PSIBLAST alignment of GI: 254780976 and protein with PDB id: 1ovq

>gi|157879567|pdb|1OVQ|A Chain A, Solution Structure Of The Hypothetical Protein Yqgf From Escherichia Coli Length = 138
 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYFEQ 136