

Query: 68  IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV 127
             + +IGLPL ++G +     +   F + MI +K  V     DE L+T  A   L    V
Sbjct: 68  AGSIVIGLPLEIDGQKSEWCKTIIKFANKMI-KKYKVSTYLQDESLSTSIAAHTLKISGV 126

Query: 128 SRKKRIQKVDSIAAALILQEVLDRISFLE 156
           S  K  +  D I+A +ILQ  LD+I+ ++
Sbjct: 127 STTKSKRIDDKISACIILQRTLDKINVIK 155


>gi|325280500|ref|YP_004253042.1| Holliday junction resolvase [Odoribacter splanchnicus DSM 20712]
 gi|324312309|gb|ADY32862.1| Holliday junction resolvase [Odoribacter splanchnicus DSM 20712]
          Length = 141

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 76/135 (56%), Gaps = 5/135 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G KR+GLA+SDP    A     ++ +++ +    L ++++ E +  F++G P  
Sbjct: 4   ILAIDYGKKRVGLAVSDPCGIIATGLQTVLSQEIFRF---LEAYLSHEKVDLFVVGHPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           M+ S+   +   + F+  +  R  ++P V +DER T+V A + L++    +K R  K  +
Sbjct: 61  MDNSDSESMTYIKPFLSGLKRRFPHIPIVMYDERFTSVLAHKALLEGGAKKKTRQDKALI 120

Query: 137 DSIAAALILQEVLDR 151
           D+++A +IL   +++
Sbjct: 121 DTMSATIILTSYMEQ 135


>gi|332878466|ref|ZP_08446187.1| RNAse H domain protein, YqgF family [Capnocytophaga sp. oral taxon
           329 str. F0087]
 gi|332683561|gb|EGJ56437.1| RNAse H domain protein, YqgF family [Capnocytophaga sp. oral taxon
           329 str. F0087]
          Length = 144

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 70/130 (53%), Gaps = 5/130 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + +ID G KR G+A++DP +  A+    +    V      ++S++  E++   ++GLP  
Sbjct: 4   VLAIDYGKKRTGVAVTDPLQLIANGLTTVSTSSVMDF---IVSYVRQEHVERIVVGLPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
            NG +   +    +FV  + +R   +P  F+DER T+V A Q ++   + +K R  K  V
Sbjct: 61  ANGEDSENMGRINSFVRCLHERLPEIPVEFFDERYTSVLAHQAMLQGGLRKKARQNKALV 120

Query: 137 DSIAAALILQ 146
           D I+A +ILQ
Sbjct: 121 DEISATIILQ 130


>gi|227888703|ref|ZP_04006508.1| crossover junction endodeoxyribonuclease [Lactobacillus johnsonii
           ATCC 33200]
 gi|227850730|gb|EEJ60816.1| crossover junction endodeoxyribonuclease [Lactobacillus johnsonii
           ATCC 33200]
          Length = 143

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 74/140 (52%), Gaps = 17/140 (12%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL-----ELLSFITTENIAAFIIGL 75
            +D+G+K +G+AISDP          L   K+ ++       ++   +   ++  F++GL
Sbjct: 5   GLDVGSKTVGVAISDP---LGITAQELETIKIDESKFSFGLRQIRKIVRKYDVEGFVLGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-----NVSRK 130
           P NM+GS G  V  ++ +   + + K  +P  + DERLTTV A +IL++       V RK
Sbjct: 62  PKNMDGSSGRSVERSKQYGERLKE-KFDLPVYYMDERLTTVQADRILVEEAGVHDRVERK 120

Query: 131 KRIQKVDSIAAALILQEVLD 150
           K I   D +AA LILQ  L+
Sbjct: 121 KVI---DQMAAVLILQNYLE 137


>gi|313203125|ref|YP_004041782.1| holliday junction resolvase yqgf [Paludibacter propionicigenes WB4]
 gi|312442441|gb|ADQ78797.1| Holliday junction resolvase YqgF [Paludibacter propionicigenes WB4]
          Length = 139

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 72/136 (52%), Gaps = 5/136 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G KR+GLA++D     A+    +   +V  T LE   +I  E +  F+IGLP  
Sbjct: 4   ILAIDYGQKRVGLAVTDMLHISANGLDTVSAHEVL-TYLE--KYIAKEPVEKFVIGLPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           MNG +   +   R F   +  +   +  V+ DER T+V A + +++  + +K R  K  V
Sbjct: 61  MNGQDSDSMQYIRPFATALQRKFPEIELVYVDERFTSVLAHKAMLEGGLKKKDRQNKELV 120

Query: 137 DSIAAALILQEVLDRI 152
           D I+A +ILQ  L+ I
Sbjct: 121 DKISATIILQSYLESI 136


>gi|300770445|ref|ZP_07080324.1| Holliday junction resolvase family protein [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|300762921|gb|EFK59738.1| Holliday junction resolvase family protein [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 138

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 72/137 (52%), Gaps = 5/137 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           + D GTKRIG+A++DP +  A+    +   ++      L +++ TE +  F++G P  M+
Sbjct: 5   AFDYGTKRIGIAVTDPLQIVANALTTVHPDEIVDF---LKNYLQTEQVETFVVGKPRQMD 61

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--VDS 138
           GS+         F+  +  +   +P    DER T+  A  ++    + + KR QK  VD+
Sbjct: 62  GSDSESASHVIGFIRLLKKQFPAIPVAEVDERFTSKMASAVIAQSGMKKGKRQQKGLVDT 121

Query: 139 IAAALILQEVLDRISFL 155
           I+A +ILQ  +D  SFL
Sbjct: 122 ISATIILQSYMDSRSFL 138


>gi|169831078|ref|YP_001717060.1| Holliday junction resolvase YqgF [Candidatus Desulforudis
           audaxviator MP104C]
 gi|226725511|sp|B1I373|RUVX_DESAP RecName: Full=Putative Holliday junction resolvase
 gi|169637922|gb|ACA59428.1| Holliday junction resolvase YqgF [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 141

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 70/132 (53%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +D+G +RIG+A++D     A+P   L R    +    +   I    +   + GLP  
Sbjct: 3   LMGLDIGDRRIGVALTDENGVAAYPLEVLERTSPEKDLRRITEIIDQYGVERVVAGLPKT 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           ++G  GP+     +F+  +  R   VP + WDERLTT   +++L+  ++ R++R + VD 
Sbjct: 63  LSGQIGPQGDKVLSFLDKLRVRST-VPVITWDERLTTAEVEKLLVSADLGRRRRRKVVDK 121

Query: 139 IAAALILQEVLD 150
           +AA LIL   L+
Sbjct: 122 LAATLILNSYLN 133


>gi|227538919|ref|ZP_03968968.1| Holliday junction resolvase family protein [Sphingobacterium
           spiritivorum ATCC 33300]
 gi|227241122|gb|EEI91137.1| Holliday junction resolvase family protein [Sphingobacterium
           spiritivorum ATCC 33300]
          Length = 138

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 72/139 (51%), Gaps = 5/139 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + + D GTKRIG+A++DP +  A+    L      +    L +++ TE +  F++G P  
Sbjct: 3   LMAFDYGTKRIGIAVTDPLQIVANA---LTTVHPNEIFDFLKNYLQTEQVETFVVGKPRQ 59

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           M+GS+         F+  +  +   +P    DER T+  A  ++    + + KR QK  V
Sbjct: 60  MDGSDSESASHVVGFIRLLKKQFPTIPVAEVDERFTSKMASAVIAQSGMKKGKRQQKGLV 119

Query: 137 DSIAAALILQEVLDRISFL 155
           D+I+A +ILQ  +D  SFL
Sbjct: 120 DTISATIILQSYMDSRSFL 138


>gi|227894661|ref|ZP_04012466.1| crossover junction endodeoxyribonuclease [Lactobacillus ultunensis
           DSM 16047]
 gi|227863556|gb|EEJ70977.1| crossover junction endodeoxyribonuclease [Lactobacillus ultunensis
           DSM 16047]
          Length = 142

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 73/134 (54%), Gaps = 5/134 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRP--FLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
            +D+G+K +G+A+SD     A       +   K       L   +   +   F++GLP N
Sbjct: 5   GLDVGSKTVGVAVSDELGITAQKLETIHIDETKYNFGMRPLKKLVRQYDPDGFVLGLPKN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNV-SRKKRIQKV 136
           M+G+ G  V  ++A+   + D K  +P  + DERLTT+ ++++L+ D  +  RKKR Q +
Sbjct: 65  MDGTSGASVARSKAYGKRLED-KFGLPVHYSDERLTTIESRRVLVEDAGIHDRKKRKQVI 123

Query: 137 DSIAAALILQEVLD 150
           D +AA LILQ  LD
Sbjct: 124 DQMAAVLILQNYLD 137


>gi|329666848|gb|AEB92796.1| hypothetical protein LJP_0462 [Lactobacillus johnsonii DPC 6026]
          Length = 143

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 74/140 (52%), Gaps = 17/140 (12%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL-----ELLSFITTENIAAFIIGL 75
            +D+G+K +G+AISDP          L   K+ ++       ++   +   ++  F++GL
Sbjct: 5   GLDVGSKTVGVAISDP---LGITAQELETIKIDESKFSFGMRQIRKIVRKYDVEGFVLGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-----NVSRK 130
           P NM+GS G  V  ++ +   + + K  +P  + DERLTTV A +IL++       V RK
Sbjct: 62  PKNMDGSSGHSVERSKQYGERLKE-KFDLPVYYMDERLTTVQADRILVEEAGVHDRVERK 120

Query: 131 KRIQKVDSIAAALILQEVLD 150
           K I   D +AA LILQ  L+
Sbjct: 121 KVI---DQMAAVLILQNYLE 137


>gi|325294689|ref|YP_004281203.1| Holliday junction resolvase [Desulfurobacterium thermolithotrophum
           DSM 11699]
 gi|325065137|gb|ADY73144.1| Holliday junction resolvase [Desulfurobacterium thermolithotrophum
           DSM 11699]
          Length = 141

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 73/135 (54%), Gaps = 7/135 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + ++D+G K+IG+A+SDP    A+P   + RK   +T  +LL  I   ++   IIG+P++
Sbjct: 4   VMALDVGFKKIGIAVSDPLLLTANPHSIIYRKSNKETFSKLLELIEKLDVGKIIIGIPIS 63

Query: 79  MNGSEGPRVHSTRAFVHN----MIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
             G E       + F       + +R   +  VF DE  +++ A+++   +  + K   +
Sbjct: 64  SEGKETKMAEKIKKFALKLDSFLKERGKKIEIVFIDESYSSLEAKELCRFLGKTEK---E 120

Query: 135 KVDSIAAALILQEVL 149
           ++D IAAAL+L+E L
Sbjct: 121 EIDDIAAALMLKEWL 135


>gi|255008472|ref|ZP_05280598.1| Holliday junction resolvase-like protein [Bacteroides fragilis
           3_1_12]
 gi|313146201|ref|ZP_07808394.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313134968|gb|EFR52328.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 138

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 74/147 (50%), Gaps = 19/147 (12%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT----ENIAAFIIG 74
           I +ID G KR G+A+SD  +  A+          T  + ELL FIT     E +   IIG
Sbjct: 4   IIAIDYGRKRTGIAVSDAMQIIAN-------GLTTVPSHELLDFITNYVKQEPVERIIIG 56

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP  MN      + +   FV ++  R   +P  + DER T+V A + +I+  + +K R  
Sbjct: 57  LPKQMNNEVSENMKNIEPFVRSLRKRLPDIPVEYVDERFTSVLAHRTMIEAGLKKKDRQN 116

Query: 135 K--VDSIAAALILQEVLDRISFLESSK 159
           K  VD I+A +ILQ      S+LES +
Sbjct: 117 KALVDEISATIILQ------SYLESKR 137


>gi|295396123|ref|ZP_06806306.1| possible crossover junction endodeoxyribonuclease [Brevibacterium
           mcbrellneri ATCC 49030]
 gi|294971064|gb|EFG46956.1| possible crossover junction endodeoxyribonuclease [Brevibacterium
           mcbrellneri ATCC 49030]
          Length = 147

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 70/139 (50%), Gaps = 2/139 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLNM 79
            ID+G  R+G+A SDP    A P   + R+     AL  +  I  E +    +IG P ++
Sbjct: 8   GIDVGAVRVGIAHSDPDGILASPLEVVNRRGGDNIALRRIQEIVEEVDPVELVIGDPTSL 67

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +G         R F   ++DR   +P  + DER TT  A  +L +   + K+R + VD+ 
Sbjct: 68  DGKARQSADKARRFAQKIVDR-TGLPVRYVDERFTTTQAHLMLQEAGKTSKQRRETVDAQ 126

Query: 140 AAALILQEVLDRISFLESS 158
           AA +ILQ  LD ++  ++S
Sbjct: 127 AAVVILQTALDALAREDNS 145


>gi|288801321|ref|ZP_06406775.1| Holliday junction resolvase [Prevotella sp. oral taxon 299 str.
           F0039]
 gi|288331704|gb|EFC70188.1| Holliday junction resolvase [Prevotella sp. oral taxon 299 str.
           F0039]
          Length = 137

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 69/135 (51%), Gaps = 7/135 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL-SFITTENIAAFIIGLPL 77
           I +ID G KR GLA++D  +  A+    +     T T  E L ++I  E +   IIGLP 
Sbjct: 4   ILAIDYGQKRTGLAVTDTLQLIANGLDTIP----THTLYEFLCAYIEKEPVERIIIGLPR 59

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK-- 135
             NG     +     FV      +  VP  ++DER T+V A + +ID  + +K R  K  
Sbjct: 60  QTNGLPSENMKRIEPFVARWKKHQPNVPIEYYDERFTSVLAHRAMIDGGLKKKARQDKAL 119

Query: 136 VDSIAAALILQEVLD 150
           VD I+A +ILQ+ L+
Sbjct: 120 VDKISATIILQDYLE 134


>gi|89898213|ref|YP_515323.1| Holliday junction resolvase-like protein [Chlamydophila felis
           Fe/C-56]
 gi|146325561|sp|Q254W0|RUVX_CHLFF RecName: Full=Putative Holliday junction resolvase
 gi|89331585|dbj|BAE81178.1| conserved hypothetical protein [Chlamydophila felis Fe/C-56]
          Length = 150

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 71/139 (51%), Gaps = 8/139 (5%)

Query: 22  IDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +D G +RIGLA +      + P  F+   K +  TA  L   I    ++  ++G P+ M 
Sbjct: 13  VDYGQRRIGLAYAASPLFISLPIGFIEAGKTLEATAQSLAKIILEREVSCVVLGNPIPMQ 72

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL-IDMNVSRKKRIQKVDSI 139
             +   +      + ++I    +V  V WDERL++  A+++L  D  +SRK+R  K DS+
Sbjct: 73  IGQKSSLQEEILKISSLIQEFCHVDVVLWDERLSSAQAERMLKCDCGLSRKQRKGKTDSV 132

Query: 140 AAALILQEVLDRISFLESS 158
           AA LIL       +FLESS
Sbjct: 133 AATLIL------TNFLESS 145


>gi|15604904|ref|NP_219688.1| Holliday junction resolvase-like protein [Chlamydia trachomatis
           D/UW-3/CX]
 gi|76788906|ref|YP_327992.1| Holliday junction resolvase-like protein [Chlamydia trachomatis
           A/HAR-13]
 gi|237802608|ref|YP_002887802.1| Holliday junction resolvase-like protein [Chlamydia trachomatis
           B/Jali20/OT]
 gi|237804530|ref|YP_002888684.1| Holliday junction resolvase-like protein [Chlamydia trachomatis
           B/TZ1A828/OT]
 gi|255310984|ref|ZP_05353554.1| Holliday junction resolvase-like protein [Chlamydia trachomatis
           6276]
 gi|255317285|ref|ZP_05358531.1| Holliday junction resolvase-like protein [Chlamydia trachomatis
           6276s]
 gi|6226795|sp|Q46370|RUVX_CHLTR RecName: Full=Putative Holliday junction resolvase
 gi|146325562|sp|Q3KMH8|RUVX_CHLTA RecName: Full=Putative Holliday junction resolvase
 gi|3328589|gb|AAC67776.1| YqgF Family [Chlamydia trachomatis D/UW-3/CX]
 gi|76167436|gb|AAX50444.1| hypothetical cytosolic protein [Chlamydia trachomatis A/HAR-13]
 gi|231272830|emb|CAX09739.1| putative Holliday junction resolvase [Chlamydia trachomatis
           B/TZ1A828/OT]
 gi|231273842|emb|CAX10632.1| putative Holliday junction resolvase [Chlamydia trachomatis
           B/Jali20/OT]
 gi|296435699|gb|ADH17873.1| Holliday junction resolvase-like protein [Chlamydia trachomatis
           G/9768]
 gi|296436623|gb|ADH18793.1| Holliday junction resolvase-like protein [Chlamydia trachomatis
           G/11222]
 gi|296437559|gb|ADH19720.1| Holliday junction resolvase-like protein [Chlamydia trachomatis
           G/11074]
 gi|297140058|gb|ADH96816.1| Holliday junction resolvase-like protein [Chlamydia trachomatis
           G/9301]
 gi|297748314|gb|ADI50860.1| Hypothetical cytosolic protein [Chlamydia trachomatis D-EC]
 gi|297749194|gb|ADI51872.1| Hypothetical cytosolic protein [Chlamydia trachomatis D-LC]
          Length = 148

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 67/142 (47%), Gaps = 8/142 (5%)

Query: 14  KPNQPIASIDLGTKRIGLAI-SDPGRRFAHPRPF---LVRKKVTQTALELLSFITTENIA 69
           K  Q    ID G KRIGLA  S P      P P      R  +T TA  L+S I    + 
Sbjct: 5   KQQQAFLGIDYGKKRIGLAFASSP---LLIPLPIGNVEARSSLTLTAQALVSIIKERAVT 61

Query: 70  AFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL-IDMNVS 128
             + G PL M  +    V S    +  +I     +  + WDERL++  A+++L  D  ++
Sbjct: 62  TVVFGNPLPMQKAYASSVQSEIQELAALIQEMTAIEVILWDERLSSAQAERMLKSDCGLN 121

Query: 129 RKKRIQKVDSIAAALILQEVLD 150
           RK+R    DS+AA LIL   LD
Sbjct: 122 RKQRKNPSDSLAATLILSSFLD 143


>gi|42518572|ref|NP_964502.1| hypothetical protein LJ0476 [Lactobacillus johnsonii NCC 533]
 gi|62900996|sp|Q74KV1|RUVX_LACJO RecName: Full=Putative Holliday junction resolvase
 gi|41582857|gb|AAS08468.1| hypothetical protein LJ_0476 [Lactobacillus johnsonii NCC 533]
          Length = 143

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 74/140 (52%), Gaps = 17/140 (12%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL-----ELLSFITTENIAAFIIGL 75
            +D+G+K +G+AISDP          L   K+ ++       ++   +   ++  F++GL
Sbjct: 5   GLDVGSKTVGVAISDP---LGITAQELETIKIDESKFSFGLRQIRRIVRKYDVEGFVLGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-----NVSRK 130
           P NM+GS G  V  ++ +   + + K  +P  + DERLTTV A +IL++       V RK
Sbjct: 62  PKNMDGSSGHSVERSKQYGERLKE-KFDLPVYYMDERLTTVQADRILVEEAGVHDRVERK 120

Query: 131 KRIQKVDSIAAALILQEVLD 150
           K I   D +AA LILQ  L+
Sbjct: 121 KVI---DQMAAVLILQNYLE 137


>gi|152002513|dbj|BAF73537.1| predicted endonuclease [Onion yellows phytoplasma OY-W]
          Length = 151

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 66/140 (47%), Gaps = 1/140 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRP-FLVRKKVTQTALELLSFITTENIAAFIIG 74
           N     +DLG K +G+A+S  G    + +  F    K  +    L   I+   I   ++G
Sbjct: 6   NNASLGLDLGEKTLGIALSQTGIIAQNLKTIFFATHKYDRLITPLQEIISQYQIKTIVLG 65

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P +MN   G +   +  F   + ++   V  + WDERL+TV A Q+L   N  + K +Q
Sbjct: 66  YPKHMNNDIGIKAKISSDFKKTLENKFEQVKVILWDERLSTVQAIQMLKTNNKKKGKILQ 125

Query: 135 KVDSIAAALILQEVLDRISF 154
             D IAA +ILQ  LD I  
Sbjct: 126 MKDEIAATIILQNYLDYIKL 145


>gi|149280102|ref|ZP_01886226.1| Holliday junction resolvase-like protein [Pedobacter sp. BAL39]
 gi|149229116|gb|EDM34511.1| Holliday junction resolvase-like protein [Pedobacter sp. BAL39]
          Length = 138

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 69/141 (48%), Gaps = 17/141 (12%)

Query: 19  IASIDLGTKRIGLAISDP------GRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           I + D GTKR+G+A++DP      G    HP+  +           L  ++ TE + AF+
Sbjct: 4   ILAFDYGTKRVGIAVTDPLQIIATGLDNVHPKDIIEY---------LKKYLLTEQVEAFV 54

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           IG P  M+GS        + F   +      +P  + DER T+  A Q ++   + ++ R
Sbjct: 55  IGDPKQMDGSPSESAQHIKGFARTLKKTFPDIPQFWVDERFTSKLAHQTILQSGLKKQDR 114

Query: 133 IQK--VDSIAAALILQEVLDR 151
             K  VD+IAA +ILQ  +++
Sbjct: 115 KDKSRVDTIAATIILQYFMEQ 135


>gi|116629094|ref|YP_814266.1| RNase H-like ribonuclease [Lactobacillus gasseri ATCC 33323]
 gi|238853837|ref|ZP_04644202.1| conserved hypothetical protein [Lactobacillus gasseri 202-4]
 gi|282852131|ref|ZP_06261488.1| RNAse YqgF [Lactobacillus gasseri 224-1]
 gi|311111120|ref|ZP_07712517.1| putative Holliday junction resolvase [Lactobacillus gasseri MV-22]
 gi|122273908|sp|Q045P4|RUVX_LACGA RecName: Full=Putative Holliday junction resolvase
 gi|116094676|gb|ABJ59828.1| RNase H-like ribonuclease [Lactobacillus gasseri ATCC 33323]
 gi|238833532|gb|EEQ25804.1| conserved hypothetical protein [Lactobacillus gasseri 202-4]
 gi|282556695|gb|EFB62300.1| RNAse YqgF [Lactobacillus gasseri 224-1]
 gi|311066274|gb|EFQ46614.1| putative Holliday junction resolvase [Lactobacillus gasseri MV-22]
          Length = 143

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 80/146 (54%), Gaps = 17/146 (11%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL-----ELLSFITTENIAAFIIGL 75
            +D+G+K +G+AISDP          L   K+ ++       ++   +   ++  F++GL
Sbjct: 5   GLDVGSKTVGVAISDP---LGITAQELETIKIDESKFSFGMRQIRKLVRKYDVEGFVLGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNV-SRKKRI 133
           P NM+GS G  V  ++ +   + + K  +P  + DERLTTV A +IL+ +  V  R +R 
Sbjct: 62  PKNMDGSSGHSVERSKQYGERLKE-KFDLPVHYMDERLTTVQADRILVQEAGVHDRVERK 120

Query: 134 QKVDSIAAALILQEVLDRISFLESSK 159
           + +D +AA LILQ      S+LE+++
Sbjct: 121 KVIDQMAAVLILQ------SYLEATR 140


>gi|268318983|ref|YP_003292639.1| putative Holliday junction resolvase [Lactobacillus johnsonii
           FI9785]
 gi|262397358|emb|CAX66372.1| putative Holliday junction resolvase [Lactobacillus johnsonii
           FI9785]
          Length = 143

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 73/140 (52%), Gaps = 17/140 (12%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL-----ELLSFITTENIAAFIIGL 75
            +D+G+K +G+AISDP          L   K+ ++       ++   +   ++  F++GL
Sbjct: 5   GLDVGSKTVGVAISDP---LGITAQELETIKIDESKFSFGMRQIRKIVRKYDVEGFVLGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-----NVSRK 130
           P NM+GS G  V  ++ +    +  K  +P  + DERLTTV A +IL++       V RK
Sbjct: 62  PKNMDGSSGHSVERSKQY-GGRLKEKFDLPVYYVDERLTTVQADRILVEEAGVHDRVERK 120

Query: 131 KRIQKVDSIAAALILQEVLD 150
           K I   D +AA LILQ  L+
Sbjct: 121 KVI---DQMAAVLILQNYLE 137


>gi|189347877|ref|YP_001944406.1| Holliday junction resolvase YqgF [Chlorobium limicola DSM 245]
 gi|189342024|gb|ACD91427.1| Holliday junction resolvase YqgF [Chlorobium limicola DSM 245]
          Length = 142

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 72/141 (51%), Gaps = 5/141 (3%)

Query: 12  SLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAF 71
           SL   + I +ID GTKRIG A SDP + FA P   + R ++ +   +L      E I   
Sbjct: 2   SLSRKKRIVAIDFGTKRIGFAESDPLQLFAQPVGTVDRAELFE---KLEQMARNEEIDKI 58

Query: 72  IIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           ++G PLN +G++         F+  +      +P    DE  ++  A QIL    +SRK+
Sbjct: 59  LVGYPLNDDGTQNRMTGVIDRFIEELALGFPGLPVERVDEHRSSRDAMQILAASGISRKE 118

Query: 132 RIQK--VDSIAAALILQEVLD 150
           R +K  +D  AA +IL+E LD
Sbjct: 119 RNRKGRLDCAAACVILREYLD 139


>gi|282866221|ref|ZP_06275268.1| Holliday junction resolvase YqgF [Streptomyces sp. ACTE]
 gi|282559005|gb|EFB64560.1| Holliday junction resolvase YqgF [Streptomyces sp. ACTE]
          Length = 154

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 61/130 (46%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID+G  RIG+A  DP    A P   +  + V      L   +        ++GLP ++ 
Sbjct: 8   AIDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLGRIVEEYEPIEVVVGLPRSLG 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     RAF   +      VP    DER++TV+A Q L    V+ KK    +D  A
Sbjct: 68  GGEGPAAVKVRAFAQVLARAIAPVPVRLVDERMSTVTATQGLRASGVTSKKGRSVIDQAA 127

Query: 141 AALILQEVLD 150
           A +ILQ  L+
Sbjct: 128 AVVILQNALE 137


>gi|255014065|ref|ZP_05286191.1| Holliday junction resolvase-like protein [Bacteroides sp. 2_1_7]
 gi|256839599|ref|ZP_05545108.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|262382117|ref|ZP_06075255.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|298375296|ref|ZP_06985253.1| Holliday junction resolvase [Bacteroides sp. 3_1_19]
 gi|301310690|ref|ZP_07216629.1| putative Holliday junction resolvase [Bacteroides sp. 20_3]
 gi|256738529|gb|EEU51854.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|262297294|gb|EEY85224.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|298267796|gb|EFI09452.1| Holliday junction resolvase [Bacteroides sp. 3_1_19]
 gi|300832264|gb|EFK62895.1| putative Holliday junction resolvase [Bacteroides sp. 20_3]
          Length = 140

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 75/143 (52%), Gaps = 11/143 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G KR G+A +D  +  A+    +   +V +    L  +I+ E +  F++GLP  
Sbjct: 4   IIAIDYGRKRTGIAATDILQMIANGVATVPSGEVVKY---LSDYISREPVDLFVVGLPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           MN      +    AFV ++      +P  ++DER T+V A + +++  + +KKR  K  V
Sbjct: 61  MNNEPSENMKYVEAFVTHLKRTIPSIPVTYYDERFTSVLAHKAMLEGGLKKKKRQDKGLV 120

Query: 137 DSIAAALILQEVLDRISFLESSK 159
           D I+A +ILQ      ++LES K
Sbjct: 121 DEISAVIILQ------AYLESKK 137


>gi|326335222|ref|ZP_08201418.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325692630|gb|EGD34573.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 148

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 71/139 (51%), Gaps = 5/139 (3%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           LK    I +ID GTKR G+A++D  +  A     L   + T+    L  +  +E++   I
Sbjct: 10  LKAQMRILAIDYGTKRCGIAVTDELKLIASA---LATVETTELLDFLQQYCQSESVERII 66

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           IGLP   +G       +  +F+  + ++   +P   +DER T+  A  IL++    +KKR
Sbjct: 67  IGLPKQTSGEPSESEAAIVSFMEKLQEKLPEIPVSRYDERFTSKIASHILVESGTKKKKR 126

Query: 133 IQK--VDSIAAALILQEVL 149
             K  +D I+A LILQ+ L
Sbjct: 127 QDKALLDRISATLILQDYL 145


>gi|300865579|ref|ZP_07110357.1| Holliday junction resolvase-like protein [Oscillatoria sp. PCC
           6506]
 gi|300336413|emb|CBN55507.1| Holliday junction resolvase-like protein [Oscillatoria sp. PCC
           6506]
          Length = 170

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 65/130 (50%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+G KRIG+A  D     A     + R    +   +    +T   +   + GLP NMN
Sbjct: 11  GLDIGQKRIGVAGCDGTGLIATGLGTIARSSFDKDVAQFRQLVTERGVQVLVSGLPYNMN 70

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G+ G +    + +   +    + +P  + DERLT++ A+Q+++   +S  +    +D  A
Sbjct: 71  GTLGFQARQVQKYASRLAS-ALALPLEYVDERLTSIQAEQLMLTEKISPSRNKALIDRKA 129

Query: 141 AALILQEVLD 150
           AA+ILQ+ LD
Sbjct: 130 AAIILQQWLD 139


>gi|300362249|ref|ZP_07058425.1| crossover junction endodeoxyribonuclease [Lactobacillus gasseri
           JV-V03]
 gi|300353240|gb|EFJ69112.1| crossover junction endodeoxyribonuclease [Lactobacillus gasseri
           JV-V03]
          Length = 143

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 80/146 (54%), Gaps = 17/146 (11%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL-----ELLSFITTENIAAFIIGL 75
            +D+G+K +G+AISDP          L   K+ ++       ++   +   ++  F++GL
Sbjct: 5   GLDVGSKTVGVAISDP---LGITAQELETIKIDESKFSFGMRQIRKIVRKYDVEGFVLGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNV-SRKKRI 133
           P NM+GS G  V  ++ +   + + K  +P  + DERLTTV A +IL+ +  V  R +R 
Sbjct: 62  PKNMDGSSGHSVERSKQYGERLKE-KFDLPVHYMDERLTTVQADRILVQEAGVHDRVERK 120

Query: 134 QKVDSIAAALILQEVLDRISFLESSK 159
           + +D +AA LILQ      S+LE+++
Sbjct: 121 KVIDQMAAVLILQ------SYLEATR 140


>gi|113477781|ref|YP_723842.1| Holliday junction resolvase-like protein [Trichodesmium erythraeum
           IMS101]
 gi|110168829|gb|ABG53369.1| Holliday junction resolvase YqgF [Trichodesmium erythraeum IMS101]
          Length = 149

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 67/130 (51%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+G KR+G+A  D     A     + R    +   +L   +    +   I+GLP +MN
Sbjct: 10  GLDVGIKRMGVAGCDGTGLIATGIMTIKRASFEKDVFQLQKIVQERQVQVLIVGLPYSMN 69

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GS G +    + +   +  + + +P  + DERLT+V A+++L   N+S  +    +D  A
Sbjct: 70  GSIGFQAKKVQRYAQRL-SQTLGLPLEYVDERLTSVQAEEMLKAANISPSQNKALIDRKA 128

Query: 141 AALILQEVLD 150
           AALILQ+ LD
Sbjct: 129 AALILQQWLD 138


>gi|160945990|ref|ZP_02093216.1| hypothetical protein FAEPRAM212_03523 [Faecalibacterium prausnitzii
           M21/2]
 gi|158443721|gb|EDP20726.1| hypothetical protein FAEPRAM212_03523 [Faecalibacterium prausnitzii
           M21/2]
          Length = 143

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 67/135 (49%), Gaps = 8/135 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAH---PRPFL-VRKKVTQTALELLSFITTENIAAFIIG 74
           I ++D G  R GLA  D          P+  L  R KV     E+   I  E I   +IG
Sbjct: 3   ILAVDYGDSRTGLATCDRTEFLTTAITPQITLKARNKVAARVCEVAKEIEAEMI---LIG 59

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPLNM+G+EG R   +R      ++    +P   WDER TT +A  +L +      +R +
Sbjct: 60  LPLNMDGTEGERAAKSRKLAKT-VELWSGLPVRMWDERQTTCAAADLLDESGTYGSRRKE 118

Query: 135 KVDSIAAALILQEVL 149
            +DS++A +IL++ L
Sbjct: 119 ILDSVSATVILEDYL 133


>gi|146296781|ref|YP_001180552.1| Holliday junction resolvase YqgF [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|167012707|sp|A4XKC6|RUVX_CALS8 RecName: Full=Putative Holliday junction resolvase
 gi|145410357|gb|ABP67361.1| Holliday junction resolvase YqgF [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 138

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 76/144 (52%), Gaps = 18/144 (12%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN-IAAFIIGLPL 77
           I  +D+G++RIG+AISDP +  A P  F V     +     L  I  E+ I   +IG P+
Sbjct: 3   ILCLDIGSRRIGVAISDPLKIAAQP--FCVLDLQKEDLYSCLDKIFNEHQIEKIVIGYPV 60

Query: 78  NMNGSEGPRVHSTRAF--------VHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR 129
           +       + H  +A         + + ++R+  V  + WDER +T + ++IL + NVS 
Sbjct: 61  S-------KFHPDKATEKLQKIDEICSELERRYKVGIIKWDERFSTKAVERILREENVSW 113

Query: 130 KKRIQKVDSIAAALILQEVLDRIS 153
           +KR + VD +AA  ILQ  LD I+
Sbjct: 114 QKRKKVVDKLAAVYILQGYLDFIN 137


>gi|303237217|ref|ZP_07323787.1| RNAse H domain protein, YqgF family [Prevotella disiens FB035-09AN]
 gi|302482604|gb|EFL45629.1| RNAse H domain protein, YqgF family [Prevotella disiens FB035-09AN]
          Length = 139

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 68/134 (50%), Gaps = 6/134 (4%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I S+D G KR GLA++DP +  A+    LV    ++    L  ++  EN+   ++G P  
Sbjct: 4   ILSVDYGKKRTGLAVTDPLQIIANG---LVTVATSELFDFLKDYVQRENVECIVVGRPTQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--- 135
           +NG     +     FV+        +P  ++DER T+  AQQ ++   V +K R +    
Sbjct: 61  LNGQPSENLSRVEQFVNRWRKAMPLIPVEYYDERFTSALAQQAILAGGVKKKMRREDKGL 120

Query: 136 VDSIAAALILQEVL 149
           VD ++A +ILQ+ +
Sbjct: 121 VDEVSATIILQDYM 134


>gi|257784263|ref|YP_003179480.1| Holliday junction resolvase YqgF [Atopobium parvulum DSM 20469]
 gi|257472770|gb|ACV50889.1| Holliday junction resolvase YqgF [Atopobium parvulum DSM 20469]
          Length = 140

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 64/132 (48%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + ++D+G  RIG+A+SDP    A P   L  ++V   A    + +        + G P  
Sbjct: 3   VLALDIGEVRIGVAVSDPDGAIASPVCVLPAQEVLSHARTFKTVLEDWEPELLLCGRPKT 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           + G +GP+           I +   +P  F DERL++  A++IL    +S K    KVD 
Sbjct: 63  LAGEDGPQAQKITVQAEQ-IAKNCQLPLEFTDERLSSAEAKKILRAQGLSEKAMRGKVDM 121

Query: 139 IAAALILQEVLD 150
           +AA+L LQ  LD
Sbjct: 122 VAASLFLQSWLD 133


>gi|71893554|ref|YP_279000.1| hypothetical protein MHJ_0198 [Mycoplasma hyopneumoniae J]
 gi|72080541|ref|YP_287599.1| hypothetical protein MHP7448_0202 [Mycoplasma hyopneumoniae 7448]
          Length = 130

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 69/136 (50%), Gaps = 9/136 (6%)

Query: 27  KRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLSFITTEN-IAAFIIGLPLNMNGSEG 84
           K  G AISD   + ++P   F   +    + +  ++F   E  I+  ++G PL + G   
Sbjct: 2   KTCGFAISDQNWKISYPLEQFNFNRYDFASVISRIAFWMKEYPISILVLGYPLTLAGKIS 61

Query: 85  PRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALI 144
           PR      F  +++ +   +  VF DERLTT  AQ  L+D+ +S KKR + +D +AA +I
Sbjct: 62  PRTKMVEYFA-DLVKKNYEIKVVFQDERLTTKQAQTFLLDLGISFKKRQKVIDKLAAQII 120

Query: 145 LQEVLDRISFLESSKG 160
           L+       FL + KG
Sbjct: 121 LER------FLNTKKG 130


>gi|295103244|emb|CBL00788.1| conserved hypothetical protein TIGR00250 [Faecalibacterium
           prausnitzii SL3/3]
          Length = 143

 Score = 67.4 bits (163), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 67/135 (49%), Gaps = 8/135 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAH---PRPFL-VRKKVTQTALELLSFITTENIAAFIIG 74
           I ++D G  R GLA  D          P+  L  R KV     E+   I  E I   +IG
Sbjct: 3   ILAVDYGDSRTGLATCDRTEFLTTAITPQITLKARNKVAARVCEVAKEIEAEMI---LIG 59

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPLNM+G+EG R   +R      ++    +P   WDER TT +A  +L +      +R +
Sbjct: 60  LPLNMDGTEGERAAKSRKLAKT-VELWSGLPVRMWDERQTTCAAADLLDESGTYGSRRKE 118

Query: 135 KVDSIAAALILQEVL 149
            +DS++A +IL++ L
Sbjct: 119 ILDSVSATVILEDYL 133


>gi|159037444|ref|YP_001536697.1| Holliday junction resolvase YqgF [Salinispora arenicola CNS-205]
 gi|157916279|gb|ABV97706.1| Holliday junction resolvase YqgF [Salinispora arenicola CNS-205]
          Length = 153

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 65/136 (47%), Gaps = 6/136 (4%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKK------VTQTALELLSFITTENIAAFIIG 74
            +D+G  R+G+A SDP    A P   L R +      V     EL + +        ++G
Sbjct: 11  GVDVGQVRVGVARSDPHGVLATPLVTLARDRDAAPDAVPSDIAELAALVAEHEAVEVVVG 70

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP+N+ G  GP     + +V  +++    VP    DER++TV A + L +  V  +++  
Sbjct: 71  LPVNLAGRHGPAAVQVQEYVGRLVEVISPVPVTLADERMSTVVASRRLAERGVRGRRQRA 130

Query: 135 KVDSIAAALILQEVLD 150
            VD  AA  ILQ  LD
Sbjct: 131 VVDQAAAVEILQSWLD 146


>gi|62185187|ref|YP_219972.1| Holliday junction resolvase-like protein [Chlamydophila abortus
           S26/3]
 gi|81312649|sp|Q5L5S0|RUVX_CHLAB RecName: Full=Putative Holliday junction resolvase
 gi|62148254|emb|CAH64019.1| putative Holliday junction resolvase [Chlamydophila abortus S26/3]
          Length = 150

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 70/140 (50%), Gaps = 8/140 (5%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN-IAAFIIGLPLNM 79
            +D G +RIGLA +      + P  F+   K  +   +LL  I  E  ++  ++G PL M
Sbjct: 12  GVDYGERRIGLAYAAYPLGISLPIGFIATGKTLEATAKLLVGIIQERRVSTVVLGNPLPM 71

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQKVDS 138
              +   +      + +++     V  + WDERL++  A+++L  D  +SRKKR  K DS
Sbjct: 72  QKGQKSALQEDILKLSSLLQESCPVEVILWDERLSSAQAERMLKGDCGLSRKKRKGKTDS 131

Query: 139 IAAALILQEVLDRISFLESS 158
           IAA LIL       SFLE S
Sbjct: 132 IAATLIL------TSFLEHS 145


>gi|118597207|sp|Q6NGZ8|RUVX_CORDI RecName: Full=Putative Holliday junction resolvase
          Length = 171

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 78/151 (51%), Gaps = 17/151 (11%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVR----KKVTQTALELLSFITTEN-IAAFIIGL 75
            +D+GT RIGLA+SD G R A P   L R    K   +  ++ ++ +  +N I   ++GL
Sbjct: 20  GVDVGTVRIGLAMSDSGARMAMPFETLARETGLKDSDKQDIDRIAEVICDNHIVEVVVGL 79

Query: 76  P--LNMNGSEGPRVHSTRAFVHNMIDRKVY------VPFVFWDERLTTVSAQQILIDMNV 127
           P  L  NGS+  +     AF    I R+++      V     DERLTTV A Q L    V
Sbjct: 80  PRDLKGNGSKSVKHAKDVAF---RIRRRMHKNGWEHVAVKMADERLTTVVATQALRASGV 136

Query: 128 SRKKRIQKVDSIAAALILQEVLD-RISFLES 157
           S KK  + VD  AA  ILQ  LD RI+ LE+
Sbjct: 137 SEKKGRRVVDQAAAVEILQSWLDARINVLEN 167


>gi|17230592|ref|NP_487140.1| Holliday junction resolvase-like protein [Nostoc sp. PCC 7120]
 gi|75910008|ref|YP_324304.1| Holliday junction resolvase-like protein [Anabaena variabilis ATCC
           29413]
 gi|32130049|sp|Q8YSI5|RUVX_ANASP RecName: Full=Putative Holliday junction resolvase
 gi|146325551|sp|Q3M6H7|RUVX_ANAVT RecName: Full=Putative Holliday junction resolvase
 gi|17132194|dbj|BAB74799.1| alr3100 [Nostoc sp. PCC 7120]
 gi|75703733|gb|ABA23409.1| Holliday junction resolvase YqgF [Anabaena variabilis ATCC 29413]
          Length = 151

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 68/130 (52%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+G KR+G+A  D     A     + R    +   ++ + +    +   ++GLP +M+
Sbjct: 9   GLDVGRKRVGVAGCDRTGLIATGITTVERTSFDRDVQQIQNIVNERQVQVLVVGLPYSMD 68

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GS G +    + F   +  + + +P  + DERLT+  A+Q+LI  NVS  +    +D  A
Sbjct: 69  GSLGFQARQVQKFTSRLA-KALQLPVEYVDERLTSFQAEQMLIAENVSPSRNKGLIDRKA 127

Query: 141 AALILQEVLD 150
           AALILQ+ LD
Sbjct: 128 AALILQQWLD 137


>gi|53712972|ref|YP_098964.1| Holliday junction resolvase-like protein [Bacteroides fragilis
           YCH46]
 gi|60681184|ref|YP_211328.1| Holliday junction resolvase-like protein [Bacteroides fragilis NCTC
           9343]
 gi|253563050|ref|ZP_04840507.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|265763069|ref|ZP_06091637.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|62900958|sp|Q64VP6|RUVX_BACFR RecName: Full=Putative Holliday junction resolvase
 gi|81315746|sp|Q5LER0|RUVX_BACFN RecName: Full=Putative Holliday junction resolvase
 gi|52215837|dbj|BAD48430.1| putative endonuclease [Bacteroides fragilis YCH46]
 gi|60492618|emb|CAH07390.1| putative Holliday junction resolvase [Bacteroides fragilis NCTC
           9343]
 gi|251946826|gb|EES87108.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|263255677|gb|EEZ27023.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|301162673|emb|CBW22220.1| putative Holliday junction resolvase [Bacteroides fragilis 638R]
          Length = 138

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 70/138 (50%), Gaps = 13/138 (9%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT----ENIAAFIIG 74
           I +ID G KR G+A+SD  +  A+          T    ELL FIT     E++   IIG
Sbjct: 4   IVAIDYGRKRTGIAVSDTMQIIANGL-------TTVPTHELLDFITNYVKQESVERIIIG 56

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP  MN      + +   FV ++  R   +P  + DER T+V A + +++  + +K R  
Sbjct: 57  LPKQMNNEVSENMKNIEPFVRSLKKRLPDMPVEYVDERFTSVLAHRTMLEAGLKKKDRQN 116

Query: 135 K--VDSIAAALILQEVLD 150
           K  VD I+A +ILQ  L+
Sbjct: 117 KALVDEISATIILQSYLE 134


>gi|239978414|ref|ZP_04700938.1| hypothetical protein SalbJ_03203 [Streptomyces albus J1074]
 gi|291450310|ref|ZP_06589700.1| conserved hypothetical protein [Streptomyces albus J1074]
 gi|291353259|gb|EFE80161.1| conserved hypothetical protein [Streptomyces albus J1074]
          Length = 158

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 60/130 (46%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  RIG+A  DP    A P   +  + V      L + +        ++GLP ++ 
Sbjct: 12  AVDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLAALVEEYEPIEVVVGLPRSLK 71

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     R F   +      VP    DER++TV+A Q +    V  KK    +D  A
Sbjct: 72  GGEGPAAVKVRGFAQELARTIAPVPVRLVDERMSTVTAAQGMRASGVRSKKGRAVIDQAA 131

Query: 141 AALILQEVLD 150
           A +ILQ  L+
Sbjct: 132 AVVILQSALE 141


>gi|38233935|ref|NP_939702.1| Holliday junction resolvase-like protein [Corynebacterium
           diphtheriae NCTC 13129]
 gi|38200196|emb|CAE49877.1| Conserved hypothetical protein [Corynebacterium diphtheriae]
          Length = 183

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 78/151 (51%), Gaps = 17/151 (11%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVR----KKVTQTALELLSFITTEN-IAAFIIGL 75
            +D+GT RIGLA+SD G R A P   L R    K   +  ++ ++ +  +N I   ++GL
Sbjct: 32  GVDVGTVRIGLAMSDSGARMAMPFETLARETGLKDSDKQDIDRIAEVICDNHIVEVVVGL 91

Query: 76  P--LNMNGSEGPRVHSTRAFVHNMIDRKVY------VPFVFWDERLTTVSAQQILIDMNV 127
           P  L  NGS+  +     AF    I R+++      V     DERLTTV A Q L    V
Sbjct: 92  PRDLKGNGSKSVKHAKDVAF---RIRRRMHKNGWEHVAVKMADERLTTVVATQALRASGV 148

Query: 128 SRKKRIQKVDSIAAALILQEVLD-RISFLES 157
           S KK  + VD  AA  ILQ  LD RI+ LE+
Sbjct: 149 SEKKGRRVVDQAAAVEILQSWLDARINVLEN 179


>gi|281420285|ref|ZP_06251284.1| putative Holliday junction resolvase [Prevotella copri DSM 18205]
 gi|281405587|gb|EFB36267.1| putative Holliday junction resolvase [Prevotella copri DSM 18205]
          Length = 137

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 68/138 (49%), Gaps = 14/138 (10%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT----ENIAAFIIG 74
           I SID G KR GLA++DP +  A+          T +  EL ++I T    E +   +IG
Sbjct: 3   ILSIDYGKKRTGLAVTDPLQIIAN-------GLATVSTHELFTYIETYIQKEQVERIVIG 55

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P+  NG     +     F +        +P  ++DER T+V A + +ID  V +K R +
Sbjct: 56  KPMQPNGQPSENLARVENFYNRWRKAHPEIPIEYYDERFTSVLAHRAMIDGGVKKKVRKE 115

Query: 135 K---VDSIAAALILQEVL 149
               VD I+A +ILQ+ L
Sbjct: 116 NKGLVDEISATIILQDYL 133


>gi|50365281|ref|YP_053706.1| Holliday junction resolvase [Mesoplasma florum L1]
 gi|62900971|sp|Q6F101|RUVX_MESFL RecName: Full=Putative Holliday junction resolvase
 gi|50363837|gb|AAT75822.1| possible Holliday junction resolvase [Mesoplasma florum L1]
          Length = 142

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 72/141 (51%), Gaps = 11/141 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLPL 77
           I  +D+G+K IGLA S  G            +   +  + LL+ FI  ++   F+ G P 
Sbjct: 4   ILGLDVGSKTIGLA-SSTGNVAKKEINLKFEEWNFEEGVSLLTEFIKDKSFDTFVFGYPK 62

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVP------FVFWDERLTTVSAQQILIDMNVSRKK 131
           NMNGS G R      F+   +   VY P       +  DER TT  A+ I+I+  +SR+K
Sbjct: 63  NMNGSIGERAEMVDYFIEGFM---VYNPEIKEEQIIRIDERRTTKMAKSIMIEAGLSRQK 119

Query: 132 RIQKVDSIAAALILQEVLDRI 152
           + +  D++AA LIL+  L++I
Sbjct: 120 QKENKDTLAAQLILETYLEKI 140


>gi|258405254|ref|YP_003197996.1| Holliday junction resolvase YqgF [Desulfohalobium retbaense DSM
           5692]
 gi|257797481|gb|ACV68418.1| Holliday junction resolvase YqgF [Desulfohalobium retbaense DSM
           5692]
          Length = 142

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 68/131 (51%), Gaps = 5/131 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL--ELLSFITTENIAAFIIGLPLN 78
            ID G KR+GLA+SD       P   + R   T+ AL  ELL++I T  I A +IGLP +
Sbjct: 5   GIDFGLKRVGLALSDSQATVVTPLATVQRS--TRQALFEELLAYIETYAIEAVVIGLPYD 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           + G+        R F  ++  R++ +P  + DE LT+  A + L +  V R KR   +D 
Sbjct: 63  LEGTATLTTRQARNFGTSLA-RRIALPIYYVDEVLTSEFAGEALREAGVPRHKRKDLLDQ 121

Query: 139 IAAALILQEVL 149
            AA  IL+  L
Sbjct: 122 HAAVAILESFL 132


>gi|330995382|ref|ZP_08319292.1| RNAse H domain protein, YqgF family [Paraprevotella xylaniphila YIT
           11841]
 gi|329575877|gb|EGG57401.1| RNAse H domain protein, YqgF family [Paraprevotella xylaniphila YIT
           11841]
          Length = 141

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 69/130 (53%), Gaps = 5/130 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + +ID G KR G+A++DP +  A+    +    V      ++S++  E++   ++G P  
Sbjct: 4   VLAIDYGKKRTGVAVTDPLQLIANGLTTVSTSSVMDF---IVSYVQQEHVERIVVGQPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
            NG +   +    +FV  + +R   +P  F+DER T+V A Q ++   + +K R  K  V
Sbjct: 61  ANGEDSENMGRINSFVRRLHERLPEIPVEFFDERYTSVLAHQAMLQGGLRKKARQNKALV 120

Query: 137 DSIAAALILQ 146
           D I+A +ILQ
Sbjct: 121 DEISATIILQ 130


>gi|158313531|ref|YP_001506039.1| Holliday junction resolvase YqgF [Frankia sp. EAN1pec]
 gi|158108936|gb|ABW11133.1| Holliday junction resolvase YqgF [Frankia sp. EAN1pec]
          Length = 188

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 67/134 (50%), Gaps = 5/134 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL----ELLSFITTENIAAFIIGLP 76
            +D+G+ R+G+A+SDP    A P   L R+ V++       EL   +   +    ++GLP
Sbjct: 33  GVDVGSVRVGVAVSDPDGLLAVPVTTL-RRDVSRRGFADVDELADIVRDRHAVEVVVGLP 91

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            +++G EG  V   R +   +  R   VP    DERLTTV A + + +  +  + R   V
Sbjct: 92  RHLSGREGEAVRLARRYAEVLSARVAPVPVRLVDERLTTVVAHRRMAERGLRSRARRDLV 151

Query: 137 DSIAAALILQEVLD 150
           D  AA  ILQ  LD
Sbjct: 152 DQEAAVQILQHHLD 165


>gi|332878326|ref|ZP_08446052.1| RNAse H domain protein, YqgF family [Capnocytophaga sp. oral taxon
           329 str. F0087]
 gi|332683777|gb|EGJ56648.1| RNAse H domain protein, YqgF family [Capnocytophaga sp. oral taxon
           329 str. F0087]
          Length = 136

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 68/134 (50%), Gaps = 5/134 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I SID GTKR GLA++DP +  A     L      Q    L  +   E + AF+IGLP  
Sbjct: 3   ILSIDYGTKRTGLAVTDPLKLIASG---LTTVDTPQLLPFLEKYTAEEAVEAFVIGLPKR 59

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           +N  +       +  +  + +R   +    +DER T+  A Q +ID  + +K+R  K  +
Sbjct: 60  LNNEDSAVEADIQQLLTKLKERFPTIKIHRYDERFTSKIAFQTMIDSGLKKKQRQNKALI 119

Query: 137 DSIAAALILQEVLD 150
           D I+A LILQ+ L+
Sbjct: 120 DEISATLILQDFLN 133


>gi|303246564|ref|ZP_07332842.1| Holliday junction resolvase YqgF [Desulfovibrio fructosovorans JJ]
 gi|302491904|gb|EFL51782.1| Holliday junction resolvase YqgF [Desulfovibrio fructosovorans JJ]
          Length = 147

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 69/131 (52%), Gaps = 5/131 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL--ELLSFITTENIAAFIIGLPLN 78
           +ID G  R+GLA++DP  R   P   L  +  T+ AL  ELL+ I+ + +   ++G P+ 
Sbjct: 6   AIDYGQARVGLAVTDPEARVVFPLRTLAWE--TRDALFHELLAVISDQAVTRIVVGYPMR 63

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
             G EG      R FV  +  R+  VP    DE  +T  A + L +   + K+ + +VD+
Sbjct: 64  AGGDEGLTGRQVRNFVSRLT-RRTTVPVELVDEAHSTEEAAERLREAGYAGKELLARVDA 122

Query: 139 IAAALILQEVL 149
            AAA+IL+  L
Sbjct: 123 QAAAVILERYL 133


>gi|291009599|ref|ZP_06567572.1| Holliday junction resolvase YqgF [Saccharopolyspora erythraea NRRL
           2338]
          Length = 158

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 66/131 (50%), Gaps = 1/131 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL-ELLSFITTENIAAFIIGLPLNM 79
            ID+G  R+G+A+SDP    A P   L R       L  L+  +    +   ++G+P  +
Sbjct: 17  GIDVGAVRVGVALSDPAPMLATPLVTLQRDVEGGGDLGRLVEIVAEHEVVEVVVGMPRTL 76

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
            G  GP   +  ++   + +R   VP V+ DERLTTV+A ++L    V  KK+   VD  
Sbjct: 77  AGRHGPAAEAAESYGTALAERIAPVPVVYSDERLTTVTASRMLSKRGVRGKKQRAVVDQA 136

Query: 140 AAALILQEVLD 150
           AA  ILQ  LD
Sbjct: 137 AAVEILQAWLD 147


>gi|160889624|ref|ZP_02070627.1| hypothetical protein BACUNI_02050 [Bacteroides uniformis ATCC 8492]
 gi|317479181|ref|ZP_07938318.1| hypothetical protein HMPREF1007_01434 [Bacteroides sp. 4_1_36]
 gi|156860616|gb|EDO54047.1| hypothetical protein BACUNI_02050 [Bacteroides uniformis ATCC 8492]
 gi|316904669|gb|EFV26486.1| hypothetical protein HMPREF1007_01434 [Bacteroides sp. 4_1_36]
          Length = 141

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 74/141 (52%), Gaps = 7/141 (4%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G KR G+A+SD  +  A+    +   ++ Q    LL ++  E +   ++GLP  
Sbjct: 4   IIAIDYGRKRTGIAVSDTLQMIANGLTTVPTHQLLQF---LLDYVAKEPVERILVGLPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           MN      + +   FV ++  +   +P  + DER T+V A + +++  + +K R  K  V
Sbjct: 61  MNNEASENMKNIEPFVRSLKKKLPDMPVEYVDERFTSVLAHRTMLEAGLKKKDRQNKALV 120

Query: 137 DSIAAALILQEVLD--RISFL 155
           D I+A +ILQ  L+  R SFL
Sbjct: 121 DEISATIILQTYLENKRFSFL 141


>gi|300784620|ref|YP_003764911.1| holliday junction resolvase [Amycolatopsis mediterranei U32]
 gi|299794134|gb|ADJ44509.1| putative holliday junction resolvase [Amycolatopsis mediterranei
           U32]
          Length = 133

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 64/131 (48%), Gaps = 1/131 (0%)

Query: 31  LAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN-IAAFIIGLPLNMNGSEGPRVHS 89
           +A+SDP    A P   L R     T L+ L+ + TE+ +   I+GLP  +   +GP    
Sbjct: 1   MALSDPAPVLASPLVTLSRDATDDTDLDQLAALVTEHEVVEVIVGLPRTLANRQGPAAEL 60

Query: 90  TRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALILQEVL 149
             A+   +  R   VP    DERLTTV+A +IL    V  +K+   VD  AA  ILQ  +
Sbjct: 61  AIAYSERLAGRIAPVPVRLGDERLTTVTASRILSQRGVKGRKQRAVVDQAAAVEILQAWI 120

Query: 150 DRISFLESSKG 160
           D  +   + +G
Sbjct: 121 DAAAAHRAREG 131


>gi|326514774|dbj|BAJ99748.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 199

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 75/163 (46%), Gaps = 10/163 (6%)

Query: 1   MSILLIEDLVKSL-----KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VT 53
           M +L  E+L + L     K    +  +D+G+K +GLA+SD   R A P   L R K  + 
Sbjct: 13  MRLLKAEELFRKLLEGGSKKKARLLGLDVGSKYVGLAVSDQQNRIALPLSVLGRTKTNIN 72

Query: 54  QTALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVY--VPFVFWDE 111
             A +  + +   ++A  ++G P N+ G   P        V  +        + + +WDE
Sbjct: 73  LMADDFKTLVNNYSLAGLVVGYPFNLQGQSSPDASQVSLLVGELCKTGKLDDLSYTYWDE 132

Query: 112 RLTTVSAQQILIDMNVSRKKRIQKV-DSIAAALILQEVLDRIS 153
             T+   + +L  +N++ +   + + D  AA  ILQ  LD ++
Sbjct: 133 NFTSKCVEALLNPLNLNDRVETKTMTDKFAAVCILQGYLDNMN 175


>gi|7529715|emb|CAB86895.1| putative protein [Arabidopsis thaliana]
          Length = 548

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 40/134 (29%), Positives = 72/134 (53%), Gaps = 7/134 (5%)

Query: 22  IDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGLPL-N 78
           +D+G K +GLAISDP    A P   L+RKK  +   A +  + +   +++  ++G P   
Sbjct: 405 LDVGDKYVGLAISDPSNMVASPLSVLLRKKSNIDLMATDFQNLVKAFSVSGLVVGYPFGK 464

Query: 79  MNGSEGPRVHSTRAFVHNM--IDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           +N  E   V +   F+  +   ++   V + +WDERL++ + + +L  +N+   +    +
Sbjct: 465 LNNVED--VVTVNLFIEELRKTEKLKDVKYTYWDERLSSKTVELMLKPLNLHPVQEKTML 522

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQE LD
Sbjct: 523 DKLAAVVILQEYLD 536


>gi|297242855|ref|ZP_06926793.1| endonuclease [Gardnerella vaginalis AMD]
 gi|296889066|gb|EFH27800.1| endonuclease [Gardnerella vaginalis AMD]
          Length = 124

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 55/105 (52%), Gaps = 12/105 (11%)

Query: 58  ELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKV-----------YVPF 106
           E+L  I   N+   +IGLPL ++G+EG        +  N+I R             Y+P 
Sbjct: 13  EVLEVIEDNNVEKVVIGLPLQLDGTEGKSAKKALRWGKNLIKRMQILHDEKDWALDYMPE 72

Query: 107 VFW-DERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALILQEVLD 150
           V W DERLTTVSA + L+  ++S KK    VD  +A LILQ  LD
Sbjct: 73  VVWKDERLTTVSAHRQLLQADLSTKKHRPMVDQQSAVLILQSALD 117


>gi|297820018|ref|XP_002877892.1| hypothetical protein ARALYDRAFT_323835 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297323730|gb|EFH54151.1| hypothetical protein ARALYDRAFT_323835 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 542

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 40/134 (29%), Positives = 72/134 (53%), Gaps = 7/134 (5%)

Query: 22  IDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGLPL-N 78
           +D+G K +GLAISDP    A P   L+RKK  +   A +  + +   +++  ++G P   
Sbjct: 399 LDVGDKYVGLAISDPSNMVASPLSVLLRKKTNIDLMATDFQNLVKAFSVSGLVVGYPFGK 458

Query: 79  MNGSEGPRVHSTRAFVHNM--IDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           +N  E   V +   F+  +   ++   V + +WDERL++ + + +L  +N+   +    +
Sbjct: 459 LNNVED--VVTVNLFIEELRKTEKLKDVKYTYWDERLSSKTVELMLKPLNLHPVQEKTML 516

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQE LD
Sbjct: 517 DKLAAVVILQEYLD 530


>gi|212691279|ref|ZP_03299407.1| hypothetical protein BACDOR_00770 [Bacteroides dorei DSM 17855]
 gi|237712292|ref|ZP_04542773.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|237726431|ref|ZP_04556912.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|265752000|ref|ZP_06087793.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|212666511|gb|EEB27083.1| hypothetical protein BACDOR_00770 [Bacteroides dorei DSM 17855]
 gi|229434957|gb|EEO45034.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
 gi|229453613|gb|EEO59334.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|263236792|gb|EEZ22262.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 139

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 72/143 (50%), Gaps = 11/143 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G KR G+A++D  +  A+    L      Q    +L ++  E +   I+G P  
Sbjct: 4   ILAIDYGKKRTGVAVTDVLQIIANG---LTTVPTHQLLDFILKYVEKEPVERIIVGHPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           MN  E   + +   FV+ +  +   +P  F DER T+V A Q ++D  + +K R  K  V
Sbjct: 61  MNNQESENMRNIVPFVNQLRKKLPDIPIEFVDERFTSVLAHQAMLDGGLKKKDRQNKALV 120

Query: 137 DSIAAALILQEVLDRISFLESSK 159
           D I+A +ILQ      S+LES K
Sbjct: 121 DEISATIILQ------SYLESKK 137


>gi|15606654|ref|NP_214034.1| hypothetical protein aq_1498 [Aquifex aeolicus VF5]
 gi|6226434|sp|O67469|RUVX_AQUAE RecName: Full=Putative Holliday junction resolvase
 gi|2983890|gb|AAC07442.1| hypothetical protein aq_1498 [Aquifex aeolicus VF5]
          Length = 131

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 68/134 (50%), Gaps = 5/134 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + ++D GTKR+GLAI D   +   P+  +  K+  +   E+   +    +   I+GLPL 
Sbjct: 3   VLAVDYGTKRVGLAIGDEELKIVSPKGTVSSKEAVKKIKEI---VEKSRVGKVIVGLPLT 59

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
            +G EG R    + FV  + +       + WDER TT  A + L    +  KK+ +  D 
Sbjct: 60  PSGKEGQRAKLVKDFVEKLREELPNTEIILWDERWTTAEAMRRL--EGLPPKKKKELKDV 117

Query: 139 IAAALILQEVLDRI 152
           I+A +IL+E L+ +
Sbjct: 118 ISAMIILEEYLNSV 131


>gi|288918209|ref|ZP_06412564.1| Holliday junction resolvase YqgF [Frankia sp. EUN1f]
 gi|288350379|gb|EFC84601.1| Holliday junction resolvase YqgF [Frankia sp. EUN1f]
          Length = 200

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 64/133 (48%), Gaps = 3/133 (2%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGLPL 77
            +D+G+ R+G+A SDP    A P   L R    +  +   EL   +   +    ++GLP 
Sbjct: 45  GVDVGSVRVGVAASDPDGLLAVPVTTLRRDASGRRHKDVDELADIVRDRHAVEVVVGLPR 104

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
            ++G EG  V   R +   +  R   VP    DERLTTV A + + +  +  + R + VD
Sbjct: 105 QLSGEEGEAVRRARQYAEVLSTRVAPVPVRLVDERLTTVVAHRRMAERGLRSRARRELVD 164

Query: 138 SIAAALILQEVLD 150
             AA  ILQ  LD
Sbjct: 165 QEAAVQILQHHLD 177


>gi|326531638|dbj|BAJ97823.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 187

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 75/163 (46%), Gaps = 10/163 (6%)

Query: 1   MSILLIEDLVKSL-----KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VT 53
           M +L  E+L + L     K    +  +D+G+K +GLA+SD   R A P   L R K  + 
Sbjct: 1   MRLLKAEELFRKLLEGGSKKKARLLGLDVGSKYVGLAVSDQQNRIALPLSVLGRTKTNIN 60

Query: 54  QTALELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVY--VPFVFWDE 111
             A +  + +   ++A  ++G P N+ G   P        V  +        + + +WDE
Sbjct: 61  LMADDFKTLVNNYSLAGLVVGYPFNLQGQSSPDASQVSLLVGELCKTGKLDDLSYTYWDE 120

Query: 112 RLTTVSAQQILIDMNVSRKKRIQKV-DSIAAALILQEVLDRIS 153
             T+   + +L  +N++ +   + + D  AA  ILQ  LD ++
Sbjct: 121 NFTSKCVEALLNPLNLNDRVETKTMTDKFAAVCILQGYLDNMN 163


>gi|295085224|emb|CBK66747.1| conserved hypothetical protein TIGR00250 [Bacteroides xylanisolvens
           XB1A]
          Length = 138

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 71/142 (50%), Gaps = 13/142 (9%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI----TTENIAAFIIG 74
           I +ID G KR G+A+SD  +  A+          T +  ELL+FI      E +   IIG
Sbjct: 4   IVAIDYGRKRTGIAVSDTMQLIANGL-------TTVSTHELLNFIGEYMAKEPVERIIIG 56

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP  MN      + +   FV ++  R   +P  + DER T+V A + +++  + +K R  
Sbjct: 57  LPKQMNNEVSENMKNIEPFVRSLKKRYPDLPVEYVDERFTSVLAHRTMLEAGLKKKDRQN 116

Query: 135 K--VDSIAAALILQEVLDRISF 154
           K  VD I+A +ILQ  L+   F
Sbjct: 117 KALVDEISATIILQTYLESKRF 138


>gi|311742343|ref|ZP_07716152.1| possible Holliday junction resolvase [Aeromicrobium marinum DSM
           15272]
 gi|311313971|gb|EFQ83879.1| possible Holliday junction resolvase [Aeromicrobium marinum DSM
           15272]
          Length = 149

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 64/132 (48%), Gaps = 9/132 (6%)

Query: 22  IDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMNG 81
           +D+G  RIG+A+ DP    A P   +           LL   +   +   ++GLPL+++G
Sbjct: 1   MDVGDVRIGVAMCDPDGMIATPVETVPAGPAAHA--RLLQIASEIEVVEIVVGLPLSLSG 58

Query: 82  SEGPRVHSTRAFVH---NMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
            EGP     RAFV     M DR    P    DERL+TV+A   L D   + +   + +D 
Sbjct: 59  REGPAAGKVRAFVQVLAAMSDR----PVRLVDERLSTVTAGSQLRDSGRTGRGTRRVIDQ 114

Query: 139 IAAALILQEVLD 150
            AA +ILQ  LD
Sbjct: 115 AAAVVILQNALD 126


>gi|297564704|ref|YP_003683676.1| Holliday junction resolvase YqgF [Meiothermus silvanus DSM 9946]
 gi|296849153|gb|ADH62168.1| Holliday junction resolvase YqgF [Meiothermus silvanus DSM 9946]
          Length = 135

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 66/133 (49%), Gaps = 2/133 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +A++D+G  RIGLA+ + G  +A  R +LVR+      L L +F   E +A  I+GLPL 
Sbjct: 3   VAALDVGEARIGLAVGEVGSPWAFGRGYLVRRTPQADVLALRAFAERERVAKLIVGLPLR 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
            +G+  P   + R        R+  +     DER TT    Q L +     ++   K+D 
Sbjct: 63  TDGT--PSAQAARVLELVRALREAGLEVETLDERFTTQLGAQRLKEAPRRVRQEKGKLDE 120

Query: 139 IAAALILQEVLDR 151
            AA  +L+  L+R
Sbjct: 121 AAAVALLESYLER 133


>gi|148272983|ref|YP_001222544.1| Holliday junction resolvase-like protein [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
 gi|167012711|sp|A5CRZ4|RUVX_CLAM3 RecName: Full=Putative Holliday junction resolvase
 gi|147830913|emb|CAN01857.1| putative Hollyday junction resolvase [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
          Length = 161

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 63/131 (48%), Gaps = 2/131 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLNM 79
           ++D+G  RIGLA SDP    A P   + R       +  +  + TE + A  ++GLPL +
Sbjct: 8   AVDVGKARIGLARSDPHGLIATPVETVPRDPAGSADVRRILAVATEIDCAELVVGLPLAL 67

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +G           F   + D    +P    DERL+TVSAQ  L       +K+   +D +
Sbjct: 68  SGRATASTDDAEGFARRLAD-ATEIPVRLVDERLSTVSAQGALRASGRGSRKQKPVIDQV 126

Query: 140 AAALILQEVLD 150
           AA +ILQ  L+
Sbjct: 127 AAVIILQHALE 137


>gi|295100354|emb|CBK97899.1| conserved hypothetical protein TIGR00250 [Faecalibacterium
           prausnitzii L2-6]
          Length = 143

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 65/135 (48%), Gaps = 8/135 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHP-RPFLV---RKKVTQTALELLSFITTENIAAFIIG 74
           I ++D G  R GLA  D       P  P +    R KV     E+   I  E I   +IG
Sbjct: 3   ILAVDYGDSRTGLATCDRTEFLTSPITPQITVKARDKVAARVCEVAKEIEAELI---VIG 59

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPLNM+G+EG R   +R      ++    +P   WDER TT +A  +L +      KR  
Sbjct: 60  LPLNMDGTEGERARKSRKLAKT-VEIWSGLPVRMWDERQTTCAAADLLDESGTFGAKRKS 118

Query: 135 KVDSIAAALILQEVL 149
            +DS++A +IL + +
Sbjct: 119 ILDSVSATVILDDYI 133


>gi|115440129|ref|NP_001044344.1| Os01g0764700 [Oryza sativa Japonica Group]
 gi|57899566|dbj|BAD87145.1| unknown protein [Oryza sativa Japonica Group]
 gi|113533875|dbj|BAF06258.1| Os01g0764700 [Oryza sativa Japonica Group]
 gi|215701312|dbj|BAG92736.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 178

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 67/138 (48%), Gaps = 5/138 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGLPLN 78
            +D+G+K +GLA+SD   R A P   L R K  ++  A + ++ ++  ++A F++G P N
Sbjct: 26  GLDVGSKYVGLAVSDDKNRIALPLSVLSRTKTNISLMADDFVTLVSKYSLAGFVVGYPFN 85

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVY--VPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           + G   P     R  V  +        + + +WDE  T+   + +L  + +      + +
Sbjct: 86  LQGQSSPNALQVRLLVGELCKTGKLDDMSYTYWDENFTSKCVEALLHPLKLHDPVETKTM 145

Query: 137 -DSIAAALILQEVLDRIS 153
            D  AA  ILQ  LD ++
Sbjct: 146 TDKFAAVCILQRYLDNMN 163


>gi|291297317|ref|YP_003508715.1| Holliday junction resolvase YqgF [Meiothermus ruber DSM 1279]
 gi|290472276|gb|ADD29695.1| Holliday junction resolvase YqgF [Meiothermus ruber DSM 1279]
          Length = 136

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 66/135 (48%), Gaps = 2/135 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + ++D+G  RIGLA+ + G  +A  R +LVRK +      L +F   E    F++GLPL 
Sbjct: 3   VVALDVGEARIGLAVGEIGSPWAFGRGYLVRKNLEADLEALAAFAERERAERFVVGLPLR 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
            +G    +    +A V  M +R + +  +  DER TT   Q  L       ++   K+D 
Sbjct: 63  TDGRPSAQAERVQALVEAMRERGMQLELL--DERYTTKLGQNRLKHAPKRIRQEKGKLDE 120

Query: 139 IAAALILQEVLDRIS 153
            AA  +L+  L R+ 
Sbjct: 121 AAAIALLESYLARVG 135


>gi|145332817|ref|NP_001078274.1| DNA binding / hydrolase, acting on ester bonds / nuclease/ nucleic
           acid binding / recombinase [Arabidopsis thaliana]
 gi|26449955|dbj|BAC42098.1| unknown protein [Arabidopsis thaliana]
 gi|332645487|gb|AEE79008.1| Polynucleotidyl transferase/ ribonuclease H-like protein
           [Arabidopsis thaliana]
          Length = 170

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 72/135 (53%), Gaps = 7/135 (5%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGLPLN 78
            +D+G K +GLAISDP    A P   L+RKK  +   A +  + +   +++  ++G P  
Sbjct: 26  GLDVGDKYVGLAISDPSNMVASPLSVLLRKKSNIDLMATDFQNLVKAFSVSGLVVGYPFG 85

Query: 79  -MNGSEGPRVHSTRAFVHNM--IDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
            +N  E   V +   F+  +   ++   V + +WDERL++ + + +L  +N+   +    
Sbjct: 86  KLNNVED--VVTVNLFIEELRKTEKLKDVKYTYWDERLSSKTVELMLKPLNLHPVQEKTM 143

Query: 136 VDSIAAALILQEVLD 150
           +D +AA +ILQE LD
Sbjct: 144 LDKLAAVVILQEYLD 158


>gi|110637112|ref|YP_677319.1| Holliday junction resolvase-like protein [Cytophaga hutchinsonii
           ATCC 33406]
 gi|118597208|sp|Q11X87|RUVX_CYTH3 RecName: Full=Putative Holliday junction resolvase
 gi|110279793|gb|ABG57979.1| possible Holliday junction resolvase [Cytophaga hutchinsonii ATCC
           33406]
          Length = 152

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 72/142 (50%), Gaps = 19/142 (13%)

Query: 19  IASIDLGTKRIGLAISDPGRRFA------HPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           I + D GTKRIG+A +DP +  A      HP+  +V          L  ++ TE + AF+
Sbjct: 4   ILAFDFGTKRIGIASTDPMQIIANALDTVHPKDVVVY---------LKKYLNTEPVEAFV 54

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKV-YVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           +GLP  +   E     + +AF+ N+I +     P    DER T+  A   ++   VS+K 
Sbjct: 55  VGLPRTLQNEESSNAANVKAFI-NLIKKNFPQTPIYGVDERFTSSMAFDTMLAGGVSKKG 113

Query: 132 RIQK--VDSIAAALILQEVLDR 151
           R  K  +D I+A +ILQ  +++
Sbjct: 114 RRDKATIDKISATIILQSFMEQ 135


>gi|254881557|ref|ZP_05254267.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|254834350|gb|EET14659.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
          Length = 139

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 72/143 (50%), Gaps = 11/143 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G KR G+A++D  +  A+    L      Q    +L ++  E +   I+G P  
Sbjct: 4   ILAIDYGKKRTGVAVTDVLQIIANG---LTTVPTHQLLDFILKYVEKEPVERIIVGHPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           MN  E   + +   FV+ +  +   +P  F DER T+V A Q ++D  + +K R  K  V
Sbjct: 61  MNNQESENMRNIVPFVNQLRKKLPDIPVEFVDERFTSVLAHQAMLDGGLKKKDRQNKALV 120

Query: 137 DSIAAALILQEVLDRISFLESSK 159
           D I+A +ILQ      S+LES K
Sbjct: 121 DEISATIILQ------SYLESKK 137


>gi|39938790|ref|NP_950556.1| Hollyday junction resolvase [Onion yellows phytoplasma OY-M]
 gi|62900989|sp|Q6YQR9|RUVX_ONYPE RecName: Full=Putative Holliday junction resolvase
 gi|39721899|dbj|BAD04389.1| Hollyday junction resolvase [Onion yellows phytoplasma OY-M]
          Length = 151

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 65/140 (46%), Gaps = 1/140 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRP-FLVRKKVTQTALELLSFITTENIAAFIIG 74
           N     +DLG K +G+A+S  G    + +  F    K  +    L   I    I   ++G
Sbjct: 6   NNASLGLDLGEKTLGIALSQTGIIAQNLKTIFFATHKYDRLIAPLQEIIFQYQIKTIVLG 65

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P +MN   G +   +  F   + ++   V  + WDERL+TV A Q+L   N  + K +Q
Sbjct: 66  YPKHMNNDIGIKAKISSDFKKTLENKFEQVKVILWDERLSTVQAIQMLKTNNKKKGKILQ 125

Query: 135 KVDSIAAALILQEVLDRISF 154
             D IAA +ILQ  LD I  
Sbjct: 126 MKDEIAATIILQNYLDYIKL 145


>gi|333029958|ref|ZP_08458019.1| Holliday junction resolvase [Bacteroides coprosuis DSM 18011]
 gi|332740555|gb|EGJ71037.1| Holliday junction resolvase [Bacteroides coprosuis DSM 18011]
          Length = 139

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 71/138 (51%), Gaps = 13/138 (9%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFIT----TENIAAFIIG 74
           I +ID G KR G+A++DP +  A+          T    +L+ F+T     E++   IIG
Sbjct: 4   ILAIDYGRKRTGIAVTDPMQIIANGL-------TTVRTHDLMDFLTDYTQKESVEKIIIG 56

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP  M+ +    +     FV N   +   +P  + DER T+V AQ+ +I+  + +K R  
Sbjct: 57  LPKQMDNTPSESMKYIEPFVRNFQKKFPDMPLEYVDERFTSVIAQRTIIEAGLKKKDRQN 116

Query: 135 K--VDSIAAALILQEVLD 150
           K  VD ++A +ILQ  L+
Sbjct: 117 KALVDEVSATIILQTYLE 134


>gi|294643795|ref|ZP_06721593.1| RNAse YqgF [Bacteroides ovatus SD CC 2a]
 gi|294808455|ref|ZP_06767208.1| RNAse YqgF [Bacteroides xylanisolvens SD CC 1b]
 gi|292640884|gb|EFF59104.1| RNAse YqgF [Bacteroides ovatus SD CC 2a]
 gi|294444383|gb|EFG13097.1| RNAse YqgF [Bacteroides xylanisolvens SD CC 1b]
          Length = 141

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 72/148 (48%), Gaps = 13/148 (8%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI----TTENI 68
           + P   I +ID G KR G+A+SD  +  A+          T    ELL+FI      E +
Sbjct: 1   MYPMSRIVAIDYGRKRTGIAVSDTMQLIAN-------GLTTVPTHELLNFIGEYMAKEPV 53

Query: 69  AAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVS 128
              IIGLP  MN      + +   FV ++  R   +P  + DER T+V A + +++  + 
Sbjct: 54  ERIIIGLPKQMNNEVSENMKNIEPFVRSLNKRYPDLPVEYVDERFTSVLAHRTMLEAGLK 113

Query: 129 RKKRIQK--VDSIAAALILQEVLDRISF 154
           +K R  K  VD I+A +ILQ  L+   F
Sbjct: 114 KKDRQNKALVDEISATIILQTYLESKRF 141


>gi|29840356|ref|NP_829462.1| Holliday junction resolvase-like protein [Chlamydophila caviae
           GPIC]
 gi|33301619|sp|Q822T1|RUVX_CHLCV RecName: Full=Putative Holliday junction resolvase
 gi|29834705|gb|AAP05340.1| conserved hypothetical protein TIGR00250 [Chlamydophila caviae
           GPIC]
          Length = 163

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 70/140 (50%), Gaps = 8/140 (5%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            ID G +RIGLA +      + P   +     V  TA  L + I   +++  ++G P+ M
Sbjct: 14  GIDYGQRRIGLAYAASPLFISLPIGCIEAGNTVEATAKILFNIIQERSVSCVVLGNPIPM 73

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQKVDS 138
              +   +      + ++I     V  + WDERL++  A+++L  D  +SRKKR  K D+
Sbjct: 74  QKGQKSALQEEITKLSSLIQESCGVEVILWDERLSSAQAERMLKGDCGLSRKKRKGKTDT 133

Query: 139 IAAALILQEVLDRISFLESS 158
           IAA LIL       SFLESS
Sbjct: 134 IAATLIL------TSFLESS 147


>gi|150006542|ref|YP_001301286.1| Holliday junction resolvase-like protein [Bacteroides vulgatus ATCC
           8482]
 gi|294778839|ref|ZP_06744256.1| RNAse YqgF [Bacteroides vulgatus PC510]
 gi|319642941|ref|ZP_07997577.1| Holliday junction resolvase [Bacteroides sp. 3_1_40A]
 gi|167012694|sp|A6L7K0|RUVX_BACV8 RecName: Full=Putative Holliday junction resolvase
 gi|149934966|gb|ABR41664.1| putative endonuclease [Bacteroides vulgatus ATCC 8482]
 gi|294447292|gb|EFG15875.1| RNAse YqgF [Bacteroides vulgatus PC510]
 gi|317385489|gb|EFV66432.1| Holliday junction resolvase [Bacteroides sp. 3_1_40A]
          Length = 139

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 72/143 (50%), Gaps = 11/143 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G KR G+A++D  +  A+    L      Q    +L ++  E +   I+G P  
Sbjct: 4   ILAIDYGKKRTGVAVTDVLQIIANG---LTTVPTHQLLDFILKYVEKEPVERIIVGHPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           MN  E   + +   FV+ +  +   +P  F DER T+V A Q ++D  + +K R  K  V
Sbjct: 61  MNNQESENMRNIVPFVNQLRKKIPDIPVEFVDERFTSVLAHQAMLDGGLKKKDRQNKALV 120

Query: 137 DSIAAALILQEVLDRISFLESSK 159
           D I+A +ILQ      S+LES K
Sbjct: 121 DEISATIILQ------SYLESKK 137


>gi|304382926|ref|ZP_07365408.1| Holliday junction resolvase [Prevotella marshii DSM 16973]
 gi|304335951|gb|EFM02199.1| Holliday junction resolvase [Prevotella marshii DSM 16973]
          Length = 140

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 68/140 (48%), Gaps = 13/140 (9%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT----ENIAAFIIG 74
           I SID G KR GLA++DP +        +     T    EL  F+ T    E +   +IG
Sbjct: 6   ILSIDYGKKRTGLAVTDPLQ-------MICGGLATVPTSELFKFLQTYMEKEPVERIVIG 58

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P   NG     +   + FV+       +VP  F+DER T++ A + ++D  + +K R  
Sbjct: 59  EPKQPNGMPSENMARVQQFVNRWRKAVPHVPIEFYDERFTSLLAHKAMLDGGLKKKARRD 118

Query: 135 K--VDSIAAALILQEVLDRI 152
           K  VD I+A +ILQ  L+ I
Sbjct: 119 KALVDEISATIILQSYLESI 138


>gi|224023748|ref|ZP_03642114.1| hypothetical protein BACCOPRO_00464 [Bacteroides coprophilus DSM
           18228]
 gi|224016970|gb|EEF74982.1| hypothetical protein BACCOPRO_00464 [Bacteroides coprophilus DSM
           18228]
          Length = 142

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 69/134 (51%), Gaps = 5/134 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G KR G+A++DP +  A+    L      Q    LL ++T E++   I+G P  
Sbjct: 4   IIAIDYGRKRTGIAVTDPMQIIANG---LTTVPTHQLMDFLLKYVTQESVERIIVGHPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           MN  +   + +   F++ +  +   +P    DER T+V A Q ++   + +K R  K  V
Sbjct: 61  MNNEDSENMKNIIPFINQLKKKLPKIPVELVDERFTSVLAHQAMLAGGLKKKDRQNKALV 120

Query: 137 DSIAAALILQEVLD 150
           D I+A +ILQ  L+
Sbjct: 121 DEISATIILQSYLE 134


>gi|206900507|ref|YP_002250744.1| hypothetical protein DICTH_0881 [Dictyoglomus thermophilum H-6-12]
 gi|226725513|sp|B5YDY6|RUVX_DICT6 RecName: Full=Putative Holliday junction resolvase
 gi|206739610|gb|ACI18668.1| conserved hypothetical protein [Dictyoglomus thermophilum H-6-12]
          Length = 139

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 70/136 (51%), Gaps = 1/136 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + +ID G K +GLAISDP R  A        K        L   +    +   ++G P++
Sbjct: 3   VLAIDWGEKYVGLAISDPLRIIAQGLDVWEIKGEEDFVSRLKRLVEDYQVKEIVLGYPIS 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           + G E  R    R  +  +I+  + +P  F DERLTT+ A+++L++ ++ RKKR    + 
Sbjct: 63  LRGHENERTQKVR-HIAELIESVIGIPVKFVDERLTTMEAEKVLLEGDIKRKKRKLLKNK 121

Query: 139 IAAALILQEVLDRISF 154
            AA +ILQ+ LD  S 
Sbjct: 122 QAAVIILQKYLDSSSL 137


>gi|318057083|ref|ZP_07975806.1| Holliday junction resolvase-like protein [Streptomyces sp.
           SA3_actG]
 gi|318077855|ref|ZP_07985187.1| Holliday junction resolvase-like protein [Streptomyces sp.
           SA3_actF]
          Length = 154

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 61/130 (46%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID+G  RIG+A  DP    A P   +  + V      + + +        ++GLP ++ 
Sbjct: 8   AIDVGDARIGVASCDPDGILATPVETVPGRDVPAARRRIKALVDEYEPIELVVGLPRSLR 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EG      RAF   +      VP    DER+TTV+A Q L    V+ KK    +D  A
Sbjct: 68  GGEGSAAKKVRAFAGGLALLVAPVPVRLVDERMTTVTAGQGLRASGVNTKKGRSVIDQAA 127

Query: 141 AALILQEVLD 150
           A +ILQ  L+
Sbjct: 128 AVIILQTALE 137


>gi|260642386|ref|ZP_05415682.2| putative Holliday junction resolvase [Bacteroides finegoldii DSM
           17565]
 gi|260622253|gb|EEX45124.1| putative Holliday junction resolvase [Bacteroides finegoldii DSM
           17565]
          Length = 141

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 71/146 (48%), Gaps = 13/146 (8%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI----TTENIAA 70
           P   I +ID G KR G+A+SD  +  A+          T    ELL+FI      E +  
Sbjct: 3   PMSRIVAIDYGRKRTGIAVSDTMQLIAN-------GLTTVPTHELLNFIGDYIAKEPVER 55

Query: 71  FIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRK 130
            IIGLP  MN      + +   FV ++  R   +P  + DER T+V A + +++  + +K
Sbjct: 56  IIIGLPKQMNNEVSENMKNIEPFVRSLKKRFPELPVEYVDERFTSVLAHRTMLEAGLKKK 115

Query: 131 KRIQK--VDSIAAALILQEVLDRISF 154
            R  K  VD I+A +ILQ  L+   F
Sbjct: 116 DRQNKALVDEISATIILQTYLESKRF 141


>gi|297562015|ref|YP_003680989.1| Holliday junction resolvase YqgF [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296846463|gb|ADH68483.1| Holliday junction resolvase YqgF [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 161

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 66/138 (47%), Gaps = 9/138 (6%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D G  RIG+A SDP    A P   + R K     + LL  +        ++G P +++
Sbjct: 8   AVDPGNARIGVAASDPSGMLASPVETIRRGKGDTQRIALL--VLERQAREVVVGYPASLS 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQ-QILIDMNVSRK------KRI 133
           G EGP   S R F   +      VP    DERLTTV+AQ Q+L   + + K       R 
Sbjct: 66  GEEGPAARSARDFARTLAALLHPVPVRLVDERLTTVTAQSQLLSGASFAAKGAKGGRARR 125

Query: 134 QKVDSIAAALILQEVLDR 151
             +D  AA ++LQ  LD+
Sbjct: 126 SVIDQAAATVLLQSALDQ 143


>gi|282858812|ref|ZP_06267957.1| RNAse YqgF [Prevotella bivia JCVIHMP010]
 gi|282588381|gb|EFB93541.1| RNAse YqgF [Prevotella bivia JCVIHMP010]
          Length = 139

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 68/134 (50%), Gaps = 6/134 (4%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G KR G+A++DP R  A+    L     ++    L+++I +E +   +IG P+ 
Sbjct: 4   ILAIDYGKKRTGIAVTDPLRIIANG---LATVPTSELYDYLVAYIRSEAVDKIVIGKPIQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--- 135
            NG           F +     +  +P  F+DER T+V A Q +I   V +K R +    
Sbjct: 61  ANGQPSENFVRVEQFANRWKKVQPTIPIEFYDERFTSVIAHQAMIVGGVKKKTRREDKGL 120

Query: 136 VDSIAAALILQEVL 149
           VD I+A +ILQ+ +
Sbjct: 121 VDEISATIILQDFM 134


>gi|254445960|ref|ZP_05059436.1| conserved hypothetical protein TIGR00250 [Verrucomicrobiae
           bacterium DG1235]
 gi|198260268|gb|EDY84576.1| conserved hypothetical protein TIGR00250 [Verrucomicrobiae
           bacterium DG1235]
          Length = 149

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 66/132 (50%), Gaps = 4/132 (3%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            +D G +R+G+A  D  G   A P   +V+    +    L+          F+ G P NM
Sbjct: 5   GVDYGERRVGVAFGDDIG--VATPLQAIVKATEEERIQALVDLARERRATDFVFGYPYNM 62

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           NGS G +     AF+  ++ + + +P    DERLT+V A +          +R  K+DS+
Sbjct: 63  NGSVGFKAKEVDAFIDKLL-KAIDLPVHRLDERLTSVEASKAFPKKRDDELRRSGKIDSV 121

Query: 140 AAALILQEVLDR 151
           AA+LILQ+ L++
Sbjct: 122 AASLILQDYLNQ 133


>gi|186680854|ref|YP_001864050.1| Holliday junction resolvase-like protein [Nostoc punctiforme PCC
           73102]
 gi|186463306|gb|ACC79107.1| Holliday junction resolvase YqgF [Nostoc punctiforme PCC 73102]
          Length = 158

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 67/137 (48%), Gaps = 1/137 (0%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
           KP      +D G KRIG+A  D     A     + R    Q   ++   +    +   ++
Sbjct: 8   KPFISALGLDFGRKRIGVAGCDRTGLIATGITTIERTSFEQDVEQIRQIVNEREVQILVM 67

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP +M+GS G +    + F   +  + + +P  + DERLT+  A+Q+LI  N S  +  
Sbjct: 68  GLPYSMDGSIGFQARQVQKFTTRL-SKALKLPVEYVDERLTSFQAEQLLIAENRSPSRHK 126

Query: 134 QKVDSIAAALILQEVLD 150
             +D  AAALILQ+ LD
Sbjct: 127 GLIDRKAAALILQQWLD 143


>gi|152002556|dbj|BAF73580.1| predicted endonuclease [Onion yellows phytoplasma OY-W]
          Length = 151

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 65/140 (46%), Gaps = 1/140 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRP-FLVRKKVTQTALELLSFITTENIAAFIIG 74
           N     +DLG K +G+A+S  G      +  F    K  +    L   I+   I   ++G
Sbjct: 6   NNASLGLDLGEKTLGIALSQTGIIAQKLKTIFFATHKYDRLIAPLQEIISQYQIKTIVLG 65

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P +MN   G +   +  F   + ++   V  + WDERL+TV A Q+L   N  + + +Q
Sbjct: 66  YPKHMNNDIGIKAKISSDFKKTLENKFEQVKVILWDERLSTVQAIQMLKTNNKKKGQILQ 125

Query: 135 KVDSIAAALILQEVLDRISF 154
             D IAA +ILQ  LD I  
Sbjct: 126 MKDEIAATIILQNYLDYIKL 145


>gi|300088456|ref|YP_003758978.1| Holliday junction resolvase YqgF [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299528189|gb|ADJ26657.1| Holliday junction resolvase YqgF [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 143

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 68/134 (50%), Gaps = 3/134 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +D+G K +G+A+SDP    A P   L R      A  ++  +   + A  +IGLP  
Sbjct: 5   VIGLDVGDKWVGVALSDPMGVIARPLTILERCDEITDAEAVVRLVGEHDAARVVIGLPRL 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI--QKV 136
           +NG  G +    + F   +      VP +F DER +T SA+ I+      RK     ++ 
Sbjct: 65  LNGVVGTQAERVQYFARRLAS-LTDVPVIFQDERFSTASAKDIMKSNRRYRKGFYSRERD 123

Query: 137 DSIAAALILQEVLD 150
           D++AAA+ILQ+ LD
Sbjct: 124 DAVAAAVILQDWLD 137


>gi|325298806|ref|YP_004258723.1| Holliday junction resolvase [Bacteroides salanitronis DSM 18170]
 gi|324318359|gb|ADY36250.1| Holliday junction resolvase [Bacteroides salanitronis DSM 18170]
          Length = 139

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 71/144 (49%), Gaps = 11/144 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G KR G+A++DP +  A     L      Q    LL ++  E +   IIG P  
Sbjct: 4   ILAIDYGKKRTGIAVTDPMQVIASG---LTTVPTHQLMDFLLGYVRQEAVERIIIGHPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           MN  +   +     F++ +  +   +P   +DER T+V A Q ++   + +K R  K  V
Sbjct: 61  MNNEDSENMKRIVPFMNQLKKKLPDMPVELYDERFTSVLAHQAMLAGGLKKKDRQNKALV 120

Query: 137 DSIAAALILQEVLDRISFLESSKG 160
           D I+A +ILQ      S+LE+ +G
Sbjct: 121 DEISATIILQ------SYLEAKRG 138


>gi|73748006|ref|YP_307245.1| hypothetical protein cbdb_A67 [Dehalococcoides sp. CBDB1]
 gi|147668700|ref|YP_001213518.1| Holliday junction resolvase YqgF [Dehalococcoides sp. BAV1]
 gi|289432003|ref|YP_003461876.1| Holliday junction resolvase YqgF [Dehalococcoides sp. GT]
 gi|146325568|sp|Q3ZWC2|RUVX_DEHSC RecName: Full=Putative Holliday junction resolvase
 gi|73659722|emb|CAI82329.1| conserved hypothetical protein [Dehalococcoides sp. CBDB1]
 gi|146269648|gb|ABQ16640.1| Holliday junction resolvase YqgF [Dehalococcoides sp. BAV1]
 gi|288945723|gb|ADC73420.1| Holliday junction resolvase YqgF [Dehalococcoides sp. GT]
          Length = 133

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 72/130 (55%), Gaps = 3/130 (2%)

Query: 24  LGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMNGSE 83
           +G K IG A+SDP R  A P   L R   T+T   + S + T      IIGLP+++NG+ 
Sbjct: 1   MGDKWIGAALSDPLRILASPLVILRRDDDTKTLENIESLVKTHQPDLLIIGLPISLNGTI 60

Query: 84  GPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAAL 143
           GP+    ++F   ++ R + +  ++ DER +T  A++ + D    +  +  + D+ AAA+
Sbjct: 61  GPQAEKVKSFSE-LLSRHLNIEIIYRDERFSTDEARRKMNDS--GKNNKTVRDDAAAAAV 117

Query: 144 ILQEVLDRIS 153
           ILQ+ LD  +
Sbjct: 118 ILQDYLDETN 127


>gi|294056021|ref|YP_003549679.1| Holliday junction resolvase YqgF [Coraliomargarita akajimensis DSM
           45221]
 gi|293615354|gb|ADE55509.1| Holliday junction resolvase YqgF [Coraliomargarita akajimensis DSM
           45221]
          Length = 153

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 68/131 (51%), Gaps = 4/131 (3%)

Query: 21  SIDLGTKRIGLAISDP-GRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            ID G KRIGLA +D  G     P    V KK     +E +  I    +   ++G PLNM
Sbjct: 5   GIDWGEKRIGLAFADEVGIALPLPAAVAVSKKERMRHIEQM--IQERRVRELVVGYPLNM 62

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +GS G +     AF+  + +++  +P    DERL++ S +Q L        ++  ++DS 
Sbjct: 63  DGSVGFKAKEVDAFIEEL-EKRFRLPVSRIDERLSSHSVEQGLRGQKKKPDRKSGEIDSR 121

Query: 140 AAALILQEVLD 150
           AAALILQ+ ++
Sbjct: 122 AAALILQDFIE 132


>gi|254423308|ref|ZP_05037026.1| conserved hypothetical protein TIGR00250 [Synechococcus sp. PCC
           7335]
 gi|196190797|gb|EDX85761.1| conserved hypothetical protein TIGR00250 [Synechococcus sp. PCC
           7335]
          Length = 144

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 65/130 (50%), Gaps = 1/130 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +DLG KRIG+A  D     A     L +       + L + I   ++   ++GLP  M+
Sbjct: 6   GLDLGAKRIGVAGCDRTGLIATGLTTLYKTSFESIIVPLETLIQARSVEVLVVGLPYTMD 65

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G  G +    + F H +  + + +P  F DERLT+  A+Q+L+    S     + +D  A
Sbjct: 66  GQIGFQAKKIQKFAHRL-SKVLGLPVEFVDERLTSFQAEQMLLAERRSLTNCKELIDRKA 124

Query: 141 AALILQEVLD 150
           AA+ILQ+ LD
Sbjct: 125 AAIILQQWLD 134


>gi|304373321|ref|YP_003856530.1| Holliday junction resolvase, putative [Mycoplasma hyorhinis HUB-1]
 gi|304309512|gb|ADM21992.1| Holliday junction resolvase, putative [Mycoplasma hyorhinis HUB-1]
 gi|330723802|gb|AEC46172.1| Holliday junction resolvase, putative [Mycoplasma hyorhinis MCLD]
          Length = 137

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 68/135 (50%), Gaps = 3/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELL-SFITTENIAAFIIGLP 76
           I ++DLG+K  G AISD  R  + P   F  ++   +  +E L  +     I   +IG P
Sbjct: 4   IIALDLGSKSCGFAISDALRITSQPLENFQFKEHKLELVIEKLKDYFEKYEIELVLIGYP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           L+M  ++         FV N+      +P    DER TT  A  I+I+  +SR+KR +  
Sbjct: 64  LSMQLNQTKSSKRVDYFV-NLFKTHFDIPIKLVDERQTTKKAHSIMIEQGLSRQKRKKNK 122

Query: 137 DSIAAALILQEVLDR 151
           D +AA LIL + L++
Sbjct: 123 DKLAAQLILDDYLNQ 137


>gi|315503217|ref|YP_004082104.1| holliday junction resolvase yqgf [Micromonospora sp. L5]
 gi|315409836|gb|ADU07953.1| Holliday junction resolvase YqgF [Micromonospora sp. L5]
          Length = 153

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 61/136 (44%), Gaps = 6/136 (4%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRK------KVTQTALELLSFITTENIAAFIIG 74
            +D+G  R+G+A  DP    A P   L R        V     EL+           ++G
Sbjct: 11  GVDVGQVRVGVARCDPHGILATPLVTLARDLTAEPDAVPADMAELVRLAAEHEAVGIVVG 70

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP+N+ G  GP   +  A+   + D    +P    DER++TV A + L +  V  K++  
Sbjct: 71  LPVNLAGKHGPAALNVSAYASRLADVMRPIPVTLTDERMSTVVASRRLAERGVRGKRQRA 130

Query: 135 KVDSIAAALILQEVLD 150
            VD  AA  ILQ  LD
Sbjct: 131 VVDQAAAVEILQSWLD 146


>gi|302866802|ref|YP_003835439.1| Holliday junction resolvase YqgF [Micromonospora aurantiaca ATCC
           27029]
 gi|302569661|gb|ADL45863.1| Holliday junction resolvase YqgF [Micromonospora aurantiaca ATCC
           27029]
          Length = 153

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 61/136 (44%), Gaps = 6/136 (4%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRK------KVTQTALELLSFITTENIAAFIIG 74
            +D+G  R+G+A  DP    A P   L R        V     EL+           ++G
Sbjct: 11  GVDVGQVRVGVARCDPHGILATPLVTLARDLTAEPDAVPADMAELVRLAAEHEAVGIVVG 70

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP+N+ G  GP   +  A+   + D    +P    DER++TV A + L +  V  K++  
Sbjct: 71  LPVNLAGKHGPAALNVSAYASRLADVMRPIPVTLTDERMSTVVASRRLAERGVRGKRQRA 130

Query: 135 KVDSIAAALILQEVLD 150
            VD  AA  ILQ  LD
Sbjct: 131 VVDQAAAVEILQSWLD 146


>gi|237716075|ref|ZP_04546556.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262407687|ref|ZP_06084235.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|298480835|ref|ZP_06999030.1| Holliday junction resolvase [Bacteroides sp. D22]
 gi|229443722|gb|EEO49513.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262354495|gb|EEZ03587.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|298272858|gb|EFI14424.1| Holliday junction resolvase [Bacteroides sp. D22]
          Length = 138

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 70/142 (49%), Gaps = 13/142 (9%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI----TTENIAAFIIG 74
           I +ID G KR G+A+SD  +  A+          T    ELL+FI      E +   IIG
Sbjct: 4   IVAIDYGRKRTGIAVSDTMQLIAN-------GLTTVPTHELLNFIGEYMAKEPVERIIIG 56

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP  MN      + +   FV ++  R   +P  + DER T+V A + +++  + +K R  
Sbjct: 57  LPKQMNNEVSENMKNIEPFVRSLKKRYPDLPVEYVDERFTSVLAHRTMLEAGLKKKDRQN 116

Query: 135 K--VDSIAAALILQEVLDRISF 154
           K  VD I+A +ILQ  L+   F
Sbjct: 117 KALVDEISATIILQTYLESKRF 138


>gi|198275232|ref|ZP_03207763.1| hypothetical protein BACPLE_01391 [Bacteroides plebeius DSM 17135]
 gi|198271815|gb|EDY96085.1| hypothetical protein BACPLE_01391 [Bacteroides plebeius DSM 17135]
          Length = 138

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 71/143 (49%), Gaps = 11/143 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G KR G+A++DP +  A+    L      +    LL ++  E +   ++G P  
Sbjct: 4   ILAIDYGRKRTGIAVTDPMQIIANG---LTTVPTHELMDFLLKYVAQEKVERIVVGHPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           MN  +   +   + FV  +  +   +P    DER T+V A Q ++D  + +K R  K  V
Sbjct: 61  MNNEDSENMKYIKPFVAQLKKKLPDMPVELVDERFTSVLAHQAMLDGGLKKKARQDKALV 120

Query: 137 DSIAAALILQEVLDRISFLESSK 159
           D I+A +ILQ      S+LES +
Sbjct: 121 DEISATIILQ------SYLESRR 137


>gi|298384714|ref|ZP_06994274.1| Holliday junction resolvase [Bacteroides sp. 1_1_14]
 gi|298262993|gb|EFI05857.1| Holliday junction resolvase [Bacteroides sp. 1_1_14]
          Length = 138

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 70/142 (49%), Gaps = 13/142 (9%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI----TTENIAAFIIG 74
           I +ID G KR G+A+SD  +  A+          T    ELL+FI      E +   IIG
Sbjct: 4   IVAIDYGRKRTGIAVSDTLQLIANGL-------TTVPTHELLNFIGEYVAKEPVERIIIG 56

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP  MN      + +   FV ++  R   +P  + DER T+V A + +++  + +K R  
Sbjct: 57  LPKQMNNEASENMKNIEPFVRSLKKRFPELPVEYVDERFTSVLAHRTMLEAGLKKKDRQN 116

Query: 135 K--VDSIAAALILQEVLDRISF 154
           K  VD I+A +ILQ  L+   F
Sbjct: 117 KALVDEISATIILQTYLESKRF 138


>gi|239939939|ref|ZP_04691876.1| hypothetical protein SrosN15_02984 [Streptomyces roseosporus NRRL
           15998]
 gi|239986423|ref|ZP_04707087.1| hypothetical protein SrosN1_03861 [Streptomyces roseosporus NRRL
           11379]
 gi|291443370|ref|ZP_06582760.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
 gi|291346317|gb|EFE73221.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
          Length = 157

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 58/130 (44%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  RIG+A  DP    A P   +  + V      L   +        I+GLP ++ 
Sbjct: 11  AVDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLRQIVEEYEPIEVILGLPRSLG 70

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     R F          VP    DER+TTV+A Q +    V  KK    +D  A
Sbjct: 71  GGEGPAAAKVRDFAQVFARSIAPVPVRLVDERMTTVTAAQGMRASGVKSKKGRSVIDQAA 130

Query: 141 AALILQEVLD 150
           A +ILQ  L+
Sbjct: 131 AVVILQNALE 140


>gi|225426409|ref|XP_002269986.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 169

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 72/139 (51%), Gaps = 5/139 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGLP 76
           +  +D+G K +GLA+SD   + A P   L+RKK  +   A +  S I+  ++A FI+G P
Sbjct: 24  LLGLDVGDKYVGLAVSDLHNKIASPLSVLLRKKSNIDLMATDFQSLISDLSLAGFIVGYP 83

Query: 77  LNMNGSEGPRVHSTRAFVHNMI--DRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            N   S  P   + + F+ ++    +   V + +WDE  T+ + + +L  +N+   +   
Sbjct: 84  FNRQRSS-PTAVNVKVFIDDLCKTGKLEGVRYTYWDECFTSKNVELLLKPLNLHPVQSKT 142

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D  AA  ILQ  LD ++
Sbjct: 143 ILDKFAAVGILQGYLDHVN 161


>gi|324999313|ref|ZP_08120425.1| Holliday junction resolvase-like protein [Pseudonocardia sp. P1]
          Length = 142

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 66/132 (50%), Gaps = 2/132 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLNM 79
            +D+G  R+G+A+ DP    A P   + R       +  ++ +  E ++   ++GLP N+
Sbjct: 10  GVDVGAVRVGVAMCDPDGILATPVETVPRDAEHGADVRRIAELVAEHDVVGVVLGLPRNL 69

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
            G +GP   + R F  + +   + VP    DER+TTV A + L    V  +K+   VD  
Sbjct: 70  RGEDGPAARAAREFA-DALQAGLDVPVELTDERMTTVVAARQLSGRGVKGRKQRSVVDQA 128

Query: 140 AAALILQEVLDR 151
           AA  ILQ  LD+
Sbjct: 129 AAVQILQGWLDQ 140


>gi|237722140|ref|ZP_04552621.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|260170793|ref|ZP_05757205.1| Holliday junction resolvase-like protein [Bacteroides sp. D2]
 gi|299149163|ref|ZP_07042224.1| putative Holliday junction resolvase [Bacteroides sp. 3_1_23]
 gi|315919127|ref|ZP_07915367.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|229447950|gb|EEO53741.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|298512830|gb|EFI36718.1| putative Holliday junction resolvase [Bacteroides sp. 3_1_23]
 gi|313693002|gb|EFS29837.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 138

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 70/142 (49%), Gaps = 13/142 (9%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI----TTENIAAFIIG 74
           I +ID G KR G+A+SD  +  A+          T    ELL+FI      E +   IIG
Sbjct: 4   IVAIDYGRKRTGIAVSDTMQLIANGL-------TTVPTHELLNFIGEYIAKEPVERIIIG 56

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP  MN      + +   FV ++  R   +P  + DER T+V A + +++  + +K R  
Sbjct: 57  LPKQMNNEVSENMKNIEPFVRSLKKRYPDLPVEYVDERFTSVLAHRTMLEAGLKKKDRQN 116

Query: 135 K--VDSIAAALILQEVLDRISF 154
           K  VD I+A +ILQ  L+   F
Sbjct: 117 KALVDEISATIILQTYLESKRF 138


>gi|270293966|ref|ZP_06200168.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270275433|gb|EFA21293.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 141

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 73/141 (51%), Gaps = 7/141 (4%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G KR G+A+SD  +  A+    +   ++ Q    LL ++  E +   ++G P  
Sbjct: 4   IIAIDYGRKRTGIAVSDTLQMIANGLTTVPTHQLLQF---LLDYVAKEPVERILVGFPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           MN      + +   FV ++  +   +P  + DER T+V A + +++  + +K R  K  V
Sbjct: 61  MNNEASENMKNIEPFVRSLKKKLPDMPVEYVDERFTSVLAHRTMLEAGLKKKDRQNKALV 120

Query: 137 DSIAAALILQEVLD--RISFL 155
           D I+A +ILQ  L+  R SFL
Sbjct: 121 DEISATIILQTYLENKRFSFL 141


>gi|29345829|ref|NP_809332.1| Holliday junction resolvase-like protein [Bacteroides
           thetaiotaomicron VPI-5482]
 gi|253567815|ref|ZP_04845226.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|32130022|sp|Q8AAP5|RUVX_BACTN RecName: Full=Putative Holliday junction resolvase
 gi|29337722|gb|AAO75526.1| putative endonuclease [Bacteroides thetaiotaomicron VPI-5482]
 gi|251841888|gb|EES69968.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 138

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 70/142 (49%), Gaps = 13/142 (9%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI----TTENIAAFIIG 74
           I +ID G KR G+A+SD  +  A+          T    ELL+FI      E +   IIG
Sbjct: 4   IVAIDYGRKRTGIAVSDTLQLIAN-------GLTTVPTHELLNFIGGYVAKEPVERIIIG 56

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP  MN      + +   FV ++  R   +P  + DER T+V A + +++  + +K R  
Sbjct: 57  LPKQMNNEASENMKNIEPFVRSLKKRFPELPVEYVDERFTSVLAHRTMLEAGLKKKDRQN 116

Query: 135 K--VDSIAAALILQEVLDRISF 154
           K  VD I+A +ILQ  L+   F
Sbjct: 117 KALVDEISATIILQTYLESKRF 138


>gi|160883801|ref|ZP_02064804.1| hypothetical protein BACOVA_01773 [Bacteroides ovatus ATCC 8483]
 gi|156110886|gb|EDO12631.1| hypothetical protein BACOVA_01773 [Bacteroides ovatus ATCC 8483]
          Length = 138

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 70/142 (49%), Gaps = 13/142 (9%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI----TTENIAAFIIG 74
           I +ID G KR G+A+SD  +  A+          T    ELL+FI      E +   IIG
Sbjct: 4   IVAIDYGRKRTGIAVSDTMQLIAN-------GLTTVPTHELLNFIGEYIAKEPVERIIIG 56

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP  MN      + +   FV ++  R   +P  + DER T+V A + +++  + +K R  
Sbjct: 57  LPKQMNNELSENMKNIEPFVRSLKKRYPDLPVEYVDERFTSVLAHRTMLEAGLKKKDRQN 116

Query: 135 K--VDSIAAALILQEVLDRISF 154
           K  VD I+A +ILQ  L+   F
Sbjct: 117 KALVDEISATIILQTYLESKRF 138


>gi|260494134|ref|ZP_05814265.1| DNA integration/recombination/invertion protein [Fusobacterium sp.
           3_1_33]
 gi|260198280|gb|EEW95796.1| DNA integration/recombination/invertion protein [Fusobacterium sp.
           3_1_33]
          Length = 147

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 79/145 (54%), Gaps = 10/145 (6%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII-GLPLNM 79
           ++D+G  RIG+A SD     A P   + RKKV   +++ ++ I  EN    I+ G+P ++
Sbjct: 6   ALDIGDVRIGVAKSDIMGIIASPLETINRKKVK--SVKRIAEICKENDTNLIVVGIPKSL 63

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVS---RKKRIQKV 136
           +G E  +    R ++  +      +  +  DER +TV A  IL ++N +    K+++  V
Sbjct: 64  DGEEKRQAEKVREYIKKLKKEIENLEIIEVDERFSTVIADNILKELNKNGAIEKRKV--V 121

Query: 137 DSIAAALILQEVLD--RISFLESSK 159
           D +AA++ILQ  LD  ++ FLE  K
Sbjct: 122 DKVAASIILQTYLDMKKLKFLEEGK 146


>gi|328955591|ref|YP_004372924.1| Holliday junction resolvase YqgF [Coriobacterium glomerans PW2]
 gi|328455915|gb|AEB07109.1| Holliday junction resolvase YqgF [Coriobacterium glomerans PW2]
          Length = 140

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 63/131 (48%), Gaps = 1/131 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           +ID+G  R G+A+SD   R A P   L   +V   A      +        + G PL + 
Sbjct: 5   AIDIGEVRCGIAVSDATGRVALPVKVLPAIEVVSLARSFRDVLAEYEPEMLVCGSPLTLA 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G  GP+    RA     I     +P  F DER+++  A++IL +   + ++   K+D IA
Sbjct: 65  GELGPQAERIRAEAEA-IGSAADLPVAFVDERMSSREAKRILRERGCTEREMRGKLDMIA 123

Query: 141 AALILQEVLDR 151
           A+L LQ  LDR
Sbjct: 124 ASLFLQTWLDR 134


>gi|85711782|ref|ZP_01042838.1| Holliday junction resolvase-like protein [Idiomarina baltica OS145]
 gi|85694397|gb|EAQ32339.1| Holliday junction resolvase-like protein [Idiomarina baltica OS145]
          Length = 135

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 68/137 (49%), Gaps = 13/137 (9%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQ------TALELLSFITTENIAAFI 72
           +   D GTK IG+A+   G+        L   K         T  +LL     E +   +
Sbjct: 3   VVGFDFGTKSIGVAV---GQSITGTASILKALKAQDGIPNWSTVEQLLKEWQPERV---V 56

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLPLNM+G+E P     + F  N I  +  VP VF DERLT+ +A++ L + +  R   
Sbjct: 57  VGLPLNMDGTEQPLTQRAKKF-GNRIHGRFNVPVVFQDERLTSTAAREALFERDGYRGLE 115

Query: 133 IQKVDSIAAALILQEVL 149
             KVDS AA LI+++ L
Sbjct: 116 KGKVDSAAALLIVEDYL 132


>gi|313115011|ref|ZP_07800503.1| conserved hypothetical protein TIGR00250 [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310622665|gb|EFQ06128.1| conserved hypothetical protein TIGR00250 [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 191

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 66/135 (48%), Gaps = 8/135 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAH---PRPFL-VRKKVTQTALELLSFITTENIAAFIIG 74
           I ++D G  R GLA  D          P+  L  R KV     E+   I  E I   +IG
Sbjct: 51  ILAVDYGDSRTGLATCDRTEFLTTAITPQITLKARNKVAARVCEVAKEIGAELI---VIG 107

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPLNM+G+EG R   +R      ++    +P   WDER TT +A  IL +      KR +
Sbjct: 108 LPLNMDGTEGERAIKSRKLAKT-VEIWSGLPVRMWDERQTTCAAADILDESGTFGTKRKE 166

Query: 135 KVDSIAAALILQEVL 149
            +DS++A +IL + L
Sbjct: 167 ILDSVSATVILDDYL 181


>gi|294673343|ref|YP_003573959.1| hypothetical protein PRU_0590 [Prevotella ruminicola 23]
 gi|294472451|gb|ADE81840.1| conserved hypothetical protein TIGR00250 [Prevotella ruminicola 23]
          Length = 137

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 67/133 (50%), Gaps = 5/133 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I SID G KR GLA++DP +  A     L     ++    L ++I  E +   +IG P  
Sbjct: 4   ILSIDYGKKRTGLAVTDPLQIIAGG---LATVATSELFDFLKAYIAREQVEMIVIGEPRQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
            NG     +   + FV+        VP  ++DER T+V A Q ++D  + +K R  K  V
Sbjct: 61  PNGEPSENLARVQQFVNRWRKAVPEVPIQYYDERFTSVLAHQAMLDGGLKKKARQNKGLV 120

Query: 137 DSIAAALILQEVL 149
           D I+A +IL++ +
Sbjct: 121 DEISATIILEDFM 133


>gi|326780492|ref|ZP_08239757.1| Holliday junction resolvase YqgF [Streptomyces cf. griseus
           XylebKG-1]
 gi|326660825|gb|EGE45671.1| Holliday junction resolvase YqgF [Streptomyces cf. griseus
           XylebKG-1]
          Length = 154

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 58/130 (44%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  RIG+A  DP    A P   +  + V      L   +        ++GLP ++ 
Sbjct: 8   AVDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLRQIVDEYEPIEVVLGLPRSLG 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     R F          VP    DER+TTV+A Q +    V  KK    +D  A
Sbjct: 68  GGEGPAAAKVREFAQVFARSIAPVPVRLVDERMTTVTAAQGMRASGVKSKKGRSVIDQAA 127

Query: 141 AALILQEVLD 150
           A +ILQ  L+
Sbjct: 128 AVVILQNALE 137


>gi|238897811|ref|YP_002923490.1| Holliday junction resolvase-like protein [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
 gi|229465568|gb|ACQ67342.1| Holliday junction resolvase-like protein [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 145

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 62/128 (48%), Gaps = 1/128 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I + D GTK IG+AI       A P      K  T   +++   ++       ++G PLN
Sbjct: 6   IIAFDFGTKSIGVAIGQNITETARPLTACKSKNGTPDWIKIERLLSEWYPDLVVVGFPLN 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+G+E P   S R F H +  R+  +  VF DERL+T  A+  L D    +      VD+
Sbjct: 66  MDGTEQPITESARQFGHALY-RRFGIKVVFHDERLSTAEARAYLFDKGGYQALNKSSVDA 124

Query: 139 IAAALILQ 146
            +A +IL+
Sbjct: 125 TSAVIILE 132


>gi|182439828|ref|YP_001827547.1| hypothetical protein SGR_6035 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178468344|dbj|BAG22864.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 161

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 58/130 (44%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  RIG+A  DP    A P   +  + V      L   +        ++GLP ++ 
Sbjct: 15  AVDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLRQIVDEYEPIEVVLGLPRSLG 74

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EGP     R F          VP    DER+TTV+A Q +    V  KK    +D  A
Sbjct: 75  GGEGPAAAKVREFAQVFARSIAPVPVRLVDERMTTVTAAQGMRASGVKSKKGRSVIDQAA 134

Query: 141 AALILQEVLD 150
           A +ILQ  L+
Sbjct: 135 AVVILQNALE 144


>gi|152994576|ref|YP_001339411.1| Holliday junction resolvase YqgF [Marinomonas sp. MWYL1]
 gi|150835500|gb|ABR69476.1| Holliday junction resolvase YqgF [Marinomonas sp. MWYL1]
          Length = 156

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 69/147 (46%), Gaps = 3/147 (2%)

Query: 2   SILLIEDLVKSLKPN--QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALEL 59
           SI     L  + KPN  + +   D GT RIG+AI       A P   L  K+      E+
Sbjct: 4   SISTGTSLDDNQKPNTVRSVLGFDFGTTRIGVAIGQSITGTAQPLDPLKAKEGIPNWDEI 63

Query: 60  LSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQ 119
              +      AF++GLPL+M+GSE       R F   +  R   +P+   DERL++  A+
Sbjct: 64  TRIVEEWKPDAFVVGLPLDMDGSENEMCQRARKFAKRLHGR-FNLPYHMMDERLSSYEAK 122

Query: 120 QILIDMNVSRKKRIQKVDSIAAALILQ 146
             +I    +R  +   VD +AA +IL+
Sbjct: 123 GQVIARGGNRNFKENSVDGLAAQMILE 149


>gi|163782351|ref|ZP_02177349.1| hypothetical protein HG1285_06175 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882384|gb|EDP75890.1| hypothetical protein HG1285_06175 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 132

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 68/131 (51%), Gaps = 4/131 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID GTKR+GLAI D     A P+  L         +E    + ++ +   ++GLPL 
Sbjct: 3   IIAIDFGTKRVGLAIGDTDLGIAVPKGVLRNDANLLDRIE--DIVRSKGVKKVVVGLPLT 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
            +G EG R    R F   +  R   V    WDER +T+ A+  L D+   R++ +  +D+
Sbjct: 61  PSGREGERAKLVREFAEALRKRLKDVDIELWDERYSTMEAESRLRDLPPRRRREV--LDA 118

Query: 139 IAAALILQEVL 149
           I+A +IL+E L
Sbjct: 119 ISAQIILEEYL 129


>gi|58698540|ref|ZP_00373442.1| conserved hypothetical protein TIGR00250 [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225629964|ref|YP_002726755.1| putative holliday junction resolvase [Wolbachia sp. wRi]
 gi|254767533|sp|C0R5C2|RUVX_WOLWR RecName: Full=Putative Holliday junction resolvase
 gi|58534956|gb|EAL59053.1| conserved hypothetical protein TIGR00250 [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225591945|gb|ACN94964.1| putative holliday junction resolvase [Wolbachia sp. wRi]
          Length = 155

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 83/153 (54%), Gaps = 7/153 (4%)

Query: 7   EDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE 66
           ++ +KS+  ++ I  +D+G K+IG+A SD  +  A       RK +++  L  L  I  E
Sbjct: 7   DEFLKSIPKDKRIMCLDMGEKQIGIAFSDKTQLIATAHSIYHRKNMSKD-LGYLHRIFKE 65

Query: 67  NIA-AFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL--I 123
           N A + +IG+PLN++  E     +   F + +I +K  V     DE L+T  A   L   
Sbjct: 66  NEAGSMVIGIPLNIDEQETKWCKTIIQFANKII-KKYKVNTYLQDESLSTSIATHTLKIT 124

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLDRISFLE 156
            +++++ K+I   D I+A +ILQ  LD+I+ ++
Sbjct: 125 GISITKSKKID--DKISACIILQRTLDKINTIK 155


>gi|237744282|ref|ZP_04574763.1| DNA integration/recombination/invertion protein [Fusobacterium sp.
           7_1]
 gi|229431511|gb|EEO41723.1| DNA integration/recombination/invertion protein [Fusobacterium sp.
           7_1]
          Length = 147

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 79/145 (54%), Gaps = 10/145 (6%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII-GLPLNM 79
           ++D+G  RIG+A SD     A P   + RKKV   +++ ++ I  EN    I+ G+P ++
Sbjct: 6   ALDIGDVRIGVARSDIMGIIASPLETINRKKVK--SVKRIAEICKENDTNLIVVGIPKSL 63

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVS---RKKRIQKV 136
           +G E  +    R ++  +      +  +  DER +TV A  IL ++N +    K+++  V
Sbjct: 64  DGEEKRQAEKVREYIEKLKKEIENLEIIEVDERFSTVIADNILKELNKNGAIEKRKV--V 121

Query: 137 DSIAAALILQEVLD--RISFLESSK 159
           D +AA++ILQ  LD  ++ FLE  K
Sbjct: 122 DKVAASIILQTYLDMKKLKFLEEGK 146


>gi|89091932|ref|ZP_01164887.1| Holliday junction resolvase-like protein [Oceanospirillum sp.
           MED92]
 gi|89083667|gb|EAR62884.1| Holliday junction resolvase-like protein [Oceanospirillum sp.
           MED92]
          Length = 158

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 63/135 (46%), Gaps = 2/135 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           NQ +A  D GT+RIG+A        A P   L+ K       E+   I+     A ++G+
Sbjct: 6   NQALA-FDFGTRRIGVASGQSVTGTASPLTPLIAKDGIPNWDEISKLISEWQPDALVVGI 64

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLN +G+     H  R F  N +  +   P    DERL+T  A++I      S   R + 
Sbjct: 65  PLNADGTISDMAHRARKFA-NRLHERYKTPCFLMDERLSTAEAKEIHFASGGSDNFREES 123

Query: 136 VDSIAAALILQEVLD 150
           VD IAA LIL+   +
Sbjct: 124 VDGIAAQLILESWFN 138


>gi|297624148|ref|YP_003705582.1| Holliday junction resolvase YqgF [Truepera radiovictrix DSM 17093]
 gi|297165328|gb|ADI15039.1| Holliday junction resolvase YqgF [Truepera radiovictrix DSM 17093]
          Length = 154

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 68/136 (50%), Gaps = 4/136 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           ++ + ++D+G +RIG+A  + G  FA  R  + R+ +      + +    E  A  ++GL
Sbjct: 2   SEVVLALDVGERRIGVARGEVGSPFAFGRGVIARRSLRADVAAVRALADAEGAARVVVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P  + G +  +    RAF   +  +   +  VF DER T+  A Q L+   + R +R +K
Sbjct: 62  PRRLRGGDSAQTSRVRAFAAQL--QAAGLEVVFEDERFTSRIATQSLVKSGLKRGQRQEK 119

Query: 136 --VDSIAAALILQEVL 149
             VD  AA LIL+  L
Sbjct: 120 GRVDEGAAVLILETYL 135


>gi|282877696|ref|ZP_06286511.1| RNAse YqgF [Prevotella buccalis ATCC 35310]
 gi|281300268|gb|EFA92622.1| RNAse YqgF [Prevotella buccalis ATCC 35310]
          Length = 138

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 71/144 (49%), Gaps = 13/144 (9%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLPL 77
           I SID G KR G+A++DP +  A+    +     T T  + L  ++  E +   +IG P+
Sbjct: 3   ILSIDYGKKRTGIAVTDPLQIIANGLATVS----TSTLFDYLKDYVAREEVERIVIGKPM 58

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK-- 135
             NG     +     FV+        +P  ++DER T+V A + ++   + +K R  K  
Sbjct: 59  QTNGKPSENMARVEQFVNRWRKAMPQIPIEYYDERFTSVLAHKAMLASGIGKKARQNKAL 118

Query: 136 VDSIAAALILQEVLDRISFLESSK 159
           VD I+A +ILQ      S++ES +
Sbjct: 119 VDEISATIILQ------SYMESKR 136


>gi|256027954|ref|ZP_05441788.1| DNA integration/recombination/invertion protein [Fusobacterium sp.
           D11]
 gi|289765899|ref|ZP_06525277.1| DNA integration/recombination/inversion protein [Fusobacterium sp.
           D11]
 gi|289717454|gb|EFD81466.1| DNA integration/recombination/inversion protein [Fusobacterium sp.
           D11]
          Length = 147

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 76/144 (52%), Gaps = 8/144 (5%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
           ++D+G  RIG+A SD     A P   + RKKV ++A  +       +    ++G+P +++
Sbjct: 6   ALDIGDVRIGVAKSDIMGIIASPLETINRKKV-KSAKRIAEICKENDTNLIVVGIPKSLD 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVS---RKKRIQKVD 137
           G E  +    R ++  +      +  +  DER +TV A  IL ++N +    K+++  VD
Sbjct: 65  GEEKRQAEKVREYIKKLKKEIENLEIIEVDERFSTVIADNILKELNKNGAIEKRKV--VD 122

Query: 138 SIAAALILQEVLD--RISFLESSK 159
            +AA++ILQ  LD  ++ FLE  K
Sbjct: 123 KVAASIILQTYLDMKKLKFLEEGK 146


>gi|312131456|ref|YP_003998796.1| holliday junction resolvase yqgf [Leadbetterella byssophila DSM
           17132]
 gi|311908002|gb|ADQ18443.1| Holliday junction resolvase YqgF [Leadbetterella byssophila DSM
           17132]
          Length = 140

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 65/133 (48%), Gaps = 5/133 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G  R GLA++DP +  A     L   K  Q    L  +I  E + A ++GLPL+
Sbjct: 4   ILAIDYGKVRTGLAVTDPLQIIATA---LETVKTDQLINYLERYIQNEEVDALVLGLPLS 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           +   + P     R+F   + D+   +P  F DER T+  A   LI   V +K R  K   
Sbjct: 61  LRSEDTPTTTMVRSFGEVLKDKFPDLPLHFIDERFTSKMASDTLISSGVKKKDRKVKGNT 120

Query: 137 DSIAAALILQEVL 149
           D I+A +ILQ  L
Sbjct: 121 DLISAVIILQSYL 133


>gi|327312426|ref|YP_004327863.1| RNAse H domain-containing protein, YqgF family [Prevotella
           denticola F0289]
 gi|326944800|gb|AEA20685.1| RNAse H domain protein, YqgF family [Prevotella denticola F0289]
          Length = 139

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 68/135 (50%), Gaps = 8/135 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLPL 77
           I +ID G KR GLA++DP R  A+    +     T    + L+ +I TE +   +IG P+
Sbjct: 4   ILAIDYGKKRTGLAVTDPLRIIANGLATVA----TSGLFDFLTQYIGTETVEQLVIGRPV 59

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK-- 135
             +G     +     FV+        +P  ++DER T+V A Q +I   V +K R +   
Sbjct: 60  QPDGRPSENLGRVEQFVNRWRKAHPELPVDYYDERFTSVIAHQAMIAGGVKKKTRRENKG 119

Query: 136 -VDSIAAALILQEVL 149
            VD I+A +ILQ+ +
Sbjct: 120 LVDEISATIILQDYM 134


>gi|293372829|ref|ZP_06619207.1| RNAse YqgF [Bacteroides ovatus SD CMC 3f]
 gi|292632204|gb|EFF50804.1| RNAse YqgF [Bacteroides ovatus SD CMC 3f]
          Length = 141

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/150 (32%), Positives = 74/150 (49%), Gaps = 17/150 (11%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI----TTENI 68
           + P   I +ID G KR G+A+SD  +  A+          T    ELL+FI      E +
Sbjct: 1   MYPMSRIVAIDYGRKRTGIAVSDTMQLIAN-------GLTTVPTHELLNFIGEYIAKEPV 53

Query: 69  AAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVY--VPFVFWDERLTTVSAQQILIDMN 126
              IIGLP  MN      + +   FV ++  +K Y  +P  + DER T+V A + +++  
Sbjct: 54  ERIIIGLPKQMNNEVSENMKNIEPFVRSL--KKCYPDLPVEYVDERFTSVLAHRTMLEAG 111

Query: 127 VSRKKRIQK--VDSIAAALILQEVLDRISF 154
           + +K R  K  VD I+A +ILQ  L+   F
Sbjct: 112 LKKKDRQNKALVDEISATIILQTYLESKRF 141


>gi|89890525|ref|ZP_01202035.1| endonuclease involved in recombination repair [Flavobacteria
           bacterium BBFL7]
 gi|89517440|gb|EAS20097.1| endonuclease involved in recombination repair [Flavobacteria
           bacterium BBFL7]
          Length = 139

 Score = 64.7 bits (156), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 70/137 (51%), Gaps = 5/137 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G KR G+A++DP +  A     L      + ++ L  ++ TE++   +IG P  
Sbjct: 4   ILAIDYGKKRTGIAVTDPMQIIASG---LTTVATHELSVFLEKYLNTEDVETIVIGEPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           M+ ++        AF   + ++   +     DER T+  A Q +ID  +S+ KR  K  V
Sbjct: 61  MDYTDSELGGVINAFAKALQEKYPAITIERVDERFTSKMAFQTMIDSGLSKSKRRNKALV 120

Query: 137 DSIAAALILQEVLDRIS 153
           D IAA +ILQ  +DR S
Sbjct: 121 DEIAATIILQTYMDRKS 137


>gi|163785970|ref|ZP_02180418.1| Holliday junction resolvase-like protein [Flavobacteriales
           bacterium ALC-1]
 gi|159877830|gb|EDP71886.1| Holliday junction resolvase-like protein [Flavobacteriales
           bacterium ALC-1]
          Length = 137

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 70/133 (52%), Gaps = 5/133 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID GTKR GLA++D  +  A     +  K++      L +++ TE++  F++GLP  
Sbjct: 4   ILAIDYGTKRTGLAVTDEMQIIASGLTTVETKELVPF---LKNYVDTESVEKFVVGLPKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           M+ +        + F+  +     ++P    DER T+  A Q +ID  + +K+R  K  +
Sbjct: 61  MDNTASESEVYIKKFLEILTKAIPHIPIERVDERFTSKMAFQTMIDSGLKKKQRQNKALI 120

Query: 137 DSIAAALILQEVL 149
           D I+A LILQ  L
Sbjct: 121 DEISATLILQSYL 133


>gi|326382144|ref|ZP_08203836.1| Holliday junction resolvase-like protein [Gordonia neofelifaecis
           NRRL B-59395]
 gi|326198874|gb|EGD56056.1| Holliday junction resolvase-like protein [Gordonia neofelifaecis
           NRRL B-59395]
          Length = 142

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 66/138 (47%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           ++P     +ID+G+ R+G+A+ DP    A P   + R K       ++  IT  +    +
Sbjct: 2   IEPRGRRIAIDVGSVRVGVAVCDPDGILATPVETVRRSKDGADVARIVDLITEYDAVGVV 61

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           IGLP  + G EGP V + R F   +      V   F+DERLTTV+A   L    V  K  
Sbjct: 62  IGLPRTLRGEEGPAVRAARYFGRQLASEAEGVSIEFYDERLTTVTATTALRASGVKAKDA 121

Query: 133 IQKVDSIAAALILQEVLD 150
              +D  AA  ILQ  LD
Sbjct: 122 RAVIDQAAAVAILQGWLD 139


>gi|256820223|ref|YP_003141502.1| Holliday junction resolvase YqgF [Capnocytophaga ochracea DSM 7271]
 gi|256581806|gb|ACU92941.1| Holliday junction resolvase YqgF [Capnocytophaga ochracea DSM 7271]
          Length = 143

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 66/132 (50%), Gaps = 7/132 (5%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL-SFITTENIAAFIIGLPLNM 79
           +ID GTKR G+A++DP +  A     +     T T L  L  +   E + AF+IG P  M
Sbjct: 5   AIDYGTKRTGIAVTDPLQIIASGLCTVE----TSTLLAFLKQYTAEEAVEAFVIGQPKRM 60

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--VD 137
           N  +       + F+  +      +P    DER T+  A Q +ID  + +K+R  K  +D
Sbjct: 61  NSEDSSVEAEIQKFISKLQQEFPEIPIHRQDERFTSKLAFQTMIDSGLKKKQRQNKALID 120

Query: 138 SIAAALILQEVL 149
            I+A +ILQE L
Sbjct: 121 EISATIILQEFL 132


>gi|298243731|ref|ZP_06967538.1| Holliday junction resolvase YqgF [Ktedonobacter racemifer DSM
           44963]
 gi|297556785|gb|EFH90649.1| Holliday junction resolvase YqgF [Ktedonobacter racemifer DSM
           44963]
          Length = 162

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 72/148 (48%), Gaps = 22/148 (14%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
           ++D+G  RIG+A  D     A P   + V +   QT   +   I   +    +IGLP+++
Sbjct: 8   ALDVGEARIGVAACDATGFLASPYTTIYVTRDEAQTWDAIERLIAETDAEGLVIGLPVSL 67

Query: 80  NG---SEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI--- 133
           +G   ++G R+    AFV  +    + VP  FWDERL+TV A+++       + K     
Sbjct: 68  DGQIHAQGERI---MAFVERL-KAHIAVPVTFWDERLSTVEAERLRTQQGGRKSKHTGGR 123

Query: 134 -----------QKVDSIAAALILQEVLD 150
                       ++D++AAA+ LQE LD
Sbjct: 124 QHSQGKRRRPGHEIDALAAAVFLQEYLD 151


>gi|329724707|gb|EGG61213.1| RNAse H domain protein, YqgF family [Staphylococcus epidermidis
           VCU144]
          Length = 123

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 64/119 (53%), Gaps = 4/119 (3%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL---ELLSFITTENIAAFII 73
             I  +D+G+K +G+AISD     A     L R    Q  L   +L+  I    +   +I
Sbjct: 4   HKILGLDVGSKTVGIAISDLMGWTAQGLDTL-RINEEQDDLGIDQLVKIIKDNQVGTVVI 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           GLP NMN S G R  ++  +   + +    +  V WDERL+T++A++ L++ +VSR+KR
Sbjct: 63  GLPKNMNNSIGFRGEASIKYKEKLQESIPSIDIVMWDERLSTMAAERSLLEADVSRQKR 121


>gi|325851999|ref|ZP_08171082.1| RNAse H domain protein, YqgF family [Prevotella denticola CRIS
           18C-A]
 gi|325484555|gb|EGC87471.1| RNAse H domain protein, YqgF family [Prevotella denticola CRIS
           18C-A]
          Length = 139

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 68/135 (50%), Gaps = 8/135 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGLPL 77
           I +ID G KR GLA++DP R  A+    +     T    + L+ +I TE +   +IG P+
Sbjct: 4   ILAIDYGKKRTGLAVTDPLRIIANGLATVA----TSGLFDFLTQYIETETVERLVIGRPV 59

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK-- 135
             +G     +     FV+        +P  ++DER T+V A Q +I   V +K R +   
Sbjct: 60  QPDGRPSENLGRVEQFVNRWRKAHPELPVDYYDERFTSVIAHQAMIAGGVKKKTRRENKG 119

Query: 136 -VDSIAAALILQEVL 149
            VD I+A +ILQ+ +
Sbjct: 120 LVDEISATIILQDYM 134


>gi|224053911|ref|XP_002298037.1| predicted protein [Populus trichocarpa]
 gi|222845295|gb|EEE82842.1| predicted protein [Populus trichocarpa]
          Length = 170

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 79/156 (50%), Gaps = 10/156 (6%)

Query: 5   LIEDLVKSLKPNQP-IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLS 61
           L  +L+K+   NQ     +D+G K +GLA+SDP  + A P   L+RKK  +   A +  S
Sbjct: 9   LFHELLKTSAINQGRFLGLDVGDKYVGLAVSDPLNKIASPLSVLLRKKSNIELMATDFQS 68

Query: 62  FITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMI--DRKVYVPFVFWDERLTTVSAQ 119
            I+  ++  FI+G P +      P     + FV ++    +   V F +WDE  T+ + +
Sbjct: 69  LISELSLGGFIVGYPFDRQRG-APDAVRVKLFVDDLCKTGKLEGVKFTYWDECFTSKNVE 127

Query: 120 QIL--IDMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
            ++  +D++    K I  +D  AA  ILQ  LD ++
Sbjct: 128 LLVKPLDLHPVHAKSI--MDKFAAVGILQGYLDYVN 161


>gi|330466939|ref|YP_004404682.1| holliday junction resolvase yqgf [Verrucosispora maris AB-18-032]
 gi|328809910|gb|AEB44082.1| holliday junction resolvase yqgf [Verrucosispora maris AB-18-032]
          Length = 152

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 67/136 (49%), Gaps = 6/136 (4%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKK------VTQTALELLSFITTENIAAFIIG 74
            +D+G  RIG++ SDP    A P   + R++      V +  +E+ + +        ++G
Sbjct: 11  GVDVGQVRIGVSRSDPHGVLATPLVTVAREQKPRPDAVPKDLVEIAALVVEHEAVEVVVG 70

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP+N+ G  GP     +A+   + +    VP    DER++TV A + L +  V  KK+  
Sbjct: 71  LPVNLAGRHGPAAEHVKAYARQLAEVIAPVPVTLTDERMSTVVASRRLAERGVRGKKQRA 130

Query: 135 KVDSIAAALILQEVLD 150
            VD  AA  ILQ  LD
Sbjct: 131 VVDQAAAVEILQSWLD 146


>gi|16752801|ref|NP_445069.1| Holliday junction resolvase-like protein [Chlamydophila pneumoniae
           AR39]
 gi|7189439|gb|AAF38349.1| conserved hypothetical protein [Chlamydophila pneumoniae AR39]
          Length = 154

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 69/143 (48%), Gaps = 4/143 (2%)

Query: 14  KPNQPIA--SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIAA 70
           KP+   A   ID G KRIGLA +        P   +   K +  +A  L   I + NI  
Sbjct: 6   KPSSCKAYLGIDYGKKRIGLAYAAEPLLLTLPIGNIEAGKNLKLSAEALHKIILSRNITC 65

Query: 71  FIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSR 129
            ++G PL M       +    + +   + +   V  + WDERL++V A+++L  D  +SR
Sbjct: 66  VVLGNPLPMQKGLYSSLQEEVSLLAEELKKLSTVEIILWDERLSSVQAERMLKQDCGLSR 125

Query: 130 KKRIQKVDSIAAALILQEVLDRI 152
           K R  K DS+AA LIL   LD +
Sbjct: 126 KDRKGKTDSLAATLILTSFLDSL 148


>gi|15618161|ref|NP_224446.1| Holliday junction resolvase-like protein [Chlamydophila pneumoniae
           CWL029]
 gi|15835772|ref|NP_300296.1| Holliday junction resolvase-like protein [Chlamydophila pneumoniae
           J138]
 gi|33241578|ref|NP_876519.1| Holliday junction resolvase-like protein [Chlamydophila pneumoniae
           TW-183]
 gi|6226490|sp|Q9Z8U7|RUVX_CHLPN RecName: Full=Putative Holliday junction resolvase
 gi|4376511|gb|AAD18390.1| YggF Family hypothetical protein [Chlamydophila pneumoniae CWL029]
 gi|8978610|dbj|BAA98447.1| YggF family hypothetical protein [Chlamydophila pneumoniae J138]
 gi|33236086|gb|AAP98176.1| hypothetical protein CpB0243 [Chlamydophila pneumoniae TW-183]
 gi|269303113|gb|ACZ33213.1| conserved hypothetical protein TIGR00250 [Chlamydophila pneumoniae
           LPCoLN]
          Length = 151

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 69/143 (48%), Gaps = 4/143 (2%)

Query: 14  KPNQPIA--SIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENIAA 70
           KP+   A   ID G KRIGLA +        P   +   K +  +A  L   I + NI  
Sbjct: 3   KPSSCKAYLGIDYGKKRIGLAYAAEPLLLTLPIGNIEAGKNLKLSAEALHKIILSRNITC 62

Query: 71  FIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSR 129
            ++G PL M       +    + +   + +   V  + WDERL++V A+++L  D  +SR
Sbjct: 63  VVLGNPLPMQKGLYSSLQEEVSLLAEELKKLSTVEIILWDERLSSVQAERMLKQDCGLSR 122

Query: 130 KKRIQKVDSIAAALILQEVLDRI 152
           K R  K DS+AA LIL   LD +
Sbjct: 123 KDRKGKTDSLAATLILTSFLDSL 145


>gi|297742527|emb|CBI34676.3| unnamed protein product [Vitis vinifera]
          Length = 224

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 71/137 (51%), Gaps = 5/137 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGLPLN 78
            +D+G K +GLA+SD   + A P   L+RKK  +   A +  S I+  ++A FI+G P N
Sbjct: 81  GLDVGDKYVGLAVSDLHNKIASPLSVLLRKKSNIDLMATDFQSLISDLSLAGFIVGYPFN 140

Query: 79  MNGSEGPRVHSTRAFVHNMID--RKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
              S  P   + + F+ ++    +   V + +WDE  T+ + + +L  +N+   +    +
Sbjct: 141 RQRSS-PTAVNVKVFIDDLCKTGKLEGVRYTYWDECFTSKNVELLLKPLNLHPVQSKTIL 199

Query: 137 DSIAAALILQEVLDRIS 153
           D  AA  ILQ  LD ++
Sbjct: 200 DKFAAVGILQGYLDHVN 216


>gi|311113672|ref|YP_003984894.1| Holliday junction resolvase YqgF [Rothia dentocariosa ATCC 17931]
 gi|310945166|gb|ADP41460.1| Holliday junction resolvase YqgF [Rothia dentocariosa ATCC 17931]
          Length = 175

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 66/146 (45%), Gaps = 6/146 (4%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL-SFITTENIAAFIIGLPLNM 79
            +D+G  R+G ++SDP    A P   L R     +   +L   +   ++    +GLP  M
Sbjct: 2   GVDVGNARVGTSLSDPDGILATPLKTLRRDSKKNSDRRVLRKLVEVNDVKEIFVGLPKTM 61

Query: 80  NGSEGPRVHSTRAFVHNM---IDRKVYVPFVFW--DERLTTVSAQQILIDMNVSRKKRIQ 134
            G E       R + H +   +D +       W  DERLTTVSA + L +  VS +    
Sbjct: 62  RGGESDSTRMARDYAHALRSELDAEGNTHINIWLVDERLTTVSAHRSLHEAGVSSRNFKT 121

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            VD +AA  ILQ  LD +   ++  G
Sbjct: 122 MVDQVAAVNILQYSLDALKAGQAVAG 147


>gi|126662043|ref|ZP_01733042.1| Holliday junction resolvase-like protein [Flavobacteria bacterium
           BAL38]
 gi|126625422|gb|EAZ96111.1| Holliday junction resolvase-like protein [Flavobacteria bacterium
           BAL38]
          Length = 137

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 69/134 (51%), Gaps = 7/134 (5%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL-SFITTENIAAFIIGLPL 77
           I +ID G KR G+A++D  +  A    F +    ++TA+  L  + + E + + IIG P 
Sbjct: 4   ILAIDYGIKRTGIAVTDEMQMIA----FGLTTIPSETAITFLKDYFSKEKVESVIIGEPK 59

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK-- 135
            MNG          AFV    +    +P    DER T+  A Q +ID  +++K+R  K  
Sbjct: 60  QMNGEPSQSTDIINAFVVKFQEAFPEMPLNRVDERFTSKMAFQTMIDSGLNKKQRQNKAL 119

Query: 136 VDSIAAALILQEVL 149
           VD IAA +ILQ+ L
Sbjct: 120 VDEIAATIILQDYL 133


>gi|300741579|ref|ZP_07071600.1| putative Holliday junction resolvase [Rothia dentocariosa M567]
 gi|300380764|gb|EFJ77326.1| putative Holliday junction resolvase [Rothia dentocariosa M567]
          Length = 184

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 66/146 (45%), Gaps = 6/146 (4%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL-SFITTENIAAFIIGLPLNM 79
            +D+G  R+G ++SDP    A P   L R     +   +L   +   ++    +GLP  M
Sbjct: 11  GVDVGNARVGTSLSDPDGILATPLKTLRRDSKKNSDRRVLRKLVEVNDVKEIFVGLPKTM 70

Query: 80  NGSEGPRVHSTRAFVHNM---IDRKVYVPFVFW--DERLTTVSAQQILIDMNVSRKKRIQ 134
            G E       R + H +   +D +       W  DERLTTVSA + L +  VS +    
Sbjct: 71  RGGESDSTRMARDYAHALRSELDAEGNTHINIWLVDERLTTVSAHRSLHEAGVSSRNFKT 130

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            VD +AA  ILQ  LD +   ++  G
Sbjct: 131 MVDQVAAVNILQYSLDALKAGQAVAG 156


>gi|46581473|ref|YP_012281.1| hypothetical protein DVU3070 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601357|ref|YP_965757.1| Holliday junction resolvase YqgF [Desulfovibrio vulgaris DP4]
 gi|62900991|sp|Q726N6|RUVX_DESVH RecName: Full=Putative Holliday junction resolvase
 gi|167012717|sp|A1VA64|RUVX_DESVV RecName: Full=Putative Holliday junction resolvase
 gi|46450895|gb|AAS97541.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120561586|gb|ABM27330.1| Holliday junction resolvase YqgF [Desulfovibrio vulgaris DP4]
 gi|311235125|gb|ADP87979.1| Holliday junction resolvase YqgF [Desulfovibrio vulgaris RCH1]
          Length = 142

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 60/129 (46%), Gaps = 1/129 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            ID G +R G+A++D G R A PR  +         +ELL  +  E   AF++GLP    
Sbjct: 5   GIDYGQRRTGIAVTDAGGRMAFPRRTIAMTTRDAFFVELLGMVEVECPDAFVVGLPRLPG 64

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G E       R FV  +  R+  +P  F  E L++  A+  L D  +  ++    VD  A
Sbjct: 65  GEETLTTRQVRNFVERL-KRRTTLPVYFMPEELSSFEAEDDLRDAGLRGRRLEAVVDQQA 123

Query: 141 AALILQEVL 149
           A  IL+  L
Sbjct: 124 AVRILESFL 132


>gi|228472378|ref|ZP_04057143.1| conserved hypothetical protein [Capnocytophaga gingivalis ATCC
           33624]
 gi|228276246|gb|EEK14981.1| conserved hypothetical protein [Capnocytophaga gingivalis ATCC
           33624]
          Length = 135

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 66/133 (49%), Gaps = 5/133 (3%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID GTKR G+A++D  +  A     L   + T+    L  +   E +   I+GLP  
Sbjct: 3   ILAIDYGTKRCGIAVTDELKLIASA---LATVETTELLDFLEKYCQAEQVERIIVGLPKQ 59

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           ++G       +   F+  + ++   +P   +DER T+  A  IL+     +KKR  K  +
Sbjct: 60  VSGELSESEQAIAPFIEKLQEKLPKIPVSRYDERFTSKIASHILVQSGTKKKKRQDKALL 119

Query: 137 DSIAAALILQEVL 149
           D I+A LILQ+ L
Sbjct: 120 DRISATLILQDYL 132


>gi|15835074|ref|NP_296833.1| Holliday junction resolvase-like protein [Chlamydia muridarum Nigg]
 gi|14195475|sp|Q9PKK9|RUVX_CHLMU RecName: Full=Putative Holliday junction resolvase
 gi|7190501|gb|AAF39309.1| conserved hypothetical protein [Chlamydia muridarum Nigg]
          Length = 148

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 67/143 (46%), Gaps = 2/143 (1%)

Query: 10  VKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFL-VRKKVTQTALELLSFITTENI 68
           + S+K  +    +D G KRIGLA +        P   +     +  TA  L++ I    +
Sbjct: 1   MNSMKQKEAFLGVDYGKKRIGLAFASAPLLITLPIGSINTCSSLALTAQALITIIKERAV 60

Query: 69  AAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNV 127
              + G PL M  S    V S    +  ++     +  + WDERL++  A+++L  D  +
Sbjct: 61  TTVVFGNPLPMQKSYASSVQSEIQELAALVRDMTSLEVILWDERLSSAQAERMLKNDCGL 120

Query: 128 SRKKRIQKVDSIAAALILQEVLD 150
           SRK+R    DS+AA LIL   LD
Sbjct: 121 SRKQRKNSSDSLAATLILSSFLD 143


>gi|229827984|ref|ZP_04454053.1| hypothetical protein GCWU000342_00032 [Shuttleworthia satelles DSM
           14600]
 gi|229792578|gb|EEP28692.1| hypothetical protein GCWU000342_00032 [Shuttleworthia satelles DSM
           14600]
          Length = 147

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 4/135 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGL 75
           I ++D G K +G+A +D     A     + RK   K+ +T   +        I   ++GL
Sbjct: 10  IMALDYGAKTVGVACTDSLGLTAQAVETVWRKRENKLRKTLARIDQIARDREIRLILVGL 69

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P+NM+ SEG R    R F  + + ++  +    +DERL+T+ A +IL    V   KR + 
Sbjct: 70  PVNMDDSEGERAGMARDFA-DQVAQRTGIAVEMYDERLSTIEADEILGKSGVPVGKRKRH 128

Query: 136 VDSIAAALILQEVLD 150
           +D ++A LIL+  L+
Sbjct: 129 LDELSAQLILERYLE 143


>gi|226951815|ref|ZP_03822279.1| Holliday junction resolvase [Acinetobacter sp. ATCC 27244]
 gi|226837355|gb|EEH69738.1| Holliday junction resolvase [Acinetobacter sp. ATCC 27244]
          Length = 147

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 63/134 (47%), Gaps = 1/134 (0%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           L P Q I + D GT+++G+AI       A+P P    K       +LL  +       FI
Sbjct: 4   LNPPQSIMAFDFGTQKMGMAIGQSSIESANPLPLFSMKDGIPDWNQLLKIVKEWQPNLFI 63

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLPLNM+ SE       R F   +  +     ++  DERLTT  A++ L       + +
Sbjct: 64  VGLPLNMDDSESELSARARKFARRLRHQTNITTWMV-DERLTTREAREELEFYQSKGQAK 122

Query: 133 IQKVDSIAAALILQ 146
               DS AAAL++Q
Sbjct: 123 RLSADSFAAALLIQ 136


>gi|315225648|ref|ZP_07867456.1| Holliday junction resolvase [Capnocytophaga ochracea F0287]
 gi|314944375|gb|EFS96416.1| Holliday junction resolvase [Capnocytophaga ochracea F0287]
          Length = 143

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 66/132 (50%), Gaps = 7/132 (5%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL-SFITTENIAAFIIGLPLNM 79
           +ID GTKR G+A++DP +  A     +     T T L  L  +   E + AF+IG P  M
Sbjct: 5   AIDYGTKRTGIAVTDPLQIIASGLCTVE----TPTLLAFLKQYTAEEAVEAFVIGQPKRM 60

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--VD 137
           N  +       + F+  +      +P    DER T+  A Q +ID  + +K+R  K  +D
Sbjct: 61  NSEDSSVEAEIQKFISKLQQEFPEIPIHRQDERFTSKLAFQTMIDSGLKKKQRQNKALID 120

Query: 138 SIAAALILQEVL 149
            I+A +ILQE L
Sbjct: 121 EISATIILQEFL 132


>gi|226226072|ref|YP_002760178.1| putative Holliday junction resolvase [Gemmatimonas aurantiaca T-27]
 gi|226089263|dbj|BAH37708.1| putative Holliday junction resolvase [Gemmatimonas aurantiaca T-27]
          Length = 168

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 66/130 (50%), Gaps = 2/130 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL-ELLSFITTENIAAFIIGLPLNM 79
           ++D G KRIGLA+SD     A P   + R+   +  + E++       ++ +I GLPL+ 
Sbjct: 10  AVDWGDKRIGLAVSDELGMLASPAGVIARRAGKRPPIAEIMRQAEALGVSGYIFGLPLDP 69

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
            G E  R    R     +  R+  +P    DER TT +A + + +   S + R   VD++
Sbjct: 70  GGDETDRSREVREVAGKLATRQ-PLPVRLVDERFTTSAALRSIREQGGSTRGRKGDVDAL 128

Query: 140 AAALILQEVL 149
           AA ++L+ VL
Sbjct: 129 AACVLLEGVL 138


>gi|269218534|ref|ZP_06162388.1| putative Holliday junction resolvase [Actinomyces sp. oral taxon
           848 str. F0332]
 gi|269211645|gb|EEZ77985.1| putative Holliday junction resolvase [Actinomyces sp. oral taxon
           848 str. F0332]
          Length = 156

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 65/129 (50%), Gaps = 4/129 (3%)

Query: 23  DLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIA-AFIIGLPLNMNG 81
           D+G  RIG+A  DP    A P   L R    ++ ++  + I  +  A   I+GLPLNM+G
Sbjct: 10  DVGQVRIGVAQCDPEGILATPVETLWRG---ESDIDDAAQIVRDCEAMEVIVGLPLNMDG 66

Query: 82  SEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAA 141
           +EG      RA+   + +     P    DERL+TV+A   LI    + +K+   VD  AA
Sbjct: 67  TEGASARDARAWAAKLAESVAPAPVRLVDERLSTVTAHGQLIAAGRNSRKQRSIVDQAAA 126

Query: 142 ALILQEVLD 150
            +IL   L+
Sbjct: 127 VVILNTALE 135


>gi|330444557|ref|YP_004377543.1| hypothetical protein G5S_0903 [Chlamydophila pecorum E58]
 gi|328807667|gb|AEB41840.1| conserved hypothetical protein TIGR00250 [Chlamydophila pecorum
           E58]
          Length = 146

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 67/134 (50%), Gaps = 2/134 (1%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLNM 79
            +D G KR+GLA +      + P   + R K     +  L  I  E +++  I+G P+ M
Sbjct: 12  GVDYGLKRVGLACASAPLFLSVPIGTVERGKNLDVIVTTLRKIIVERHVSCVILGNPIPM 71

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQKVDS 138
            G++   +    A     +     +  + WDERL++  A+++L  D  +SRK+R  K D+
Sbjct: 72  YGNQVSALQEEIAIFAKKLKEATCIEVILWDERLSSAQAERMLKHDCGLSRKQRKGKTDT 131

Query: 139 IAAALILQEVLDRI 152
           +AA LIL   L+R 
Sbjct: 132 LAATLILSSFLERC 145


>gi|37926502|pdb|1IV0|A Chain A, Solution Structure Of The Yqgf-Family Protein (N-Terminal
           Fragment)
          Length = 98

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 2/97 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + ++D+G  RIGLA+ + G   A  R +LVRK + +    LL F+  E +   ++GLPL 
Sbjct: 3   VGALDVGEARIGLAVGEEGVPLASGRGYLVRKTLEEDVEALLDFVRREGLGKLVVGLPLR 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTT 115
            +  E  +       V  +  R V V    WDER TT
Sbjct: 63  TDLKESAQAGKVLPLVEALRARGVEVE--LWDERFTT 97


>gi|118617375|ref|YP_905707.1| Holliday junction resolvase-like protein [Mycobacterium ulcerans
           Agy99]
 gi|183982184|ref|YP_001850475.1| hypothetical protein MMAR_2171 [Mycobacterium marinum M]
 gi|167012739|sp|A0PPG7|RUVX_MYCUA RecName: Full=Putative Holliday junction resolvase
 gi|226731630|sp|B2HNC2|RUVX_MYCMM RecName: Full=Putative Holliday junction resolvase
 gi|118569485|gb|ABL04236.1| conserved hypothetical protein [Mycobacterium ulcerans Agy99]
 gi|183175510|gb|ACC40620.1| conserved hypothetical protein [Mycobacterium marinum M]
          Length = 170

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 62/139 (44%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            ID+GT RIG+A SDP    A P   + R++  +    L + +        I+GLP  + 
Sbjct: 29  GIDVGTVRIGVASSDPDGILATPLETVRRERSGKHLRRLATLVGETEAVEVIVGLPRTLA 88

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
              G            +  R   +P    DERLTTVSAQ+ L +  V  K +   +D  A
Sbjct: 89  DRIGSSAQDAIDLADELAARVAPIPVRLADERLTTVSAQRSLREAGVRAKNQRAVIDQAA 148

Query: 141 AALILQEVLDRISFLESSK 159
           A  ILQ  LD+   L   +
Sbjct: 149 AVAILQAWLDQRRTLAGGR 167


>gi|260591630|ref|ZP_05857088.1| putative Holliday junction resolvase [Prevotella veroralis F0319]
 gi|260536430|gb|EEX19047.1| putative Holliday junction resolvase [Prevotella veroralis F0319]
          Length = 139

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (48%), Gaps = 6/134 (4%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G KR GLA++DP R  A+    L     +     L  ++  E +   +IG P+ 
Sbjct: 4   ILAIDYGKKRTGLAVTDPLRIIAN---GLATIPTSDIFDYLTQYVAKEPVDQLVIGKPIQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--- 135
            NG     +     FV+        +P  ++DER T+V A Q +I   V +K R +    
Sbjct: 61  PNGQPSENLARVENFVNRWRKLHPEMPIDYYDERFTSVIAHQAMIAGGVKKKTRREDKGL 120

Query: 136 VDSIAAALILQEVL 149
           VD I+A +ILQ+ +
Sbjct: 121 VDEISATIILQDYM 134


>gi|22299872|ref|NP_683119.1| Holliday junction resolvase-like protein [Thermosynechococcus
           elongatus BP-1]
 gi|32130026|sp|Q8DGI8|RUVX_THEEB RecName: Full=Putative Holliday junction resolvase
 gi|22296057|dbj|BAC09881.1| tll2329 [Thermosynechococcus elongatus BP-1]
          Length = 151

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 62/132 (46%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +DLG KRIG+A  D   + A     + R+       +L        +   I+GLP  
Sbjct: 4   VLGLDLGRKRIGVAGCDRLGQLATGITTIYRRNFASDVAQLRRICQERGVEKLIVGLPYT 63

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           ++G  G +    +      I   + +P  + DERLT+  A++IL     S +     VD 
Sbjct: 64  LDGQLGSQARQVQHLAEK-IGAALNLPVEYIDERLTSFQAEEILKQRRRSPRHHKDLVDQ 122

Query: 139 IAAALILQEVLD 150
           IAAALILQ+ LD
Sbjct: 123 IAAALILQQWLD 134


>gi|126657653|ref|ZP_01728808.1| Holliday junction resolvase-like protein [Cyanothece sp. CCY0110]
 gi|126621109|gb|EAZ91823.1| Holliday junction resolvase-like protein [Cyanothece sp. CCY0110]
          Length = 143

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 65/131 (49%), Gaps = 1/131 (0%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+G KRIG+A  D     A     + R+   Q   +L + +T       +IGLP +M+
Sbjct: 8   GLDVGKKRIGVAGCDGTGLIATGLTTIERQSFPQDVQQLQTLVTEREAQLLVIGLPYSMD 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           GS G +    + F    I + + +P  + DERLT+V A+  L       +     VD +A
Sbjct: 68  GSIGFQAKQVQKFAKR-ISKALELPVEYIDERLTSVEAETKLKAQKKYSRHNKGLVDRLA 126

Query: 141 AALILQEVLDR 151
           A +ILQ+ LD+
Sbjct: 127 ATIILQQWLDQ 137


>gi|269114906|ref|YP_003302669.1| Putative holliday junction resolvase [Mycoplasma hominis]
 gi|268322531|emb|CAX37266.1| Putative Holliday junction resolvase [Mycoplasma hominis ATCC
           23114]
          Length = 144

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 74/146 (50%), Gaps = 15/146 (10%)

Query: 19  IASIDLGTKRIGLAISDPGR---------RFAHPRPFLVRKKVTQTALELLSFITTE-NI 68
           I ++DLGTK  G AISDP           RF      LV +KV    L  L+    + +I
Sbjct: 3   ILALDLGTKSCGFAISDPNNIIASGLENFRFELNHFNLVIEKV----LHYLNKSEYQGSI 58

Query: 69  AAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVS 128
              ++G PL M+ S+  R +    F   +  + V +P VF DER +T+ AQ+IL     +
Sbjct: 59  GTIVLGYPLRMDLSKSQRTYMVERFGERL-KKVVDIPVVFQDERQSTIGAQEILQSAGWN 117

Query: 129 RKKRIQKVDSIAAALILQEVLDRISF 154
            KK   K DS+AA LIL++ L  I +
Sbjct: 118 TKKSKSKKDSLAAQLILEDYLKGIKY 143


>gi|78187998|ref|YP_378336.1| Holliday junction resolvase YqgF [Chlorobium chlorochromatii CaD3]
 gi|146325560|sp|Q3AUD8|RUVX_CHLCH RecName: Full=Putative Holliday junction resolvase
 gi|78170197|gb|ABB27293.1| Holliday junction resolvase YqgF [Chlorobium chlorochromatii CaD3]
          Length = 140

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 72/138 (52%), Gaps = 7/138 (5%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGL 75
           Q I +ID GTKRIG+A SDP   FA P   + R  +++    LLS  +    +   ++G 
Sbjct: 5   QRIVAIDYGTKRIGVAKSDPLGMFAQPIGTVDRAGLSK----LLSPMVEAGEVQLVVVGY 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLN +G +         F+ ++      +P    +E  ++ SA Q+L+    SRK+R  K
Sbjct: 61  PLNRHGEQTAMTEVIDRFIESLRLEFPALPIETINEHCSSKSAMQLLVASGTSRKERKTK 120

Query: 136 --VDSIAAALILQEVLDR 151
             +D+ AA L+L + L++
Sbjct: 121 GRLDTAAACLLLSDYLEQ 138


>gi|150007310|ref|YP_001302053.1| Holliday junction resolvase-like protein [Parabacteroides
           distasonis ATCC 8503]
 gi|167012744|sp|A6L9R7|RUVX_PARD8 RecName: Full=Putative Holliday junction resolvase
 gi|149935734|gb|ABR42431.1| putative endonuclease [Parabacteroides distasonis ATCC 8503]
          Length = 140

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 74/143 (51%), Gaps = 11/143 (7%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I +ID G KR G+A +D  +  A+    +   +V +    L  +I+ E +  F++GL   
Sbjct: 4   IIAIDYGRKRTGIAATDILQMIANGVATVPSGEVVKY---LSDYISREPVDLFVVGLRKQ 60

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK--V 136
           MN      +    AFV ++      +P  ++DER T+V A + +++  + +KKR  K  V
Sbjct: 61  MNNEPSENMKYVEAFVTHLKRTIPSIPVTYYDERFTSVLAHKAMLEGGLKKKKRQDKGLV 120

Query: 137 DSIAAALILQEVLDRISFLESSK 159
           D I+A +ILQ      ++LES K
Sbjct: 121 DEISAVIILQ------AYLESKK 137


>gi|325963400|ref|YP_004241306.1| hypothetical protein Asphe3_20170 [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323469487|gb|ADX73172.1| conserved hypothetical protein TIGR00250 [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 199

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 65/135 (48%), Gaps = 5/135 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE-NIAAFIIGLPLNM 79
            +D+GT R+G+AI D     A P   L R     + + +++ +  E      I+GLP  M
Sbjct: 17  GVDVGTVRVGVAICDRDSVLATPYKTLDRNARKNSDIRIIANLVDELGAVQVIVGLPRTM 76

Query: 80  NGSEGPRVHSTRAFV----HNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
            G E       R +       +  R + VP    DERL++V+A + L +  +S +   + 
Sbjct: 77  KGEERSSAEMAREYAALLAGELAGRGLAVPVNLVDERLSSVTAHRHLHEAGMSSRNHRKV 136

Query: 136 VDSIAAALILQEVLD 150
           VD +AAA ILQ  +D
Sbjct: 137 VDQVAAAGILQHAID 151


>gi|255327163|ref|ZP_05368238.1| conserved hypothetical protein [Rothia mucilaginosa ATCC 25296]
 gi|255295781|gb|EET75123.1| conserved hypothetical protein [Rothia mucilaginosa ATCC 25296]
          Length = 178

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 65/146 (44%), Gaps = 6/146 (4%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL-SFITTENIAAFIIGLPLNM 79
            +D+G  R+G A+SDP    A P   L R     +   +L   I    +    +GLP  M
Sbjct: 2   GVDVGNARVGTALSDPDGILATPLKTLRRDAKKNSDRRVLRKLIEVNEVVEVFVGLPKTM 61

Query: 80  NGSEGPRVHSTRAFVHNM-----IDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            G + P     R +   +      + K ++     DERLTTVSA + L +  VS +    
Sbjct: 62  RGGDSPSTEMAREYAQALRSELDAEEKTHINIWLVDERLTTVSAHRALHEAGVSSRDFKT 121

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            VD +AA  ILQ  LD +   +S  G
Sbjct: 122 MVDQVAAVNILQYSLDALKAGQSVAG 147


>gi|33152804|ref|NP_874157.1| Holliday junction resolvase-like protein [Haemophilus ducreyi
           35000HP]
 gi|62901013|sp|Q7VKS6|RUVX_HAEDU RecName: Full=Putative Holliday junction resolvase
 gi|33149028|gb|AAP96546.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP]
          Length = 138

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 66/147 (44%), Gaps = 31/147 (21%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAF------- 71
           I + D GT  IG A+                + +T+TA  L +F + + I  +       
Sbjct: 5   ILAFDFGTYSIGCAVG---------------QSITKTAQSLTAFKSQDGIPNWQHIEKII 49

Query: 72  --------IIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI 123
                   ++GLPLNM+GSE P     R F  N ++ +  +P    DERLTT  A+  + 
Sbjct: 50  KEWQPDLLVVGLPLNMDGSEQPLTQRARKFA-NRLNGRFNLPVALQDERLTTTEAKSEIF 108

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLD 150
                +  +  K+D+I+A LIL+   D
Sbjct: 109 SRGGYKALKKDKIDTISACLILESWFD 135


>gi|294621483|ref|ZP_06700651.1| conserved hypothetical protein [Enterococcus faecium U0317]
 gi|291598924|gb|EFF29973.1| conserved hypothetical protein [Enterococcus faecium U0317]
          Length = 124

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 64/120 (53%), Gaps = 10/120 (8%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE-----LLSFITTENIAAFII 73
           +  +D+G+K +G+A+SDP   F      +   ++ +   E     L   +    +  F++
Sbjct: 3   VMGLDVGSKTVGVAVSDP---FGWTAQGVEIIRINEAEEEFGFDRLKELVAQYEVDRFVV 59

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKR 132
           GLP NMN S GPR  ++ ++    I     +P  + DERLTTV A+++L++  N SR KR
Sbjct: 60  GLPKNMNNSIGPRAEASMSYGEK-IKELFSLPVDYQDERLTTVQAERMLVEQANTSRAKR 118


>gi|291301347|ref|YP_003512625.1| Holliday junction resolvase YqgF [Stackebrandtia nassauensis DSM
           44728]
 gi|290570567|gb|ADD43532.1| Holliday junction resolvase YqgF [Stackebrandtia nassauensis DSM
           44728]
          Length = 151

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 68/136 (50%), Gaps = 5/136 (3%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVR----KKVTQTALELLSFITTEN-IAAFIIGL 75
            +D+G  R+G+A+SDP    A P   + R    K V    +  ++ +  E+ +   +IGL
Sbjct: 12  GVDVGKVRVGVALSDPDGILAAPLETVPRDMSGKSVPPADISRIADLVNEHSVVEIVIGL 71

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P+ ++G E      +RA+   +      VP  F DERLTT  A + L +  V  K+R   
Sbjct: 72  PVTLSGEESYAAAESRAYAEQVTAAVGDVPVRFVDERLTTAVASRRLSERGVKGKRRKAV 131

Query: 136 VDSIAAALILQEVLDR 151
           VD  AA  ILQ  L++
Sbjct: 132 VDQAAAVEILQLWLEK 147


>gi|42520048|ref|NP_965963.1| hypothetical protein WD0143 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|99034738|ref|ZP_01314668.1| hypothetical protein Wendoof_01000517 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|62900994|sp|Q73IL4|RUVX_WOLPM RecName: Full=Putative Holliday junction resolvase
 gi|42409785|gb|AAS13897.1| conserved hypothetical protein TIGR00250 [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 155

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 80/153 (52%), Gaps = 7/153 (4%)

Query: 7   EDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE 66
           ++ +KS+  ++ I  +D+G K+IG+A SD  +  A       RK +++  L  L  I  E
Sbjct: 7   DEFLKSIPKDKRIMCLDMGEKQIGIAFSDKTQLIATAHSIYHRKNMSKD-LGYLHRIFKE 65

Query: 67  N-IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL--I 123
           N   + +IGLPL M+  E     +   F + +I +K  V     DE  +T  A   L   
Sbjct: 66  NESGSMVIGLPLKMDEQETKWCKTIIQFANKII-KKYKVNIYLQDESFSTSIATHTLKIT 124

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLDRISFLE 156
            +++++ K+I   D I+A +ILQ  LD+I+ ++
Sbjct: 125 GISITKSKKID--DKISACIILQRTLDKINTIK 155


>gi|306818739|ref|ZP_07452461.1| possible Holliday junction resolvase [Mobiluncus mulieris ATCC
           35239]
 gi|304648425|gb|EFM45728.1| possible Holliday junction resolvase [Mobiluncus mulieris ATCC
           35239]
          Length = 153

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 64/130 (49%)

Query: 21  SIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMN 80
            +D+G  R+G+A +      A P   L  +       EL SFI  E   A  +GLP  +N
Sbjct: 8   GVDVGKVRVGIAQAYLDTILALPVKTLKVQADGSELEELASFIREETTTAVFVGLPRLLN 67

Query: 81  GSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIA 140
           G EG      R++   +  +   +P    DERL++V+A + L    VS ++  + VD +A
Sbjct: 68  GKEGEAARMARSYARRLARKISPIPVRLIDERLSSVTAHEKLRAAGVSTREHKKMVDQVA 127

Query: 141 AALILQEVLD 150
           A  IL++ L+
Sbjct: 128 AQQILEQALE 137


>gi|32034409|ref|ZP_00134591.1| COG0816: Predicted endonuclease involved in recombination (possible
           Holliday junction resolvase in Mycoplasmas and B.
           subtilis) [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|126207719|ref|YP_001052944.1| Holliday junction resolvase-like protein [Actinobacillus
           pleuropneumoniae L20]
 gi|165975691|ref|YP_001651284.1| Holliday junction resolvase-like protein [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|303251647|ref|ZP_07337820.1| Holliday junction resolvase-like protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303252798|ref|ZP_07338958.1| Holliday junction resolvase-like protein [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307245044|ref|ZP_07527138.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307247216|ref|ZP_07529266.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307251761|ref|ZP_07533664.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307253998|ref|ZP_07535846.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307258453|ref|ZP_07540191.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307260688|ref|ZP_07542378.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|167012686|sp|A3MYV3|RUVX_ACTP2 RecName: Full=Putative Holliday junction resolvase
 gi|226725479|sp|B0BSN8|RUVX_ACTPJ RecName: Full=Putative Holliday junction resolvase
 gi|126096511|gb|ABN73339.1| putative Holliday junction resolvase [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|165875792|gb|ABY68840.1| putative Holliday junction resolvase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|302648359|gb|EFL78555.1| Holliday junction resolvase-like protein [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302649489|gb|EFL79672.1| Holliday junction resolvase-like protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306854032|gb|EFM86243.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306856274|gb|EFM88427.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306860762|gb|EFM92772.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306863024|gb|EFM94970.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306867458|gb|EFM99308.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306869609|gb|EFN01396.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 137

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 62/132 (46%), Gaps = 1/132 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I + D GT  IG A+       A   P    +       ++   I        ++GLPLN
Sbjct: 5   ILAFDFGTYSIGCAVGQDITGTAQGLPSFKAQDGIPNWDQIEKVIKEWQPERLVVGLPLN 64

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+GSE P     + F  N ++ +  +P    DERLTTVSA+  + +    +  +  KVDS
Sbjct: 65  MDGSEQPLTQRAKKFA-NRLNGRFNLPVELQDERLTTVSAKAEIFERGGYKALKKDKVDS 123

Query: 139 IAAALILQEVLD 150
           I+A LIL+   +
Sbjct: 124 ISACLILESWFE 135


>gi|283458021|ref|YP_003362629.1| putative endonuclease involved in recombination [Rothia
           mucilaginosa DY-18]
 gi|283134044|dbj|BAI64809.1| predicted endonuclease involved in recombination [Rothia
           mucilaginosa DY-18]
          Length = 187

 Score = 63.5 bits (153), Expe