BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780976|ref|YP_003065389.1| Holliday junction resolvase
YqgF [Candidatus Liberibacter asiaticus str. psy62]
         (160 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780976|ref|YP_003065389.1| Holliday junction resolvase YqgF [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040653|gb|ACT57449.1| Holliday junction resolvase YqgF [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 160

 Score =  182 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 160/160 (100%), Positives = 160/160 (100%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL
Sbjct: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ
Sbjct: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG
Sbjct: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160


>gi|114765456|ref|ZP_01444566.1| hypothetical protein 1100011001321_R2601_10219 [Pelagibaca
           bermudensis HTCC2601]
 gi|114542166|gb|EAU45197.1| hypothetical protein R2601_10219 [Roseovarius sp. HTCC2601]
          Length = 158

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 69/158 (43%), Positives = 95/158 (60%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    IED   +L  ++ +A +DLGTK IG+A+SD     A P   + RKK T  A  LL
Sbjct: 1   MIHDEIEDFAAALPRDRALAGLDLGTKTIGVAVSDRLLTVATPLETVKRKKFTLDAERLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +    I   ++GLP NM+GSEGPR  STRAF  N   R    P  FWDERL+TV+A++
Sbjct: 61  EILVKREIGGVVLGLPRNMDGSEGPRCQSTRAFARNF-SRLWDGPVTFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++ + SR KR + +D +AA+ ILQ  LDR+  L ++
Sbjct: 120 ALLEADTSRAKRAELIDHVAASYILQGALDRLRHLRAN 157


>gi|260428035|ref|ZP_05782014.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260422527|gb|EEX15778.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 157

 Score =  170 bits (431), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 71/157 (45%), Positives = 97/157 (61%), Gaps = 1/157 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    IE+    L P + +A +DLGTK IG+A+SD     A P   + RKK TQ A  L+
Sbjct: 1   MIHEQIEEFAAILPPMRALAGLDLGTKTIGVALSDRLLTVATPLETVKRKKFTQDAARLV 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +    IA  ++GLP NM+GSEGPR  STRAF  N   +    P  FWDERL+TV+A++
Sbjct: 61  EILRQREIAGVVLGLPRNMDGSEGPRCQSTRAFARNF-SQLWDGPITFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
            L++ + SR+KR + +D +AA+ ILQ VLDR+  L S
Sbjct: 120 ALLEADTSRRKRAELIDHVAASYILQGVLDRLRNLRS 156


>gi|90417721|ref|ZP_01225633.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337393|gb|EAS51044.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 156

 Score =  170 bits (431), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 78/157 (49%), Positives = 109/157 (69%), Gaps = 1/157 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+I+ +E+   ++   + IA +DLGTK IGLA+SD G+RFA PR  L R K T  A  L+
Sbjct: 1   MAIVSLEEFADAVPSGKTIAGLDLGTKTIGLAVSDRGQRFATPRKVLRRTKFTADANALV 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  +NI   +IGLPLNM+GSEGPR  +TRAF+ N   R    P + WDERL+TV+A++
Sbjct: 61  AALNEDNIVGIVIGLPLNMDGSEGPRAQATRAFLRNY-SRFDERPVLLWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
            L++ +VSRKKR +++DS AA+ ILQ  LDR+S L S
Sbjct: 120 GLLEADVSRKKRAERIDSAAASFILQGALDRLSSLRS 156


>gi|315122522|ref|YP_004063011.1| Holliday junction resolvase YqgF [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495924|gb|ADR52523.1| Holliday junction resolvase YqgF [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 167

 Score =  168 bits (426), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 140/159 (88%), Positives = 152/159 (95%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           MSILLIEDLVKSLKPNQPIASIDLGTK+IG+AISD GRRFAHPRPFL+RKK+TQTALELL
Sbjct: 1   MSILLIEDLVKSLKPNQPIASIDLGTKKIGIAISDLGRRFAHPRPFLIRKKITQTALELL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           SF TTENIAAF+IGLPLNMNGSEGPRV STRAFV NMIDR++ VPF+FWDERLTTVSAQQ
Sbjct: 61  SFATTENIAAFVIGLPLNMNGSEGPRVQSTRAFVQNMIDREINVPFIFWDERLTTVSAQQ 120

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           ILIDM+VSRKKR QKVDSIAA+LILQEVLDRIS L+SS+
Sbjct: 121 ILIDMDVSRKKRAQKVDSIAASLILQEVLDRISSLKSSE 159


>gi|254485728|ref|ZP_05098933.1| conserved hypothetical protein TIGR00250 [Roseobacter sp. GAI101]
 gi|214042597|gb|EEB83235.1| conserved hypothetical protein TIGR00250 [Roseobacter sp. GAI101]
          Length = 161

 Score =  168 bits (426), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 71/160 (44%), Positives = 96/160 (60%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    I D   +L P Q +  +DLG K IG+A++D     A P   + RKK    A  L 
Sbjct: 1   MIYDDITDFAAALPPMQALIGLDLGEKTIGVAVTDSFLSVATPLETVRRKKFGLDAALLT 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             I    I   I+GLP NM+GSEGPR  STRAF  N  D+ V +P  FWDERL+TV+A++
Sbjct: 61  QIIADRRIGGVILGLPRNMDGSEGPRCQSTRAFARNF-DKLVDLPIGFWDERLSTVAAEK 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++ + SRK+R + +D +AA+ ILQ VLDR+S L +  G
Sbjct: 120 ALLEADTSRKRRAEVIDHVAASYILQGVLDRLSVLRAKGG 159


>gi|294677840|ref|YP_003578455.1| holliday junction resolvase YqgF [Rhodobacter capsulatus SB 1003]
 gi|294476660|gb|ADE86048.1| holliday junction resolvase YqgF [Rhodobacter capsulatus SB 1003]
          Length = 159

 Score =  167 bits (424), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 65/160 (40%), Positives = 101/160 (63%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    ++D   +L     +A +DLGTK IG+A+SD  R  A P   + R+K +    +L+
Sbjct: 1   MICPGMDDFAAALPRVGALAGLDLGTKTIGVAVSDTLRGIATPLRTIRREKFSLDLADLM 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +    IA F++GLP+NM+GSEGPR  STRAF    +++   +P  FWDERL+TV+A++
Sbjct: 61  KTVAERQIAGFVLGLPVNMDGSEGPRAQSTRAFAR-NLEKLTPLPITFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            +++ ++SRK+R + VD +AA  ILQ  LDR++ L  + G
Sbjct: 120 AMLEADLSRKRRAELVDHVAAGFILQGALDRLAHLGRAHG 159


>gi|6226491|sp|Q52673|RUVX_RHOCA RecName: Full=Putative Holliday junction resolvase
 gi|1353874|gb|AAB01816.1| unknown [Rhodobacter capsulatus]
          Length = 159

 Score =  167 bits (424), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 66/160 (41%), Positives = 101/160 (63%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    ++D   +L     +A +DLGTK IG+A+SD  R  A P   + R+K T    +L+
Sbjct: 1   MICPGMDDFAAALPRVGALAGLDLGTKTIGVAVSDTLRGIATPLRTIRREKFTLDVADLM 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +    IA F++GLP+NM+GSEGPR  STRAF    +++   +P  FWDERL+TV+A++
Sbjct: 61  KTVAERQIAGFVLGLPVNMDGSEGPRAQSTRAFAR-NLEKLTPLPITFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            +++ ++SRK+R + VD +AA  ILQ  LDR++ L  + G
Sbjct: 120 AMLEADLSRKRRAELVDHVAAGFILQGALDRLAHLGRAHG 159


>gi|126729458|ref|ZP_01745272.1| hypothetical protein SSE37_24699 [Sagittula stellata E-37]
 gi|126710448|gb|EBA09500.1| hypothetical protein SSE37_24699 [Sagittula stellata E-37]
          Length = 156

 Score =  166 bits (422), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 67/157 (42%), Positives = 93/157 (59%), Gaps = 1/157 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    IE    +L P Q +  +DLGTK IG+A+SD  R  A P   + RKK    A  L 
Sbjct: 1   MIHETIEGFAAALPPMQALMGLDLGTKTIGVAVSDGLRSVATPLETVKRKKFGVDAERLQ 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + I    I   I+GLP NM+G+EGPR  STRAF  N        P  +WDERL+TV+A++
Sbjct: 61  ALIAGRRIGGLILGLPRNMDGTEGPRCQSTRAFARNF-AALWDGPIGYWDERLSTVAAEK 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
            L++ + +RK+R + +D +AA+ ILQ  LDR+ FL +
Sbjct: 120 ALLEADTTRKRRAEVIDHVAASYILQGALDRLRFLGA 156


>gi|119383262|ref|YP_914318.1| Holliday junction resolvase YqgF [Paracoccus denitrificans PD1222]
 gi|167012745|sp|A1AZC8|RUVX_PARDP RecName: Full=Putative Holliday junction resolvase
 gi|119373029|gb|ABL68622.1| Holliday junction resolvase YqgF [Paracoccus denitrificans PD1222]
          Length = 158

 Score =  166 bits (421), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 66/159 (41%), Positives = 96/159 (60%), Gaps = 1/159 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    +E   ++L     +A +DLGTK IG+A+SD  R  A P   + R K T  A  LL
Sbjct: 1   MICENVETFAEALPRTGAVAGLDLGTKTIGVAVSDGLRGVASPLTVIRRTKFTADAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +    +   ++GLP NM+GSEGPR  STRAF    ++R   +P  FWDERL+TV+A++
Sbjct: 61  KIVQDRALVGLVLGLPRNMDGSEGPRAQSTRAFAR-NLERLTPLPITFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
            L++ + SRK+R + +D +AA  ILQ  LDR+ FL  ++
Sbjct: 120 ALLEGDTSRKRRAEVIDQVAAGYILQGALDRLRFLGRTE 158


>gi|149913939|ref|ZP_01902471.1| hypothetical protein RAZWK3B_18088 [Roseobacter sp. AzwK-3b]
 gi|149812223|gb|EDM72054.1| hypothetical protein RAZWK3B_18088 [Roseobacter sp. AzwK-3b]
          Length = 158

 Score =  166 bits (421), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 67/159 (42%), Positives = 98/159 (61%), Gaps = 1/159 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    I     +L    PI  +DLGTK IG+AISD     A P   + RKK +  A  LL
Sbjct: 1   MICETIGAFAMTLPKGHPIMGLDLGTKTIGVAISDRLLSVATPTETIKRKKFSVDAARLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
              T   +A  ++GLP NM+GSEGPR  STRAF    ++    +P  FWDERL+TV+A++
Sbjct: 61  EIATQREVAGLVLGLPRNMDGSEGPRCQSTRAFAR-NLEPLTELPITFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
            L++ + SRK+R + +D++AA+ ILQ VLDR++ + +++
Sbjct: 120 ALLEADTSRKRRAEVIDNVAASYILQGVLDRLTHMRAAQ 158


>gi|310816166|ref|YP_003964130.1| Putative Holliday junction resolvase [Ketogulonicigenium vulgare
           Y25]
 gi|308754901|gb|ADO42830.1| Putative Holliday junction resolvase [Ketogulonicigenium vulgare
           Y25]
          Length = 156

 Score =  165 bits (419), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 70/157 (44%), Positives = 97/157 (61%), Gaps = 1/157 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    +ED   +L P + +  +DLGT  IG+A+SD     A P   + RKK +  A  LL
Sbjct: 1   MICESVEDFAAALPPMRAVCGLDLGTVTIGVAVSDLMLSVASPLETIKRKKFSLDAEALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             I   NIA  ++GLPLNM+GSEGPR  STRAF    + R   +P V+WDERL+TV+A++
Sbjct: 61  KIIAARNIAGIVLGLPLNMDGSEGPRAQSTRAFAR-NLSRLTDLPIVYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
            L++ + SRK+R + +D +AA  ILQ VLDR+  L  
Sbjct: 120 ALLEADTSRKRRDEVIDHVAAGFILQGVLDRLRHLRR 156


>gi|254465560|ref|ZP_05078971.1| conserved hypothetical protein TIGR00250 [Rhodobacterales bacterium
           Y4I]
 gi|206686468|gb|EDZ46950.1| conserved hypothetical protein TIGR00250 [Rhodobacterales bacterium
           Y4I]
          Length = 157

 Score =  165 bits (419), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 64/158 (40%), Positives = 97/158 (61%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M   + ED   +L P   +  +DLGTK IG+A+SD     A P   + RKK +  A  LL
Sbjct: 1   MIHDVFEDFAAALPPMSALMGLDLGTKTIGVAVSDRIGAVATPLETVKRKKFSTDAARLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             I   +I+  ++GLP NM+G+EGPR  STRAF    + +   +P  FWDERL+TV+A++
Sbjct: 61  EIIQARDISGILLGLPRNMDGTEGPRCQSTRAFAR-NLMQLTDLPISFWDERLSTVAAEK 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++ + +RK+R + +D +AA+ ILQ  LDR+  L++ 
Sbjct: 120 ALLEADTTRKRRAEVIDHVAASYILQGALDRMRHLKNG 157


>gi|110633714|ref|YP_673922.1| Holliday junction resolvase YqgF [Mesorhizobium sp. BNC1]
 gi|118597215|sp|Q11IL8|RUVX_MESSB RecName: Full=Putative Holliday junction resolvase
 gi|110284698|gb|ABG62757.1| Holliday junction resolvase YqgF [Chelativorans sp. BNC1]
          Length = 160

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 84/160 (52%), Positives = 111/160 (69%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           MS++ IE+L K+    +P+A +DLGTK IG+AISD G  FA PR +L RKK  + A  LL
Sbjct: 1   MSVVSIEELEKARAYGRPLAGLDLGTKTIGVAISDLGLSFATPRAYLPRKKFQEDAKALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             ++ EN    I+GLP+NM+GSEGPR  STRAFV   +     +PF FWDERL+TV+A++
Sbjct: 61  HLLSRENAGGVIVGLPINMDGSEGPRAQSTRAFVR-NLQPLTKLPFAFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            LI+M+VSR KR Q++DS AAA ILQ  LDR+  L +  G
Sbjct: 120 ALIEMDVSRAKRAQRIDSAAAAFILQGALDRLQALRADPG 159


>gi|307946447|ref|ZP_07661782.1| putative Holliday junction resolvase [Roseibium sp. TrichSKD4]
 gi|307770111|gb|EFO29337.1| putative Holliday junction resolvase [Roseibium sp. TrichSKD4]
          Length = 160

 Score =  164 bits (416), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 69/155 (44%), Positives = 99/155 (63%), Gaps = 1/155 (0%)

Query: 4   LLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI 63
           L ++D +  L PN  +  +DLGTK IGLA+SD GR  A P   + RKK TQ A +LL   
Sbjct: 7   LSLDDFLSVLPPNSRLIGLDLGTKTIGLALSDLGRGIATPMETIRRKKFTQDAEKLLDIC 66

Query: 64  TTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI 123
             + ++  ++GLPLNM+GSEGPR  +TRAF    + +K  +P  +WDERL+T +  + L+
Sbjct: 67  AKQEVSGLVLGLPLNMDGSEGPRAQATRAFCR-NLSQKTELPITYWDERLSTAAVTRTLL 125

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           + + SR KR + VD +AAA ILQ  LDR+  + +S
Sbjct: 126 EADSSRAKRAEVVDKMAAAFILQGFLDRLGHMGAS 160


>gi|84517362|ref|ZP_01004716.1| hypothetical protein SKA53_06000 [Loktanella vestfoldensis SKA53]
 gi|84508842|gb|EAQ05305.1| hypothetical protein SKA53_06000 [Loktanella vestfoldensis SKA53]
          Length = 158

 Score =  164 bits (415), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 66/159 (41%), Positives = 99/159 (62%), Gaps = 1/159 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M     ED    L  +  +A +DLGT  IG+A+SD  R  A P   + R+K T  A  L 
Sbjct: 1   MICATPEDFAAQLPRHGAVAGLDLGTVTIGVAVSDLMRSVATPLETIKRRKFTLDAARLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
              T   IA  ++GLP NM+GSEGPR  +TRAF    +++   +P  FWDERL+TV+A++
Sbjct: 61  EITTHRMIAGLVLGLPRNMDGSEGPRCQATRAFAR-NLEKLTPLPITFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
            +++ ++SRK+R +++D+IAA+ ILQ +LDR+  LE+  
Sbjct: 120 AMLEADMSRKRRAERIDNIAASYILQGMLDRLRHLEARA 158


>gi|83954179|ref|ZP_00962899.1| hypothetical protein NAS141_17774 [Sulfitobacter sp. NAS-14.1]
 gi|83841216|gb|EAP80386.1| hypothetical protein NAS141_17774 [Sulfitobacter sp. NAS-14.1]
          Length = 161

 Score =  164 bits (415), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 66/158 (41%), Positives = 92/158 (58%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    I D   +L P Q +  +DLG K IG+A+SD     A P   + RKK    A  L 
Sbjct: 1   MIYDDITDFAAALPPMQALIGLDLGEKTIGVAVSDSFLSIATPLETVRRKKFGVDATRLS 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             I    I   ++GLP NM+GSEG R  STRAF  N  DR   +P  FWDERL+TV+A++
Sbjct: 61  EIIAARGIGGVVLGLPRNMDGSEGARCQSTRAFARNF-DRLGDIPIGFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++ + SR++R + +D +AA  ILQ VLDR+  +++ 
Sbjct: 120 ALLEADTSRRRRAEVIDHVAAGYILQGVLDRLRVIKAQ 157


>gi|259418877|ref|ZP_05742794.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259345099|gb|EEW56953.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 157

 Score =  164 bits (415), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 65/158 (41%), Positives = 93/158 (58%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M     ED   +L     +  +D G K IG+A+SD     A P   + RKK T  +  LL
Sbjct: 1   MIHDAFEDFAATLPQMTALVGLDFGEKTIGVAVSDRIGAVATPLETIRRKKFTLDSNRLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             I+  +I   I+GLP NM+GSEGPR  STRAF    + R   +P  FWDERL+TV+A++
Sbjct: 61  EIISGRDINGIILGLPRNMDGSEGPRCQSTRAFAR-NLSRVTDLPIGFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++ + SRK+R + +D +AA+ ILQ  LDR+  ++S 
Sbjct: 120 ALLEADTSRKRRAEVIDHVAASYILQGALDRLRHIKSG 157


>gi|146277916|ref|YP_001168075.1| Holliday junction resolvase-like protein [Rhodobacter sphaeroides
           ATCC 17025]
 gi|167012753|sp|A4WTQ6|RUVX_RHOS5 RecName: Full=Putative Holliday junction resolvase
 gi|145556157|gb|ABP70770.1| Holliday junction resolvase YqgF [Rhodobacter sphaeroides ATCC
           17025]
          Length = 160

 Score =  164 bits (415), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 64/159 (40%), Positives = 98/159 (61%), Gaps = 1/159 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    IE+ + +L  +  +  +DLGTK IG+A++D  RR A P   + R K T+ A  L 
Sbjct: 1   MIHESIEEFLAALPRSGALIGLDLGTKTIGVAVTDGLRRIATPLLTIRRTKFTEDAARLR 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +      +   ++GLP NM+GSEGPR  STRAF    + + + +P  +WDERL+TV+A++
Sbjct: 61  AITAERGLVGIVLGLPRNMDGSEGPRAQSTRAFAR-NLSQVLPLPIGYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
            LI+ + SRK+R + +D +AA  ILQ VLDR+ +L   +
Sbjct: 120 ALIEADTSRKRRAEVIDHVAAGYILQGVLDRLDWLGRER 158


>gi|83943004|ref|ZP_00955464.1| hypothetical protein EE36_12523 [Sulfitobacter sp. EE-36]
 gi|83846012|gb|EAP83889.1| hypothetical protein EE36_12523 [Sulfitobacter sp. EE-36]
          Length = 161

 Score =  163 bits (414), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 66/158 (41%), Positives = 92/158 (58%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    I D   +L P Q +  +DLG K IG+A+SD     A P   + RKK    A  L 
Sbjct: 1   MIYDDITDFAAALPPMQALIGLDLGEKTIGVAVSDSFLSIATPLETVRRKKFGVDAARLS 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             I    I   ++GLP NM+GSEG R  STRAF  N  DR   +P  FWDERL+TV+A++
Sbjct: 61  EIIAARGIGGVVLGLPRNMDGSEGARCQSTRAFARNF-DRLGDIPIGFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++ + SR++R + +D +AA  ILQ VLDR+  +++ 
Sbjct: 120 ALLEADTSRRRRAEVIDHVAAGYILQGVLDRLRVIKAQ 157


>gi|99080808|ref|YP_612962.1| Holliday junction resolvase YqgF [Ruegeria sp. TM1040]
 gi|124107444|sp|Q1GI16|RUVX_SILST RecName: Full=Putative Holliday junction resolvase
 gi|99037088|gb|ABF63700.1| Holliday junction resolvase YqgF [Ruegeria sp. TM1040]
          Length = 157

 Score =  163 bits (414), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 65/158 (41%), Positives = 92/158 (58%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M     ED   +L     +  +D G K IG+A+SD     A P   + RKK T  +  LL
Sbjct: 1   MIHDAFEDFAAALPQMTALVGLDFGEKTIGVAVSDRIGAVATPLETIRRKKFTLDSNRLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             I   +I   ++GLP NM+GSEGPR  STRAF    + R   +P  FWDERL+TV+A++
Sbjct: 61  EIIAGRDINGILLGLPRNMDGSEGPRCQSTRAFAR-NLSRVTDLPIGFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++ + SRK+R + +D +AA+ ILQ  LDR+  + SS
Sbjct: 120 ALLEADTSRKRRAEVIDHVAASYILQGALDRMRHIRSS 157


>gi|84499203|ref|ZP_00997491.1| hypothetical protein OB2597_04730 [Oceanicola batsensis HTCC2597]
 gi|84392347|gb|EAQ04558.1| hypothetical protein OB2597_04730 [Oceanicola batsensis HTCC2597]
          Length = 161

 Score =  163 bits (413), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 64/158 (40%), Positives = 94/158 (59%), Gaps = 2/158 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    +E+   +L P + IA +D G K IG+A+SD     A P   + R+K  Q A  L 
Sbjct: 1   MIHETVEEFAAALPPMRAIAGLDFGDKTIGVAVSDTFLSVATPLETIRRRKFGQDADALS 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKV--YVPFVFWDERLTTVSA 118
           + +    I   ++GLP NM+GSEGPR  STRAF  N+  R     +P  FWDERL+TV+A
Sbjct: 61  ALLAARTIGGLVLGLPRNMDGSEGPRCQSTRAFARNLARRPDFADLPLTFWDERLSTVAA 120

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLE 156
           ++ L++ + SR++R + +D +AA  ILQ  LDR+  L+
Sbjct: 121 ERALLEADTSRRRRAEVIDHVAAGYILQGALDRLRHLK 158


>gi|150396164|ref|YP_001326631.1| Holliday junction resolvase-like protein [Sinorhizobium medicae
           WSM419]
 gi|167013052|sp|A6U816|RUVX_SINMW RecName: Full=Putative Holliday junction resolvase
 gi|150027679|gb|ABR59796.1| Holliday junction resolvase YqgF [Sinorhizobium medicae WSM419]
          Length = 165

 Score =  163 bits (413), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 86/159 (54%), Positives = 113/159 (71%), Gaps = 1/159 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+IL IE+L + L P Q +A +DLGTK IGL++SD GRRFA PR  + R K    A  LL
Sbjct: 1   MAILTIEELAERLPPYQAVAGLDLGTKTIGLSVSDLGRRFATPRDVIRRVKFGIDAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F   E +AAF+IGLP+NM+GSEGPR  +TRAFV  M +R   +P V WDERL+TV+A++
Sbjct: 61  FFAEKEKVAAFVIGLPVNMDGSEGPRCQATRAFVRTMGER-TDIPSVLWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           +LI+M+VSRKKR  ++DS AA+ ILQ  LDR++ L    
Sbjct: 120 VLIEMDVSRKKRADRIDSAAASFILQGALDRLALLARGA 158


>gi|255261332|ref|ZP_05340674.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255103667|gb|EET46341.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 158

 Score =  163 bits (413), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 62/158 (39%), Positives = 93/158 (58%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    I +   ++     +A +DLGT  IG+A+SD     A P   + RKK +  A  LL
Sbjct: 1   MIFNDITEFAAAVPQMSALAGLDLGTVTIGVAVSDRFLSVATPLETIRRKKFSLDAARLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                  +   ++GLP NM+GSEGPR  STRAF    +++   +P  FWDERL+TV+A++
Sbjct: 61  EIAKDRELGGLVLGLPYNMDGSEGPRCQSTRAFAR-NLEKLTDLPISFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++ + +RK+R + +D +AA  ILQ VLDR + L +S
Sbjct: 120 ALLEADTTRKRRAEVIDHVAAGYILQGVLDRFAHLRAS 157


>gi|163759344|ref|ZP_02166430.1| hypothetical protein HPDFL43_06250 [Hoeflea phototrophica DFL-43]
 gi|162283748|gb|EDQ34033.1| hypothetical protein HPDFL43_06250 [Hoeflea phototrophica DFL-43]
          Length = 162

 Score =  162 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 85/159 (53%), Positives = 119/159 (74%), Gaps = 1/159 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ +EDL   L P Q IA +DLGTK IGLA+SD  R  A PRP + R+K T  A++LL
Sbjct: 1   MAVMEVEDLEAFLTPGQTIAGLDLGTKTIGLAVSDLSRSLASPRPVIKRRKFTLDAIDLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  + + A +IGLP+NM+GSEGPRV +TRAFV NMI++   +PFVFWDERL+TV+A++
Sbjct: 61  TALKRDQVGAVVIGLPVNMDGSEGPRVQATRAFVRNMIEK-TDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
            LI+M+VSRKKR +++DS AA+ ILQ  LDR+  L ++ 
Sbjct: 120 ALIEMDVSRKKRAERIDSAAASFILQGALDRLQGLRAAA 158


>gi|163746885|ref|ZP_02154242.1| hypothetical protein OIHEL45_15819 [Oceanibulbus indolifex HEL-45]
 gi|161379999|gb|EDQ04411.1| hypothetical protein OIHEL45_15819 [Oceanibulbus indolifex HEL-45]
          Length = 157

 Score =  162 bits (411), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 64/158 (40%), Positives = 92/158 (58%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M      D + +L P Q +  +DLG K IG+A+SD  +  A P   + RKK    A  L 
Sbjct: 1   MIFDDTADFLAALPPMQALIGLDLGEKTIGVAVSDSFQSVATPLETVRRKKFGLDAARLA 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             I    I   ++GLP NM+GSEGPR  STRAF  N  DR   +P  +WDERL+TV+A++
Sbjct: 61  EIIAKRRIGGLVLGLPRNMDGSEGPRCQSTRAFARNF-DRLTPLPITYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++ + +RK+R + +D +AA  ILQ +LDR+  +   
Sbjct: 120 ALLEADTTRKRRAEVIDHVAAGYILQGLLDRLQVMRRD 157


>gi|56697209|ref|YP_167573.1| Holliday junction resolvase-like protein [Ruegeria pomeroyi DSS-3]
 gi|62900907|sp|Q5LQY2|RUVX_SILPO RecName: Full=Putative Holliday junction resolvase
 gi|56678946|gb|AAV95612.1| conserved hypothetical protein TIGR00250 [Ruegeria pomeroyi DSS-3]
          Length = 154

 Score =  162 bits (410), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 67/155 (43%), Positives = 94/155 (60%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    +E+   +L P   +A +DLG K IG+A+SD  R  A P   + RKK    A  LL
Sbjct: 1   MICETVEEFAAALPPFSALAGLDLGDKTIGVAVSDRMRGVATPLETIRRKKFGLDASALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +    IA  ++GLP NM+GSEGPR  STRAF    + R   V   FWDERL+TV+A++
Sbjct: 61  AIVEQREIAGIVLGLPRNMDGSEGPRCQSTRAFAR-NLSRLTEVAITFWDERLSTVAAEK 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            L++ + +RK+R + +D +AAA ILQ  LDR+  L
Sbjct: 120 ALLEADTTRKRRSEVIDHVAAAYILQGALDRLRNL 154


>gi|254439741|ref|ZP_05053235.1| conserved hypothetical protein TIGR00250 [Octadecabacter
           antarcticus 307]
 gi|198255187|gb|EDY79501.1| conserved hypothetical protein TIGR00250 [Octadecabacter
           antarcticus 307]
          Length = 162

 Score =  162 bits (410), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 66/158 (41%), Positives = 99/158 (62%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    + D   +L P  P+A +DLGTK IG+A+SD G   A P   + R K    AL L 
Sbjct: 1   MIFEDVIDFAAALPPYAPLAGLDLGTKTIGVAVSDGGLTIASPLETIKRSKFQADALRLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
              +   IA  ++GLP NM+GSEGPR  STRAF    + R   +P  +WDERL+TV+A++
Sbjct: 61  EITSHRAIAGIVLGLPRNMDGSEGPRAQSTRAFAR-NLSRLTDLPITYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++ + SRK+R + +D++AA++ILQ +LDR+  +++ 
Sbjct: 120 ALLEADTSRKRRAEVIDNVAASIILQGMLDRLRNIKAQ 157


>gi|86357479|ref|YP_469371.1| holliday junction resolvase protein [Rhizobium etli CFN 42]
 gi|146325597|sp|Q2K942|RUVX_RHIEC RecName: Full=Putative Holliday junction resolvase
 gi|86281581|gb|ABC90644.1| probable holliday junction resolvase protein [Rhizobium etli CFN
           42]
          Length = 164

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 90/160 (56%), Positives = 121/160 (75%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L IE++ + L P Q IA +DLGTK IGL+ISD GRRFA PRP + R K T  A  LL
Sbjct: 1   MTVLTIEEIAEILPPGQAIAGLDLGTKTIGLSISDLGRRFATPRPVIRRIKFTIDAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F + E +A F+IGLP+NM+GS GPRV +TRAFV NM ++K  +PF++WDERL+TV+A++
Sbjct: 61  DFASAEKVAGFVIGLPMNMDGSAGPRVQATRAFVRNM-EQKTALPFIYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           +LI+M+VSR KR +++DS AA+ ILQ  LDR+S L  S G
Sbjct: 120 VLIEMDVSRAKRAERIDSAAASFILQGALDRLSLLARSAG 159


>gi|86138500|ref|ZP_01057074.1| hypothetical protein MED193_05331 [Roseobacter sp. MED193]
 gi|85825025|gb|EAQ45226.1| hypothetical protein MED193_05331 [Roseobacter sp. MED193]
          Length = 157

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 63/158 (39%), Positives = 90/158 (56%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M     ED   +L     +A +D G K +G+AISD     A P   + RKK T  A  L 
Sbjct: 1   MIYDEFEDFAAALPGFTALAGLDFGDKTVGVAISDRMGTVATPLETIRRKKFTLDADHLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +    I   ++GLP NM+GSEGPR   TRAF    + R   +P  FWDERL+TV+A++
Sbjct: 61  EIVKKREIGGLVLGLPRNMDGSEGPRCQKTRAFAR-NLSRLTELPIGFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++ + SRK+R + +D +AA+ ILQ  LDR+  L++ 
Sbjct: 120 ALLEADTSRKRRAELIDHVAASYILQGALDRMRHLKND 157


>gi|221639098|ref|YP_002525360.1| Holliday junction resolvase-like protein [Rhodobacter sphaeroides
           KD131]
 gi|254767523|sp|B9KRR7|RUVX_RHOSK RecName: Full=Putative Holliday junction resolvase
 gi|221159879|gb|ACM00859.1| Holliday junction resolvase [Rhodobacter sphaeroides KD131]
          Length = 160

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 68/160 (42%), Positives = 99/160 (61%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    IED + SL     +A +DLGTK +G+A+SD  RR A P   + R K T+ A +L 
Sbjct: 1   MIHDRIEDFLASLPRTGALAGLDLGTKTVGVAVSDGLRRIATPLLTVRRTKFTEDAAKLK 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +      +   ++GLP NM+GSEGPR  STRAF    + + + +P  FWDERL+TV+A++
Sbjct: 61  AIADERRLVGIVLGLPRNMDGSEGPRAQSTRAFAR-NLVQVLPLPVGFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++ + SRK+R + +D +AA  ILQ VLDR+ +L    G
Sbjct: 120 ALLEADTSRKRRAEVIDHVAAGYILQGVLDRLDWLGREGG 159


>gi|77463236|ref|YP_352740.1| putative endonuclease involved in recombination [Rhodobacter
           sphaeroides 2.4.1]
 gi|126462110|ref|YP_001043224.1| Holliday junction resolvase-like protein [Rhodobacter sphaeroides
           ATCC 17029]
 gi|332558114|ref|ZP_08412436.1| Holliday junction resolvase-like protein [Rhodobacter sphaeroides
           WS8N]
 gi|146325603|sp|Q3J2Z5|RUVX_RHOS4 RecName: Full=Putative Holliday junction resolvase
 gi|167012752|sp|A3PJD6|RUVX_RHOS1 RecName: Full=Putative Holliday junction resolvase
 gi|77387654|gb|ABA78839.1| putative endonuclease involved in recombination [Rhodobacter
           sphaeroides 2.4.1]
 gi|126103774|gb|ABN76452.1| Holliday junction resolvase YqgF [Rhodobacter sphaeroides ATCC
           17029]
 gi|332275826|gb|EGJ21141.1| Holliday junction resolvase-like protein [Rhodobacter sphaeroides
           WS8N]
          Length = 160

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 68/160 (42%), Positives = 99/160 (61%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    IED + SL     +A +DLGTK +G+A+SD  RR A P   + R K T+ A +L 
Sbjct: 1   MIHDRIEDFLASLPRTGALAGLDLGTKTVGVAVSDGLRRIATPLLTVRRTKFTEDAAKLK 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +      +   ++GLP NM+GSEGPR  STRAF    + + + +P  FWDERL+TV+A++
Sbjct: 61  AIAAERRLVGIVLGLPRNMDGSEGPRAQSTRAFAR-NLVQVLPLPVGFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++ + SRK+R + +D +AA  ILQ VLDR+ +L    G
Sbjct: 120 ALLEADTSRKRRAEVIDHVAAGYILQGVLDRLDWLGREGG 159


>gi|254477517|ref|ZP_05090903.1| conserved hypothetical protein TIGR00250 [Ruegeria sp. R11]
 gi|214031760|gb|EEB72595.1| conserved hypothetical protein TIGR00250 [Ruegeria sp. R11]
          Length = 157

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 62/156 (39%), Positives = 91/156 (58%), Gaps = 1/156 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M     E    ++    PIA +D G K +G+AISD     A P   + RKK T  A +L 
Sbjct: 1   MIYDDFEAFAAAVPSLSPIAGLDFGDKTVGVAISDRMGTVATPLETIRRKKFTLDAEKLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +    I A ++GLP NM+G+EGPR   TRAF    + +   +P  FWDERL+TV+A++
Sbjct: 61  EIVKAREIGALLLGLPRNMDGTEGPRCQKTRAFAR-NLSQLTDLPIGFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLE 156
            L++ + SRK+R + +D +AA+ ILQ  LDR+  L+
Sbjct: 120 ALLEADTSRKRRSEVIDHVAASYILQGALDRMRHLK 155


>gi|126739041|ref|ZP_01754735.1| hypothetical protein RSK20926_21614 [Roseobacter sp. SK209-2-6]
 gi|126719658|gb|EBA16366.1| hypothetical protein RSK20926_21614 [Roseobacter sp. SK209-2-6]
          Length = 157

 Score =  161 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 61/156 (39%), Positives = 91/156 (58%), Gaps = 1/156 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    IE+  +++     +A +D G K IG+AISD     A P   + RKK T  A  L 
Sbjct: 1   MICETIEEFAQAVPGFTALAGLDFGEKTIGIAISDRIGAVATPLETIRRKKFTLDAERLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                  I   ++GLP NM+GSEGPR   TRAF    +++   +P  FWDERL+TV+A++
Sbjct: 61  EITKAREIGGLVLGLPRNMDGSEGPRCQKTRAFAR-NLEKLTELPITFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLE 156
            L++ + SRK+R + +D +AA+ ILQ  LDR+  ++
Sbjct: 120 ALLEADTSRKRRAEVIDHVAASYILQGALDRMRHMK 155


>gi|260575164|ref|ZP_05843165.1| Holliday junction resolvase YqgF [Rhodobacter sp. SW2]
 gi|259022786|gb|EEW26081.1| Holliday junction resolvase YqgF [Rhodobacter sp. SW2]
          Length = 160

 Score =  161 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 70/161 (43%), Positives = 97/161 (60%), Gaps = 2/161 (1%)

Query: 1   MSIL-LIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALEL 59
           MS+L  IE+   +L   + +A +D G K IG+A+SD  R  A P   + R K T  A  L
Sbjct: 1   MSVLETIEEFAATLPARRAVAGLDFGEKTIGVAVSDLSRSVATPLLTIRRVKFTDDAAAL 60

Query: 60  LSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQ 119
              IT   IA  I+GLP NM+GSEGPR  +TRAF    + R   +P  FWDERL+TV+A 
Sbjct: 61  AKIITERQIAGLILGLPRNMDGSEGPRAQATRAFAR-NLSRLTPLPIGFWDERLSTVAAT 119

Query: 120 QILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           + L++ + SRK+R + +D +AA  ILQ VLDR++ +    G
Sbjct: 120 RALLEADTSRKRRAEVIDHVAAGYILQGVLDRMAHMTREAG 160


>gi|126736029|ref|ZP_01751773.1| hypothetical protein RCCS2_02303 [Roseobacter sp. CCS2]
 gi|126714586|gb|EBA11453.1| hypothetical protein RCCS2_02303 [Roseobacter sp. CCS2]
          Length = 158

 Score =  161 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 63/158 (39%), Positives = 97/158 (61%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M     E  V ++     +A +DLGT  IG+A+SD  R  A P   + RKK    A +LL
Sbjct: 1   MICDTPETFVAAIPDRGALAGLDLGTVTIGVAVSDVLRSVATPLETIKRKKFGVDAAKLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
              T   +   ++GLP NM+GSEGPR  +TRAF    +++   +P  FWDERL+TV+A++
Sbjct: 61  ELTTHRLVTGLVLGLPRNMDGSEGPRCQATRAFAR-NLEKLTPLPITFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++ + SRK+R + +D +AA  ILQ +LDR++ L+++
Sbjct: 120 ALLEADTSRKRRAEVIDHVAAGYILQGMLDRMAHLKAT 157


>gi|89068321|ref|ZP_01155731.1| hypothetical protein OG2516_02629 [Oceanicola granulosus HTCC2516]
 gi|89046238|gb|EAR52296.1| hypothetical protein OG2516_02629 [Oceanicola granulosus HTCC2516]
          Length = 157

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 63/156 (40%), Positives = 93/156 (59%), Gaps = 1/156 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M     ED   +L  +  +  +DLGT+ IG+A+SD  R  A P   + RKK    A  LL
Sbjct: 1   MICDSAEDFAAALPDHGALVGLDLGTRTIGVAVSDGLRAVATPLQTIARKKFGVDAAALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +      I   ++GLP NM+GSEGPR  STR F    ++R   +P  FWDERL+TV+A++
Sbjct: 61  AICEHRAITGIVLGLPRNMDGSEGPRCQSTRGFAR-NLERLTPLPIAFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLE 156
            L++ + SR++R + +D +AA +ILQ +LDR+  L 
Sbjct: 120 ALLEADTSRRRRGEVIDHVAAGVILQGMLDRLRHLR 155


>gi|15965062|ref|NP_385415.1| hypothetical protein SMc01355 [Sinorhizobium meliloti 1021]
 gi|307301133|ref|ZP_07580902.1| Holliday junction resolvase YqgF [Sinorhizobium meliloti BL225C]
 gi|32130055|sp|Q92QL0|RUVX_RHIME RecName: Full=Putative Holliday junction resolvase
 gi|15074241|emb|CAC45888.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306904088|gb|EFN34674.1| Holliday junction resolvase YqgF [Sinorhizobium meliloti BL225C]
          Length = 165

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 88/159 (55%), Positives = 117/159 (73%), Gaps = 1/159 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+IL +E+L + L P Q +A +DLGTK IG+++SD GRRFA PR  + R K    A  LL
Sbjct: 1   MAILTMEELAERLPPYQSVAGLDLGTKTIGISVSDLGRRFATPREVIRRVKFGADAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           SF   E IAAFIIGLP+NM+GSEGPR  +TRAFV NM ++   +PFV WDERL+TV+A++
Sbjct: 61  SFAEKEKIAAFIIGLPVNMDGSEGPRCQATRAFVRNMGEK-TDIPFVLWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           +LI+M+VSRKKR +++DS AA+ ILQ  LDR++ L    
Sbjct: 120 VLIEMDVSRKKRAERIDSAAASFILQGALDRLASLARGA 158


>gi|307317866|ref|ZP_07597304.1| Holliday junction resolvase YqgF [Sinorhizobium meliloti AK83]
 gi|306896628|gb|EFN27376.1| Holliday junction resolvase YqgF [Sinorhizobium meliloti AK83]
          Length = 165

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 87/159 (54%), Positives = 116/159 (72%), Gaps = 1/159 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+IL +E+L + L P Q +A +DLGTK IG+++SD GRRFA PR  + R K    A  LL
Sbjct: 1   MAILTMEELAERLPPYQSVAGLDLGTKTIGISVSDLGRRFATPREVIRRVKFGADAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           SF   E IAAFIIGLP+NM+GSEGPR  +TRAFV  M ++   +PFV WDERL+TV+A++
Sbjct: 61  SFAEKEKIAAFIIGLPVNMDGSEGPRCQATRAFVRTMGEK-TDIPFVLWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           +LI+M+VSRKKR +++DS AA+ ILQ  LDR++ L    
Sbjct: 120 VLIEMDVSRKKRAERIDSAAASFILQGALDRLASLARGA 158


>gi|110679064|ref|YP_682071.1| hypothetical protein RD1_1766 [Roseobacter denitrificans OCh 114]
 gi|118597221|sp|Q169F8|RUVX_ROSDO RecName: Full=Putative Holliday junction resolvase
 gi|109455180|gb|ABG31385.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 163

 Score =  161 bits (407), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 62/160 (38%), Positives = 94/160 (58%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +    D + +L   + +  +DLGT+ IG+A+SD     A P   + R+K T  A  L 
Sbjct: 1   MILEDTADFLAALPSMRSLMGLDLGTQTIGVAVSDTFLSVATPLETVKRRKFTLDAARLS 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRK-VYVPFVFWDERLTTVSAQ 119
             +    +   ++GLP NM+GSEGPR  STRAF  N+       +P  FWDERL+TV+A+
Sbjct: 61  DIVAQRRLGGLVLGLPRNMDGSEGPRCQSTRAFARNLDKSIGSDLPITFWDERLSTVAAE 120

Query: 120 QILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           + L++ + SRK+R + +D +AAA ILQ  LDRI  + + +
Sbjct: 121 RALLEADTSRKRRAEVIDHVAAAYILQGALDRIRVIRAEQ 160


>gi|260433278|ref|ZP_05787249.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417106|gb|EEX10365.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 154

 Score =  161 bits (407), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 66/155 (42%), Positives = 92/155 (59%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M     E+   +L P Q +  +DLG K IG+A+SD  R  A P   + RKK    +  LL
Sbjct: 1   MIHDGFEEFAAALPPMQALMGLDLGEKTIGVAVSDRMRGVASPLETVRRKKFKLDSARLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
              T   I   ++GLP NM+GSEGPR  STRAF    + +   +P  FWDERL+TV+A++
Sbjct: 61  EIATDREIGGIVLGLPRNMDGSEGPRCQSTRAFAR-NLSQLTDIPIGFWDERLSTVAAKK 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            L++ + +RK+R Q +D +AA  ILQ  LDR+ FL
Sbjct: 120 ALLEADTTRKRRGQVIDHVAAGYILQGALDRLRFL 154


>gi|209964820|ref|YP_002297735.1| hypothetical protein RC1_1518 [Rhodospirillum centenum SW]
 gi|226731644|sp|B6IN25|RUVX_RHOCS RecName: Full=Putative Holliday junction resolvase
 gi|209958286|gb|ACI98922.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 188

 Score =  161 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 65/164 (39%), Positives = 98/164 (59%), Gaps = 4/164 (2%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+I  + +L  SL  N  +  +DLG K IGLA+SDPG   A P   + R K TQ A EL 
Sbjct: 1   MAIRNLMELKASLPRNGRLMGLDLGEKTIGLAVSDPGLSVASPVGTIRRTKFTQDAQELA 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRK----VYVPFVFWDERLTTV 116
             +   ++ A ++GLP+NM+G+EGPR  S R F   ++ R           FWDERL+T 
Sbjct: 61  RAMRDRDVRALVVGLPVNMDGTEGPRCQSVREFSRLLLQRPQLFGFEPEIAFWDERLSTS 120

Query: 117 SAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           + ++++I  +++RK+R + VD +AAA ILQ  LDR+   +++ G
Sbjct: 121 AVERMMIGWDMTRKRRDEVVDKMAAAYILQGALDRLRQGDAAPG 164


>gi|328543472|ref|YP_004303581.1| endonuclease involved in recombination [polymorphum gilvum
           SL003B-26A1]
 gi|326413216|gb|ADZ70279.1| Predicted endonuclease involved in recombination [Polymorphum
           gilvum SL003B-26A1]
          Length = 166

 Score =  161 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 69/156 (44%), Positives = 97/156 (62%), Gaps = 1/156 (0%)

Query: 4   LLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI 63
           L +ED V +L P   +  +DLGT+ IGLA+SD GR  A P   + R+K T  A +LL   
Sbjct: 7   LSLEDFVAALAPGTRLIGLDLGTRTIGLALSDLGRGIASPLETIRRRKFTLDAEQLLKIC 66

Query: 64  TTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI 123
               +   ++GLPLNM+GSEGPRV +TRAF    +  K  +P  +WDERL+T +  + LI
Sbjct: 67  AEHRVGGLVLGLPLNMDGSEGPRVQATRAFAR-NLAEKTDLPITYWDERLSTAAVTRTLI 125

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           + + SR +R + VD +AAA ILQ  LDR+ +L  S+
Sbjct: 126 EADRSRARRAELVDKMAAAYILQGFLDRLGYLSRSR 161


>gi|163739973|ref|ZP_02147378.1| Holliday junction resolvase YqgF [Phaeobacter gallaeciensis BS107]
 gi|163743191|ref|ZP_02150573.1| hypothetical protein RG210_14860 [Phaeobacter gallaeciensis 2.10]
 gi|161383608|gb|EDQ07995.1| hypothetical protein RG210_14860 [Phaeobacter gallaeciensis 2.10]
 gi|161386718|gb|EDQ11082.1| Holliday junction resolvase YqgF [Phaeobacter gallaeciensis BS107]
          Length = 157

 Score =  160 bits (405), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 60/158 (37%), Positives = 91/158 (57%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M     E    ++    PIA +D G K +G+AISD     A P   + RKK T  A  L 
Sbjct: 1   MIYDDFETFAAAVPNFTPIAGLDFGDKTVGVAISDRMGTVATPLETIRRKKFTLDAARLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +    + A ++GLP NM+G+EGPR   TRAF    + +   +P  FWDERL+TV+A++
Sbjct: 61  EIVKDREVGALLLGLPRNMDGTEGPRCQKTRAFAR-NLAKLTELPIGFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++ + SRK+R + +D +AA+ ILQ  LDR+  +++ 
Sbjct: 120 ALLEADTSRKRRAEVIDHVAASYILQGALDRMRHIKAG 157


>gi|254454337|ref|ZP_05067774.1| conserved hypothetical protein TIGR00250 [Octadecabacter
           antarcticus 238]
 gi|198268743|gb|EDY93013.1| conserved hypothetical protein TIGR00250 [Octadecabacter
           antarcticus 238]
          Length = 158

 Score =  160 bits (405), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 63/157 (40%), Positives = 95/157 (60%), Gaps = 1/157 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    + D   +L    P+A +DLGTK IG+A+ D G   A P   + R K    A  L 
Sbjct: 1   MIFEDVIDFAAALPRYAPLAGLDLGTKTIGVAVCDGGLIIASPLETIKRSKFQADATRLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                  +A  ++GLP NM+GSEGPR  STRAF    + R   +P  +WDERL+TV+A++
Sbjct: 61  EITAHREVAGIVLGLPRNMDGSEGPRAQSTRAFAR-NLSRLSDLPITYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
            L++ + SRK+R + +D+IAA++ILQ +LDR+  +++
Sbjct: 120 ALLEADTSRKRRAEVIDNIAASIILQGLLDRLRNIKA 156


>gi|218661529|ref|ZP_03517459.1| holliday junction resolvase protein [Rhizobium etli IE4771]
          Length = 166

 Score =  160 bits (404), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 89/160 (55%), Positives = 120/160 (75%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L IE++  +L P + IA +DLGTK IGL++SD GRRFA PRP + R K T  A  LL
Sbjct: 3   MTVLTIEEMAATLAPGKAIAGLDLGTKTIGLSMSDLGRRFATPRPVIRRVKFTIDAQALL 62

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F  TE +A F+IGLP+NM+GS GPRV +TRAFV NM ++K  +PFV+WDERL+TV+A++
Sbjct: 63  DFAATEKVAGFVIGLPMNMDGSAGPRVQATRAFVRNM-EQKTALPFVYWDERLSTVAAER 121

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L  S G
Sbjct: 122 TLLEMDVSRAKRAERIDSAAASFILQGALDRLSLLARSAG 161


>gi|190891542|ref|YP_001978084.1| holliday junction resolvase [Rhizobium etli CIAT 652]
 gi|226731642|sp|B3PXX0|RUVX_RHIE6 RecName: Full=Putative Holliday junction resolvase
 gi|190696821|gb|ACE90906.1| holliday junction resolvase protein [Rhizobium etli CIAT 652]
          Length = 164

 Score =  160 bits (404), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 88/160 (55%), Positives = 118/160 (73%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L IE++  +L P Q IA +DLGTK IGL++SD GRRFA PRP + R K T  A  LL
Sbjct: 1   MTVLTIEEMAATLAPGQAIAGLDLGTKTIGLSMSDLGRRFATPRPVIRRAKFTIDAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F   E +A F+IGLP+NM+GS GPRV +TRAFV NM ++   +PFV+WDERL+TV+A++
Sbjct: 61  DFAAKERVAGFVIGLPMNMDGSAGPRVQATRAFVRNMEEKTA-LPFVYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L  S G
Sbjct: 120 TLLEMDVSRAKRAERIDSAAASFILQGALDRLSLLARSDG 159


>gi|83952340|ref|ZP_00961071.1| putative endonuclease involved in recombination [Roseovarius
           nubinhibens ISM]
 gi|83836013|gb|EAP75311.1| putative endonuclease involved in recombination [Roseovarius
           nubinhibens ISM]
          Length = 158

 Score =  160 bits (404), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 63/158 (39%), Positives = 92/158 (58%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M     E   + L     +  +DLGTK +G+A+SD  R  A P   + R+K T  A  L 
Sbjct: 1   MIHDAFESFAEGLPAMGALMGLDLGTKTVGVAVSDGMRGVATPLETVKRQKFTLDAARLQ 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             I   ++   ++GLP NM+GSEGPR  STRAF  N   +   +P  FWDERL+TV+A++
Sbjct: 61  ELIAARSVVGVVLGLPRNMDGSEGPRCQSTRAFARNF-AQLTDLPIGFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++ + SRK+R + +D +AA+ ILQ  LDR+  +  S
Sbjct: 120 ALLEADTSRKRRAEVIDHVAASYILQGALDRLRHIGRS 157


>gi|327192100|gb|EGE59078.1| holliday junction resolvase protein [Rhizobium etli CNPAF512]
          Length = 164

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 89/160 (55%), Positives = 119/160 (74%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L IE++  +L P Q IA +DLGTK IGL++SD GRRFA PRP + R K T  A  LL
Sbjct: 1   MTVLTIEEMAATLAPGQAIAGLDLGTKTIGLSMSDLGRRFATPRPVIRRAKFTIDAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F   E +A F+IGLP+NM+GS GPRV +TRAFV NM ++K  +PFV+WDERL+TV+A++
Sbjct: 61  DFAAKEKVAGFVIGLPMNMDGSAGPRVQATRAFVRNM-EQKTALPFVYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L  S G
Sbjct: 120 TLLEMDVSRAKRAERIDSAAASFILQGALDRLSLLARSDG 159


>gi|325292676|ref|YP_004278540.1| Holliday junction resolvase [Agrobacterium sp. H13-3]
 gi|325060529|gb|ADY64220.1| putative Holliday junction resolvase [Agrobacterium sp. H13-3]
          Length = 159

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 88/160 (55%), Positives = 121/160 (75%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+IL IE+L ++L+P Q IA +DLGTK IGLA+SD  RRFA PRP + R K T+ A  LL
Sbjct: 1   MAILTIEELAETLQPAQAIAGLDLGTKTIGLAMSDLSRRFATPRPVIKRVKFTRDAEVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +F   E ++AFIIGLP+NM+GS GPR  +TRAFV  M ++   +PF+FWDERL+TV+A++
Sbjct: 61  AFAEKEKVSAFIIGLPINMDGSAGPRAQATRAFVRTMGEKTA-LPFIFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           +L++M+VSR KR +++DS AA+ ILQ  LDR+S L  + G
Sbjct: 120 VLLEMDVSRAKRAERIDSAAASFILQGALDRLSALARATG 159


>gi|222085624|ref|YP_002544154.1| holliday junction resolvase protein [Agrobacterium radiobacter K84]
 gi|254767490|sp|B9JDM7|RUVX_AGRRK RecName: Full=Putative Holliday junction resolvase
 gi|221723072|gb|ACM26228.1| holliday junction resolvase protein [Agrobacterium radiobacter K84]
          Length = 164

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 91/155 (58%), Positives = 117/155 (75%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+ L IEDL   L P Q IA +DLGTK IGLA+SD GRRFA PRP + R K TQ A  LL
Sbjct: 1   MTTLTIEDLAVMLLPGQAIAGLDLGTKTIGLAMSDLGRRFATPRPVIKRVKFTQDAQTLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +F   E +AAF+IGLP+NM+GS GPRV +TRAFV +M D+   +PFV+WDERL+TV+A++
Sbjct: 61  AFAEKEKVAAFVIGLPMNMDGSTGPRVQATRAFVRSMADKTA-LPFVYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L
Sbjct: 120 ALLEMDVSRAKRAERIDSAAASFILQGALDRLSAL 154


>gi|118590189|ref|ZP_01547592.1| Putative Holliday junction resolvase [Stappia aggregata IAM 12614]
 gi|118437161|gb|EAV43799.1| Putative Holliday junction resolvase [Stappia aggregata IAM 12614]
          Length = 162

 Score =  158 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 68/157 (43%), Positives = 96/157 (61%), Gaps = 1/157 (0%)

Query: 4   LLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI 63
           L +ED V ++     +  +DLGTK IGLA+SD G   A P   + RKK T  A +LL+  
Sbjct: 7   LSLEDFVAAVPARTRLIGLDLGTKTIGLALSDLGLGIASPMETIRRKKFTLDAEQLLTIC 66

Query: 64  TTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI 123
             + +   ++GLPLNM+GSEGPR  +TRAFV   + +K  +P  +WDERL+T +  + L+
Sbjct: 67  AKQGVGGIVLGLPLNMDGSEGPRAQATRAFVR-NLSQKTDLPITYWDERLSTAAVTRTLL 125

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           + + SR KR   VD +AAA ILQ  LDR+ F+    G
Sbjct: 126 EADTSRAKRADVVDKMAAAYILQGFLDRLGFMGLDNG 162


>gi|254504549|ref|ZP_05116700.1| conserved hypothetical protein TIGR00250 [Labrenzia alexandrii
           DFL-11]
 gi|222440620|gb|EEE47299.1| conserved hypothetical protein TIGR00250 [Labrenzia alexandrii
           DFL-11]
          Length = 161

 Score =  158 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/154 (43%), Positives = 95/154 (61%), Gaps = 1/154 (0%)

Query: 2   SILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS 61
             L +ED + ++     +  +DLGTK IGLA+SD GR  A P   + RKK T  A +LL 
Sbjct: 5   PTLSLEDFIAAVPDRTRLIGLDLGTKTIGLALSDLGRGIASPMETIRRKKFTLDAEQLLK 64

Query: 62  FITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQI 121
               + +   ++GLPLNM+G+EGPRV +TRAF    +  K  +P  FWDERL+T +  + 
Sbjct: 65  ICNEQGVGGLVLGLPLNMDGTEGPRVQATRAFTR-NLAPKTDLPMTFWDERLSTAAVTRT 123

Query: 122 LIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           L++ + SR KR + VD +AAA ILQ  LDR+ F+
Sbjct: 124 LLEADSSRAKRAEVVDKMAAAYILQGFLDRLGFM 157


>gi|254512444|ref|ZP_05124511.1| conserved hypothetical protein TIGR00250 [Rhodobacteraceae
           bacterium KLH11]
 gi|221536155|gb|EEE39143.1| conserved hypothetical protein TIGR00250 [Rhodobacteraceae
           bacterium KLH11]
          Length = 154

 Score =  158 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/155 (43%), Positives = 93/155 (60%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M   + ED   +L P   +  +DLG K IG+A+SD  R  A P   + RKK T  +  L+
Sbjct: 1   MIHDVFEDFAAALPPMSALMGLDLGEKTIGVAVSDRMRGVATPLETVRRKKFTLDSARLI 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +T   I   ++GLP NM+GSEGPR  STRAF    + R   V   FWDERL+TV+A++
Sbjct: 61  EIVTDREIGGIVLGLPRNMDGSEGPRCQSTRAFAR-NLTRLTEVQIGFWDERLSTVAAEK 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            L++ + +RK+R Q +D +AA  ILQ  LDR+ FL
Sbjct: 120 ALLEADTTRKRRGQVIDHVAAGYILQGALDRLRFL 154


>gi|222148317|ref|YP_002549274.1| Holliday junction resolvase-like protein [Agrobacterium vitis S4]
 gi|254767491|sp|B9JVI8|RUVX_AGRVS RecName: Full=Putative Holliday junction resolvase
 gi|221735305|gb|ACM36268.1| holliday junction resolvase protein [Agrobacterium vitis S4]
          Length = 158

 Score =  158 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 88/158 (55%), Positives = 119/158 (75%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+ L IE+L +SL+P Q +A +DLGTK IGLA+SD GRRFA PR  + R K T+ A  LL
Sbjct: 1   MATLEIEELAQSLQPGQAVAGLDLGTKTIGLAMSDLGRRFASPRTVIKRTKFTKDAEVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +F   E +AAF+IGLP+NM+GS GPRV +TRAFV  M ++   +PFV+WDERL+TV+A +
Sbjct: 61  AFAAKEKVAAFVIGLPINMDGSSGPRVQATRAFVRAMAEK-TDIPFVYWDERLSTVAATR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L S+
Sbjct: 120 ALLEMDVSRAKRAERIDSAAASFILQGALDRLSGLAST 157


>gi|118597211|sp|Q28QB4|RUVX_JANSC RecName: Full=Putative Holliday junction resolvase
          Length = 160

 Score =  158 bits (400), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 62/159 (38%), Positives = 92/159 (57%), Gaps = 2/159 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    +++   ++ P + +  +DLGTK IG+A+SD     A     + RKK    A  L 
Sbjct: 1   MIFETLDEFAGAVPPMRGLIGLDLGTKTIGVALSDRLLTSASALETVKRKKFGVDADALA 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFV--FWDERLTTVSA 118
             I    +   I+GLP NM+GSEGPR  +TRAF  N+  R  +      FWDERL+TV+A
Sbjct: 61  GLIAKHEVGGIILGLPRNMDGSEGPRAQATRAFALNLSRRGDFAHLALGFWDERLSTVAA 120

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
           ++ LI  + SRK+R + +D++AA+ ILQ  LDR+  L +
Sbjct: 121 ERALIAADTSRKRRSEVIDAVAASYILQGALDRLRHLRA 159


>gi|319783699|ref|YP_004143175.1| Holliday junction resolvase YqgF [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169587|gb|ADV13125.1| Holliday junction resolvase YqgF [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 168

 Score =  158 bits (400), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 81/159 (50%), Positives = 110/159 (69%), Gaps = 1/159 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I+ IE+L   L   + +A +DLG K IG+A+SD    FAHPRP ++R+K +  A  LL
Sbjct: 1   MGIITIEELPARLAGGKTLAGLDLGDKTIGVAVSDQRFSFAHPRPVIMRRKFSLDAAVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  EN  A +IGLP+NM+GSEGPR   +RAFV NM  +   +PFV WDERL+TV+A++
Sbjct: 61  ALLQKENAGAVVIGLPINMDGSEGPRAQKSRAFVRNM-AQMSDLPFVLWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
            LI+M+ SR+KR  K+DS AAA ILQ VLDR+  L +S 
Sbjct: 120 TLIEMDFSRRKRAGKIDSAAAAFILQGVLDRLQSLHASA 158


>gi|209549118|ref|YP_002281035.1| Holliday junction resolvase-like protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|226731643|sp|B5ZMI7|RUVX_RHILW RecName: Full=Putative Holliday junction resolvase
 gi|209534874|gb|ACI54809.1| Holliday junction resolvase YqgF [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 163

 Score =  158 bits (400), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 89/160 (55%), Positives = 121/160 (75%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L IE++ ++L P Q IA +DLGTK IGL++SD GRRFA PRP + R K T  A  L+
Sbjct: 1   MTVLTIEEMAETLAPRQAIAGLDLGTKTIGLSMSDLGRRFATPRPVIRRVKFTIDAQALM 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F T E +A F+IGLP+NM+GS GPRV +TRAFV NM ++K  +PFV+WDERL+TV+A++
Sbjct: 61  DFATAEKVAGFVIGLPMNMDGSAGPRVQATRAFVRNM-EQKTALPFVYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L  S G
Sbjct: 120 TLLEMDVSRAKRAERIDSAAASFILQGALDRLSLLARSDG 159


>gi|163734012|ref|ZP_02141453.1| hypothetical protein RLO149_03699 [Roseobacter litoralis Och 149]
 gi|161392548|gb|EDQ16876.1| hypothetical protein RLO149_03699 [Roseobacter litoralis Och 149]
          Length = 163

 Score =  158 bits (400), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 62/160 (38%), Positives = 95/160 (59%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +    D + +L P + +  +DLGT+ IG+A+SD     A P   + R+K T  A  L+
Sbjct: 1   MILEDTADFLAALAPMRSLMGLDLGTQTIGVAVSDTFLSVATPLETIKRRKFTLDAARLV 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRK-VYVPFVFWDERLTTVSAQ 119
              +   +   ++GLP NM+GSEGPR  STRAF  N+       +P  FWDERL+TV+A+
Sbjct: 61  EIASERRLGGLVLGLPRNMDGSEGPRCQSTRAFARNLEKTIGSDLPITFWDERLSTVAAE 120

Query: 120 QILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           + L++ + SRK+R + +D +AA  ILQ  LDRI  + + +
Sbjct: 121 RALLEADTSRKRRAEVIDHVAAGYILQGALDRIRVIRAEQ 160


>gi|241204443|ref|YP_002975539.1| Holliday junction resolvase-like protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240858333|gb|ACS56000.1| Holliday junction resolvase YqgF [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 164

 Score =  158 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 88/160 (55%), Positives = 120/160 (75%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L IE++ ++L P Q IA +DLGTK IGL++SD GRRFA PR  + R K T  A  LL
Sbjct: 1   MTVLTIEEMAETLVPRQAIAGLDLGTKTIGLSMSDLGRRFATPRTVIRRVKFTIDAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F  +E +A F+IGLP+NM+GS GPRV +TRAFV NM ++K  +PFV+WDERL+TV+A++
Sbjct: 61  DFAQSEKVAGFVIGLPMNMDGSAGPRVQATRAFVRNM-EQKTALPFVYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L  S G
Sbjct: 120 TLLEMDVSRAKRAERIDSAAASFILQGALDRLSLLARSDG 159


>gi|85707211|ref|ZP_01038297.1| hypothetical protein ROS217_23800 [Roseovarius sp. 217]
 gi|85668265|gb|EAQ23140.1| hypothetical protein ROS217_23800 [Roseovarius sp. 217]
          Length = 160

 Score =  158 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 67/157 (42%), Positives = 96/157 (61%), Gaps = 1/157 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    I     +L   + I  +DLGTK IG+A+SD     A P   + R K T+ A  L 
Sbjct: 1   MIFEEIAGFAGALPRGRAIMGLDLGTKTIGVALSDRLWSVASPHETVKRVKFTEDAARLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +T  ++   I+GLP NM+GSEGPR  STRAF    + R    P  +WDERL+TV+A++
Sbjct: 61  DIMTGRDVGGIILGLPRNMDGSEGPRAQSTRAFAR-NLSRLTDAPIGYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
            L++ + +RK+R+Q +D+IAAA ILQ VLDR+S + +
Sbjct: 120 ALLEADATRKRRMQVIDNIAAAYILQGVLDRMSHMRA 156


>gi|260459185|ref|ZP_05807440.1| Holliday junction resolvase YqgF [Mesorhizobium opportunistum
           WSM2075]
 gi|259034739|gb|EEW35995.1| Holliday junction resolvase YqgF [Mesorhizobium opportunistum
           WSM2075]
          Length = 168

 Score =  157 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 82/158 (51%), Positives = 111/158 (70%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ IE L   L   + +A +DLG K IG+A+SD G  FAHPRP ++R+K +  A  LL
Sbjct: 1   MAVITIEQLPARLADGRTLAGLDLGDKTIGVAVSDRGFSFAHPRPVIIRRKFSLDAAVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  EN  A +IGLP+NM+GSEGPR   +RAFV NM  +   +PFVFWDERL+TV+A++
Sbjct: 61  ALLKKENAGAVVIGLPINMDGSEGPRAQKSRAFVRNM-AQLSDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            LI+M+ SR KR  K+DS AAA ILQ VLDR+  L +S
Sbjct: 120 TLIEMDFSRAKRAGKIDSAAAAFILQGVLDRLQSLAAS 157


>gi|116251833|ref|YP_767671.1| Holliday junction resolvase-like protein [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|146325598|sp|Q1MHJ8|RUVX_RHIL3 RecName: Full=Putative Holliday junction resolvase
 gi|115256481|emb|CAK07565.1| putative Holliday junction resolvase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 164

 Score =  157 bits (397), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 87/160 (54%), Positives = 119/160 (74%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L IE++ ++L P Q IA +DLGTK IGL++SD GRRFA PR  + R K    A  LL
Sbjct: 1   MTVLTIEEMAETLAPRQAIAGLDLGTKTIGLSMSDLGRRFATPRTVIRRVKFAIDAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F  +E +A F+IGLP+NM+GS GPRV +TRAFV NM ++K  +PFV+WDERL+TV+A++
Sbjct: 61  DFAQSEKVAGFVIGLPMNMDGSAGPRVQATRAFVRNM-EQKTALPFVYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L  S G
Sbjct: 120 TLLEMDVSRAKRAERIDSAAASFILQGALDRLSLLARSDG 159


>gi|149202250|ref|ZP_01879223.1| Holliday junction resolvase YqgF [Roseovarius sp. TM1035]
 gi|149144348|gb|EDM32379.1| Holliday junction resolvase YqgF [Roseovarius sp. TM1035]
          Length = 160

 Score =  157 bits (397), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 67/157 (42%), Positives = 95/157 (60%), Gaps = 1/157 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +  I     +L   + I  +DLGTK IG+A+SD     A P   + R K T  A  LL
Sbjct: 1   MILEEIAAFAAALPQGRAIMGLDLGTKTIGVALSDRLWSVASPHETVKRVKFTDDAARLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +    +   I+GLP NM+GSEGPR  STRAF    + R   VP  +WDERL+TV+A++
Sbjct: 61  QIVAGREVGGIILGLPRNMDGSEGPRAQSTRAFAR-NLSRLTEVPIGYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
            L++ + +RK+R+Q +D+IAAA ILQ VLDR+  + +
Sbjct: 120 ALLEADATRKRRMQVIDNIAAAYILQGVLDRMGHMRA 156


>gi|23015713|ref|ZP_00055482.1| COG0816: Predicted endonuclease involved in recombination (possible
           Holliday junction resolvase in Mycoplasmas and B.
           subtilis) [Magnetospirillum magnetotacticum MS-1]
          Length = 159

 Score =  157 bits (397), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 62/153 (40%), Positives = 95/153 (62%), Gaps = 1/153 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M IL   +L+ SL  +Q +  +DLG+K IGLA+SD  R  A P   + R K T+ A +LL
Sbjct: 5   MPILSPVELLGSLSRDQRLLGLDLGSKTIGLALSDVSRTIATPFDTIRRTKFTKDAEQLL 64

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  +++   ++GLP+ M+G EGPR  S R+F    + R   +P  +WDERL+T +  +
Sbjct: 65  AIVDKQDVGGLVLGLPVEMDGFEGPRCQSVRSFAA-NLARLRDMPIAYWDERLSTSAVTR 123

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
            L++ + SRK+R + VD +AAA ILQ +LD  S
Sbjct: 124 TLLEADSSRKRRAEVVDKMAAAYILQGLLDNRS 156


>gi|15888641|ref|NP_354322.1| hypothetical protein Atu1316 [Agrobacterium tumefaciens str. C58]
 gi|32130043|sp|Q8UFT1|RUVX_AGRT5 RecName: Full=Putative Holliday junction resolvase
 gi|15156369|gb|AAK87107.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 159

 Score =  156 bits (396), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 86/155 (55%), Positives = 117/155 (75%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+ L IE+L ++L+P Q IA +DLGTK IGLA+SD  RRFA PRP + R K TQ A  LL
Sbjct: 1   MATLTIEELAQTLQPAQAIAGLDLGTKTIGLAMSDLSRRFATPRPVIKRVKFTQDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +F   E +AAF+IGLP+NM+GS GPR  +TRAFV  M ++   +PF++WDERL+TV+A++
Sbjct: 61  AFAEKEKVAAFVIGLPINMDGSAGPRAQATRAFVRTMGEKTA-LPFIYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            L++M+VSR KR +++DS AA+ ILQ  LDR+S L
Sbjct: 120 ALLEMDVSRAKRAERIDSAAASFILQGALDRLSAL 154


>gi|312115158|ref|YP_004012754.1| Holliday junction resolvase YqgF [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220287|gb|ADP71655.1| Holliday junction resolvase YqgF [Rhodomicrobium vannielii ATCC
           17100]
          Length = 156

 Score =  156 bits (395), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 62/156 (39%), Positives = 103/156 (66%), Gaps = 3/156 (1%)

Query: 1   MS--ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE 58
           M   ++ + DL+  LK ++ +  +D+GTK +GLA+SD  R+ A P   + R K T  A++
Sbjct: 1   MPSELVPLPDLISRLKRDERLMGLDVGTKTVGLALSDVMRQIATPFDTIRRTKFTADAVK 60

Query: 59  LLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSA 118
           LL+    + +   ++GLP+N++G+EGPR  STRAFV   +     +P  FWDERL+T +A
Sbjct: 61  LLAHCKAQGVGGLVVGLPVNLDGTEGPRAQSTRAFVR-SLGALTDMPMAFWDERLSTAAA 119

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISF 154
           +++L++ + SRK+R + +D +AAA ILQ  LDR+++
Sbjct: 120 ERVLLEADASRKRRAEVIDKMAAAYILQGALDRVNY 155


>gi|83590476|ref|YP_430485.1| Holliday junction resolvase YqgF [Moorella thermoacetica ATCC
           39073]
 gi|146325578|sp|Q2RHZ7|RUVX_MOOTA RecName: Full=Putative Holliday junction resolvase
 gi|83573390|gb|ABC19942.1| Holliday junction resolvase YqgF [Moorella thermoacetica ATCC
           39073]
          Length = 140

 Score =  156 bits (395), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 52/136 (38%), Positives = 82/136 (60%), Gaps = 1/136 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+GTK IG+A+SDP    A     + R+ +      L   +    +   ++GLP
Sbjct: 1   MRIMGLDVGTKTIGVALSDPLGWTAQGLTTIRRRNLAADLAALKELVRRYGVEELVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNGS GP+  + RAF  + +  +V +P  F+DERLTTV+A ++L++ ++SR++R Q +
Sbjct: 61  RNMNGSLGPQAEAVRAFARH-LQAEVGLPVHFFDERLTTVAAGRVLLEADLSRRRRRQVI 119

Query: 137 DSIAAALILQEVLDRI 152
           D +AA  ILQ  LDR+
Sbjct: 120 DQVAATYILQGYLDRL 135


>gi|118597214|sp|Q2W6Y3|RUVX_MAGMM RecName: Full=Putative Holliday junction resolvase
          Length = 155

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 63/153 (41%), Positives = 93/153 (60%), Gaps = 1/153 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M IL   +L+ SL  +Q +  +DLG+K IGLA+SD  R  A P   + R K TQ A  LL
Sbjct: 1   MPILAPAELLASLSRDQRLLGLDLGSKTIGLALSDVSRTIATPFDTIRRTKFTQDAELLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  + +   ++GLP+ M+G EGPR  S R+F    + R   +P  +WDERL+T +  +
Sbjct: 61  AVVDKQGVGGLVLGLPVEMDGFEGPRCQSVRSFAA-NLARLRDMPIAYWDERLSTSAVTR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
            L++ + SRK+R + VD +AAA ILQ +LD  S
Sbjct: 120 TLLEADSSRKRRAEVVDKMAAAYILQGLLDNRS 152


>gi|114707193|ref|ZP_01440091.1| hypothetical protein FP2506_04781 [Fulvimarina pelagi HTCC2506]
 gi|114537389|gb|EAU40515.1| hypothetical protein FP2506_04781 [Fulvimarina pelagi HTCC2506]
          Length = 165

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 113/160 (70%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           MS++ IE+  ++LK  +P+A +DLGTK IG+A+SD   RFA+PR  L RKK TQ A  L 
Sbjct: 1   MSVVEIEEFAETLKLGKPLAGLDLGTKTIGVAVSDRSFRFANPRSVLKRKKFTQDAQALK 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  + ++A ++GLPLNM+GS GPR  +T+AF  N        P + WDERL+TV+A++
Sbjct: 61  AMLDADEVSAIVLGLPLNMDGSSGPRAQATKAFSRNY-AALDERPILLWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L+D+++SRKKR +++DS AAA+ILQ VLDR++ L    G
Sbjct: 120 NLLDIDMSRKKRGERIDSAAAAIILQGVLDRLANLTRCPG 159


>gi|144897944|emb|CAM74808.1| Holliday junction resolvase [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 163

 Score =  156 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 62/152 (40%), Positives = 90/152 (59%), Gaps = 1/152 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M IL I +L  +L  +  +  +DLGTK IGLA+SD     A P   + R K T+ A  L 
Sbjct: 1   MPILPIAELKTALPRHARLMGLDLGTKTIGLALSDVRLSIASPFDTIRRTKFTKDAEALF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +     A  ++GLP+ M+G+EG R  STRAF  N++     +P VFWDERL+T +  +
Sbjct: 61  AALDKHEAAGIVLGLPVEMDGTEGARCQSTRAFARNLLG-LRDLPIVFWDERLSTAAVTR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRI 152
            L++ + SR +R + VD +AAA ILQ  LD +
Sbjct: 120 TLLEADSSRARRAEVVDKMAAAYILQGALDFL 151


>gi|83310687|ref|YP_420951.1| putative Holliday junction resolvase [Magnetospirillum magneticum
           AMB-1]
 gi|82945528|dbj|BAE50392.1| Putative Holliday junction resolvase [Magnetospirillum magneticum
           AMB-1]
          Length = 159

 Score =  155 bits (393), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 63/153 (41%), Positives = 93/153 (60%), Gaps = 1/153 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M IL   +L+ SL  +Q +  +DLG+K IGLA+SD  R  A P   + R K TQ A  LL
Sbjct: 5   MPILAPAELLASLSRDQRLLGLDLGSKTIGLALSDVSRTIATPFDTIRRTKFTQDAELLL 64

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  + +   ++GLP+ M+G EGPR  S R+F    + R   +P  +WDERL+T +  +
Sbjct: 65  AVVDKQGVGGLVLGLPVEMDGFEGPRCQSVRSFAA-NLARLRDMPIAYWDERLSTSAVTR 123

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
            L++ + SRK+R + VD +AAA ILQ +LD  S
Sbjct: 124 TLLEADSSRKRRAEVVDKMAAAYILQGLLDNRS 156


>gi|49474241|ref|YP_032283.1| hypothetical protein BQ06360 [Bartonella quintana str. Toulouse]
 gi|62900974|sp|Q6FZS7|RUVX_BARQU RecName: Full=Putative Holliday junction resolvase
 gi|49239745|emb|CAF26127.1| hypothetical protein BQ06360 [Bartonella quintana str. Toulouse]
          Length = 159

 Score =  155 bits (391), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 80/160 (50%), Positives = 110/160 (68%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ I +++  L P Q IA +DLG K IG+A+SD G  F++PR  L RKK+T  A  L+
Sbjct: 1   MAVININEVITHLLPGQTIAGLDLGKKTIGIAVSDRGLTFSNPRSVLQRKKLTVDARTLI 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+   IIGLPLNMNGS GPR  +TR FV+NM +    +PFVFWDERL+T++A++
Sbjct: 61  QIFDRENVGVVIIGLPLNMNGSSGPRAQATRTFVNNM-EAYTEIPFVFWDERLSTIAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR  ++DS AAA ILQ  L+RI  L   +G
Sbjct: 120 SLLEMDVSRAKRATRIDSAAAAFILQGALNRIQNLHYMEG 159


>gi|254474193|ref|ZP_05087584.1| conserved hypothetical protein TIGR00250 [Pseudovibrio sp. JE062]
 gi|211956723|gb|EEA91932.1| conserved hypothetical protein TIGR00250 [Pseudovibrio sp. JE062]
          Length = 165

 Score =  155 bits (391), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 66/151 (43%), Positives = 94/151 (62%), Gaps = 1/151 (0%)

Query: 4   LLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFI 63
           L +ED   +L  +  +  IDLGTK IGLA++D GR+ A P   + RKK TQ    LL   
Sbjct: 7   LSLEDFCDALYDDDRLIGIDLGTKTIGLALTDSGRQIASPLETIKRKKFTQDVERLLDLC 66

Query: 64  TTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI 123
               +   +IGLPLNM+G+EGPR  +TRAFV   + +K  +P  +WDERL+T +  + LI
Sbjct: 67  HEHGVFGLVIGLPLNMDGTEGPRCQATRAFVR-NLAQKTEIPITYWDERLSTAAVTRTLI 125

Query: 124 DMNVSRKKRIQKVDSIAAALILQEVLDRISF 154
           + + SR +R + VD +AA  ILQ  LDR+++
Sbjct: 126 EADRSRARRAELVDKMAATYILQGFLDRVNY 156


>gi|49475587|ref|YP_033628.1| hypothetical protein BH08220 [Bartonella henselae str. Houston-1]
 gi|62900975|sp|Q6G3F1|RUVX_BARHE RecName: Full=Putative Holliday junction resolvase
 gi|49238394|emb|CAF27621.1| hypothetical protein BH08220 [Bartonella henselae str. Houston-1]
          Length = 159

 Score =  154 bits (390), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 81/160 (50%), Positives = 109/160 (68%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+I+ I +++  L P Q IA +DLGTK IG+A+SD G  F++PR  L R+K T  A  L+
Sbjct: 1   MAIININEVMIHLLPGQIIAGLDLGTKTIGIAVSDRGLIFSNPRSVLQRQKFTVDAQTLI 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+   IIGLPLNMNGS GPR  +TR FV NM +    +PFVFWDERL+T++A++
Sbjct: 61  KIFDHENVGVIIIGLPLNMNGSSGPRAQATRTFVRNM-EAYTEIPFVFWDERLSTIAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR  ++DS AAA ILQ  L+RI  L   +G
Sbjct: 120 SLLEMDVSRAKRATRIDSAAAAFILQGALNRIHNLHHIEG 159


>gi|262277133|ref|ZP_06054926.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
 gi|262224236|gb|EEY74695.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
          Length = 156

 Score =  154 bits (389), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 54/153 (35%), Positives = 85/153 (55%), Gaps = 1/153 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           +++   +D +  +  N  I  ID G K IGL++SDP ++ A P   +V KK  Q   EL 
Sbjct: 4   INLCDNKDFLIKVGKNSRILGIDPGKKNIGLSVSDPNQKIATPFKIIVMKKFKQFLEELN 63

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + I    I   +IG P+NM+G+ GPR  S R F    I +   +P   WDERL++  A  
Sbjct: 64  NIIREYEIKGIVIGNPINMDGTSGPRSQSARDFAQ-NISKNTKLPITLWDERLSSEGAFN 122

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
           ++ D++++  K+ + +D  AAA ILQ  LD ++
Sbjct: 123 LMGDLDINSSKKSKNLDQHAAAFILQGYLDFLN 155


>gi|325509094|gb|ADZ20730.1| Holliday junction resolvase-like protein [Clostridium
           acetobutylicum EA 2018]
          Length = 135

 Score =  153 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 52/136 (38%), Positives = 73/136 (53%), Gaps = 1/136 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  ID+G K IG+A+SDP    A     + RK   +   EL        +   + GLP
Sbjct: 1   MRILGIDVGNKTIGVALSDPLGFTAQGITTIRRKNEEEDIKELKELCEKYEVDTIVCGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ G +      F   +I + + VP   WDERLTTV+A + +++ ++SRKKR + V
Sbjct: 61  KNMNGTIGFQSEKVLGFCE-VIKQNIDVPIKMWDERLTTVAANRAMLEADLSRKKRKKLV 119

Query: 137 DSIAAALILQEVLDRI 152
           D +AA  ILQ  LD I
Sbjct: 120 DKVAATYILQGYLDSI 135


>gi|167645483|ref|YP_001683146.1| Holliday junction resolvase YqgF [Caulobacter sp. K31]
 gi|189046089|sp|B0T191|RUVX_CAUSK RecName: Full=Putative Holliday junction resolvase
 gi|167347913|gb|ABZ70648.1| Holliday junction resolvase YqgF [Caulobacter sp. K31]
          Length = 164

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 58/161 (36%), Positives = 94/161 (58%), Gaps = 1/161 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +L I +   ++    PI  +D G K IG+A+SD     A P   + + K ++ A  L 
Sbjct: 1   MPVLDIAEFAAAIPDYLPIVGLDPGEKTIGVAVSDVTLTVASPLALIKKTKFSEDAATLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + +   A  +IGLP+NM+G+EG R  S RA   N++  + ++P  FWDERL+T +  +
Sbjct: 61  QLMGSRKAAGIVIGLPMNMDGTEGVRCQSNRALGRNLLRLQPHIPITFWDERLSTAAVTR 120

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           +LI + +V+RK+R + VD +AAA ILQ  L+R+  +  + G
Sbjct: 121 VLIEEHDVNRKRRAEVVDKMAAAWILQGALERMRGIAEAAG 161


>gi|114771780|ref|ZP_01449173.1| hypothetical protein OM2255_12592 [alpha proteobacterium HTCC2255]
 gi|114547596|gb|EAU50487.1| hypothetical protein OM2255_12592 [alpha proteobacterium HTCC2255]
          Length = 156

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 57/148 (38%), Positives = 88/148 (59%), Gaps = 1/148 (0%)

Query: 8   DLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN 67
           +    L   + +  +DLGTK IG+A+SD     A PR  + RKK       L +   + +
Sbjct: 9   EFASELTKFKSLIGLDLGTKTIGIAVSDTLWTVATPRETIKRKKFGIDCDALQTVFNSTD 68

Query: 68  IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV 127
               I+GLP+NM+GSEGPR  +TRAF    +  +  +P  FWDERL++V+A++ +++ ++
Sbjct: 69  TGGIILGLPMNMDGSEGPRCQATRAFAR-NLSSRCDIPITFWDERLSSVAAERAMLEADM 127

Query: 128 SRKKRIQKVDSIAAALILQEVLDRISFL 155
           SR KR   +D +AA+ ILQ  LDRI  +
Sbjct: 128 SRAKRADNIDHVAASFILQGALDRIGNI 155


>gi|220931424|ref|YP_002508332.1| Holliday junction resolvase YqgF [Halothermothrix orenii H 168]
 gi|254767518|sp|B8D2B0|RUVX_HALOH RecName: Full=Putative Holliday junction resolvase
 gi|219992734|gb|ACL69337.1| Holliday junction resolvase YqgF [Halothermothrix orenii H 168]
          Length = 140

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 52/139 (37%), Positives = 80/139 (57%), Gaps = 1/139 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D G +RIG+AISD     A  +  ++RK   +    +   I    +   I+G+P
Sbjct: 1   MRIMGLDYGDRRIGVAISDKLGMTAQGQEVIIRKTPEEDLEVIKGLIDKYEVEEIIVGMP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NM+GS GPR   TR F+   + + +  P   WDERL+TV A+++LI+ +VSRKKR   +
Sbjct: 61  KNMDGSLGPRAEKTRDFIDF-LQKSLDTPVKVWDERLSTVEAERVLIEADVSRKKRKGVI 119

Query: 137 DSIAAALILQEVLDRISFL 155
           D +AA++ILQ  L+  + L
Sbjct: 120 DKVAASIILQGYLNYQNKL 138


>gi|239833964|ref|ZP_04682292.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301]
 gi|239822027|gb|EEQ93596.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301]
          Length = 165

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 79/158 (50%), Positives = 109/158 (68%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ IE++   L+P + IA +DLGTK IGLA+SD G  FAHPRP + R K +  A  LL
Sbjct: 1   MAVVEIEEIPALLQPGKTIAGLDLGTKTIGLAVSDLGLSFAHPRPVIKRVKFSIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +  + +   +IGLP+NM+G+ GPRV +TRAFV  M      +PFVFWDERL+TV+A++
Sbjct: 61  KALDADKVGVIVIGLPMNMDGTSGPRVQATRAFVRTM-QPLTDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            LI M+VSR KR +++DS AAA ILQ  LDR+  +  S
Sbjct: 120 ALIGMDVSRGKRAERIDSAAAAFILQGALDRLHSIRRS 157


>gi|15894957|ref|NP_348306.1| Holliday junction resolvase-like protein [Clostridium
           acetobutylicum ATCC 824]
 gi|32130056|sp|Q97IG1|RUVX_CLOAB RecName: Full=Putative Holliday junction resolvase
 gi|15024643|gb|AAK79646.1|AE007678_2 Predicted endonuclease involved in recombination [Clostridium
           acetobutylicum ATCC 824]
          Length = 135

 Score =  152 bits (384), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 51/136 (37%), Positives = 73/136 (53%), Gaps = 1/136 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  ID+G K IG+A+SDP    A     + RK   +   EL        +   + GLP
Sbjct: 1   MRILGIDVGNKTIGVALSDPLGFTAQGITTIRRKNEEEDIKELKELCEKYEVDTIVCGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ G +      F   +I + + VP   WDERLTTV+A + +++ ++SRKKR + V
Sbjct: 61  KNMNGTIGFQSEKVLGFCE-VIKQNINVPIKMWDERLTTVTANRAMLEADLSRKKRKKLV 119

Query: 137 DSIAAALILQEVLDRI 152
           D +AA  ILQ  L+ I
Sbjct: 120 DKVAATYILQGYLNSI 135


>gi|295690146|ref|YP_003593839.1| Holliday junction resolvase YqgF [Caulobacter segnis ATCC 21756]
 gi|295432049|gb|ADG11221.1| Holliday junction resolvase YqgF [Caulobacter segnis ATCC 21756]
          Length = 156

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 60/156 (38%), Positives = 91/156 (58%), Gaps = 1/156 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +L IED   +L    P+  +D G K IG+A+SD  R  A P   + + K ++ A  L 
Sbjct: 1   MPVLDIEDFAAALPQYAPVVGLDPGEKTIGVAVSDVTRTVASPLALIEKTKFSKDAEALF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + +      +IGLP+NM+G+EG R  S RA   N++  K  +P  FWDERL+T +  +
Sbjct: 61  KLMDSRGAVGIVIGLPMNMDGTEGVRCQSNRALGRNLLRLKPDLPITFWDERLSTAAVTR 120

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           +LI + +V+RK+R + VD +AA  ILQ  L+R+  L
Sbjct: 121 VLIEEHDVNRKRRAEVVDKMAAGWILQGALERLRGL 156


>gi|115525369|ref|YP_782280.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris
           BisA53]
 gi|122295574|sp|Q07L84|RUVX_RHOP5 RecName: Full=Putative Holliday junction resolvase
 gi|115519316|gb|ABJ07300.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris
           BisA53]
          Length = 163

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 66/159 (41%), Positives = 90/159 (56%), Gaps = 1/159 (0%)

Query: 2   SILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS 61
            IL + +      P   +  +DLGTK IG+A+SDP RR A     ++RK  T  A  LL+
Sbjct: 4   PILPLIEAAAQWPPTGALIGLDLGTKTIGVAVSDPARRLATGVETILRKTFTTDAARLLA 63

Query: 62  FITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQI 121
             T       ++GLP+NM+ SEGPR  STRAF    + R   +P   WDERL+T + ++ 
Sbjct: 64  LATERKAVGLVLGLPINMDASEGPRAQSTRAFAR-NLARLTELPIGLWDERLSTAAVERE 122

Query: 122 LIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           LI  +VSR KR + +D  AA  ILQ  LDR++ L  S G
Sbjct: 123 LIANDVSRAKRAKVIDEHAAIFILQGALDRLAVLNRSTG 161


>gi|159043613|ref|YP_001532407.1| Holliday junction resolvase-like protein [Dinoroseobacter shibae
           DFL 12]
 gi|157911373|gb|ABV92806.1| holliday junction resolvase YqgF [Dinoroseobacter shibae DFL 12]
          Length = 163

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 59/159 (37%), Positives = 87/159 (54%), Gaps = 1/159 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    +      +   + +  +DLGT  IG+A+SD     A P   + RKK    A  L 
Sbjct: 3   MIFDDLAAFRAVVPAGRALMGLDLGTATIGVAVSDLMWSVATPLETVKRKKFGLDAARLE 62

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +   ++   I+GLP NM+GSEGPR  STRAF  N   R   +P  FWDERL+TV+A++
Sbjct: 63  ALMDARDVGGLILGLPRNMDGSEGPRAQSTRAFARNFTAR-RPIPIAFWDERLSTVAAER 121

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
            L++ + SR +R + +D +AA+ ILQ  LDR   +    
Sbjct: 122 ALLEADTSRARRAEVIDHVAASYILQGALDRFGHMRREA 160


>gi|158424464|ref|YP_001525756.1| holliday junction resolvase [Azorhizobium caulinodans ORS 571]
 gi|158331353|dbj|BAF88838.1| holliday junction resolvase [Azorhizobium caulinodans ORS 571]
          Length = 185

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 64/148 (43%), Positives = 89/148 (60%), Gaps = 1/148 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           + ++  +L     +  +DLGTK IG+A  DP RR A     + R K TQ A  L+   + 
Sbjct: 35  LAEIAAALPERGSLLGLDLGTKTIGVATCDPDRRLATVVETVKRTKFTQDAERLMVLASE 94

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
               AF++GLPLNM+GSEGPRV ++RAF  N   R   +P  FWDERL+TV+ ++ LI  
Sbjct: 95  RKAVAFVLGLPLNMDGSEGPRVQASRAFARNF-ARLSGLPIAFWDERLSTVAVERALISA 153

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRIS 153
           +VSR KR   +D  AAA ILQ  +D ++
Sbjct: 154 DVSRAKRANVIDQHAAAFILQGAIDFLN 181


>gi|306841755|ref|ZP_07474441.1| conserved hypothetical protein [Brucella sp. BO2]
 gi|306288160|gb|EFM59547.1| conserved hypothetical protein [Brucella sp. BO2]
          Length = 162

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 81/158 (51%), Positives = 108/158 (68%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+   IE++   LKP Q +A +DLGTK IGLA+SD G  FAHPRP + R K T  A  LL
Sbjct: 1   MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAHPRPVIKRVKFTIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + T+ +   +IGLP+NM+G+ GPRV +TRAFV  M      +PFVFWDERL+TV+A++
Sbjct: 61  KALETDKVGVIVIGLPMNMDGTAGPRVQATRAFVRTM-QPLTDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            LI M+VSR KR +++DS AAA ILQ  LDR+  +  +
Sbjct: 120 ALIGMDVSRGKRAERIDSAAAAFILQGALDRLHMMRRN 157


>gi|319407285|emb|CBI80926.1| putative resolvase [Bartonella sp. 1-1C]
          Length = 163

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 84/158 (53%), Positives = 112/158 (70%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+I+ I ++   L   Q IAS+DLGTK IG+AISD    F++PRP + RKK T  AL L+
Sbjct: 1   MTIISINEVKTHLSLGQTIASLDLGTKTIGIAISDISLTFSNPRPVIYRKKFTLDALTLI 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+ A IIGLPLNMNGS GPRV +T+ FV NM      +PFVFWDERL+T++A++
Sbjct: 61  QIFNNENVGAIIIGLPLNMNGSNGPRVQATKTFVSNM-ATYTEIPFVFWDERLSTIAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           +L++M++SR KR  ++DS AAA ILQ  LDRI  L+S+
Sbjct: 120 LLLEMDMSRSKRKSRIDSAAAAFILQGALDRIKTLQSN 157


>gi|163868299|ref|YP_001609508.1| putative resolvase [Bartonella tribocorum CIP 105476]
 gi|189046086|sp|A9IU51|RUVX_BART1 RecName: Full=Putative Holliday junction resolvase
 gi|161017955|emb|CAK01513.1| putative resolvase [Bartonella tribocorum CIP 105476]
          Length = 156

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 83/157 (52%), Positives = 110/157 (70%), Gaps = 1/157 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ I +++  L P Q IA +DLGTK IG+AISD G   ++PRP L RKK T+ A  L+
Sbjct: 1   MTVININEIMTHLLPGQTIAGLDLGTKTIGIAISDMGLTVSNPRPVLQRKKFTEDAHRLI 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+   +IGLPLNMNGS G RV +TRAFV NM      +PFVFWDERL+T++A++
Sbjct: 61  KIFDHENVGVIVIGLPLNMNGSSGSRVQATRAFVSNM-KAYTKIPFVFWDERLSTIAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
            L++MNVSR KR +++DS AAA ILQ  L+RI  L S
Sbjct: 120 SLLEMNVSRIKRARRIDSAAAAFILQGALNRIENLHS 156


>gi|254720416|ref|ZP_05182227.1| Holliday junction resolvase-like protein [Brucella sp. 83/13]
 gi|265985435|ref|ZP_06098170.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306839007|ref|ZP_07471828.1| conserved hypothetical protein [Brucella sp. NF 2653]
 gi|264664027|gb|EEZ34288.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306405913|gb|EFM62171.1| conserved hypothetical protein [Brucella sp. NF 2653]
          Length = 162

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 81/158 (51%), Positives = 108/158 (68%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+   IE++   LKP Q +A +DLGTK IGLA+SD G  FAHPRP + R K T  A  LL
Sbjct: 1   MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAHPRPVIKRVKFTIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + T+ +   +IGLP+NM+G+ GPRV +TRAFV  M      +PFVFWDERL+TV+A++
Sbjct: 61  KALETDKVGVIVIGLPMNMDGTAGPRVQATRAFVRTM-QPLTDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            LI M+VSR KR +++DS AAA ILQ  LDR+  +  +
Sbjct: 120 ALIGMDVSRGKRAERIDSAAAAFILQGALDRLHMMRRN 157


>gi|240850656|ref|YP_002972056.1| putative Holliday junction resolvase [Bartonella grahamii as4aup]
 gi|240267779|gb|ACS51367.1| putative Holliday junction resolvase [Bartonella grahamii as4aup]
          Length = 159

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 83/160 (51%), Positives = 108/160 (67%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M ++ I +++  L P Q IA +DLGTK IG+AISD G   ++PRP L RKK T+ A  L+
Sbjct: 1   MIVININEVMTHLLPGQTIAGLDLGTKTIGIAISDMGLTVSNPRPVLQRKKFTEDAYTLI 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+   IIGLPLNMNGS G RV +TRAFV NM      +PFVFWDERL+T++A++
Sbjct: 61  KIFDRENVGVIIIGLPLNMNGSSGSRVQATRAFVSNM-KAYTKIPFVFWDERLSTIAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++MNVSR KR  ++DS AAA ILQ  L+RI      +G
Sbjct: 120 SLLEMNVSRAKRASRIDSAAAAFILQGALNRIQNFHHMEG 159


>gi|209884927|ref|YP_002288784.1| holliday junction resolvase YqgF [Oligotropha carboxidovorans OM5]
 gi|209873123|gb|ACI92919.1| holliday junction resolvase YqgF [Oligotropha carboxidovorans OM5]
          Length = 204

 Score =  151 bits (381), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 65/158 (41%), Positives = 89/158 (56%), Gaps = 1/158 (0%)

Query: 2   SILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS 61
            IL + D      P   +  +DLGTK IG+A+SDP RR A     + RK  T+ A ELL 
Sbjct: 46  PILPLIDAAALWAPRGALIGLDLGTKTIGVAVSDPDRRLATGVTTIQRKNFTKDAAELLK 105

Query: 62  FITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQI 121
                  A F++GLP+NM+GSEGPR  STRAF  N   +   +    WDERL+T + ++ 
Sbjct: 106 ISGERACAGFVLGLPINMDGSEGPRAQSTRAFARNF-AKLTELAIGLWDERLSTAAVERE 164

Query: 122 LIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           L+  +VSR +R + +D  AA  ILQ  LDR++ L    
Sbjct: 165 LLANDVSRARRAEVIDEHAAIFILQGALDRLTALRRQA 202


>gi|23500341|ref|NP_699781.1| Holliday junction resolvase-like protein [Brucella suis 1330]
 gi|161620659|ref|YP_001594545.1| hypothetical protein BCAN_B0598 [Brucella canis ATCC 23365]
 gi|163844749|ref|YP_001622404.1| hypothetical protein BSUIS_B0594 [Brucella suis ATCC 23445]
 gi|225629090|ref|ZP_03787123.1| conserved hypothetical protein [Brucella ceti str. Cudo]
 gi|225686383|ref|YP_002734355.1| Holliday junction resolvase-like protein [Brucella melitensis ATCC
           23457]
 gi|254699833|ref|ZP_05161661.1| Holliday junction resolvase-like protein [Brucella suis bv. 5 str.
           513]
 gi|254702971|ref|ZP_05164799.1| Holliday junction resolvase-like protein [Brucella suis bv. 3 str.
           686]
 gi|254705907|ref|ZP_05167735.1| Holliday junction resolvase-like protein [Brucella pinnipedialis
           M163/99/10]
 gi|254711134|ref|ZP_05172945.1| Holliday junction resolvase-like protein [Brucella pinnipedialis
           B2/94]
 gi|256015374|ref|YP_003105383.1| putative Holliday junction resolvase [Brucella microti CCM 4915]
 gi|256029515|ref|ZP_05443129.1| Holliday junction resolvase-like protein [Brucella pinnipedialis
           M292/94/1]
 gi|256059210|ref|ZP_05449416.1| Holliday junction resolvase-like protein [Brucella neotomae 5K33]
 gi|256111486|ref|ZP_05452500.1| Holliday junction resolvase-like protein [Brucella melitensis bv. 3
           str. Ether]
 gi|256157710|ref|ZP_05455628.1| Holliday junction resolvase-like protein [Brucella ceti M490/95/1]
 gi|256253318|ref|ZP_05458854.1| Holliday junction resolvase-like protein [Brucella ceti B1/94]
 gi|256262476|ref|ZP_05465008.1| ribonuclease RNase H [Brucella melitensis bv. 2 str. 63/9]
 gi|260167394|ref|ZP_05754205.1| Holliday junction resolvase-like protein [Brucella sp. F5/99]
 gi|260568115|ref|ZP_05838584.1| ribonuclease RNase H fold containing protein [Brucella suis bv. 4
           str. 40]
 gi|261220434|ref|ZP_05934715.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261313336|ref|ZP_05952533.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261318725|ref|ZP_05957922.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261323159|ref|ZP_05962356.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261750307|ref|ZP_05994016.1| holliday junction resolvase YqgF [Brucella suis bv. 5 str. 513]
 gi|261753580|ref|ZP_05997289.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261756804|ref|ZP_06000513.1| ribonuclease RNase H fold containing protein [Brucella sp. F5/99]
 gi|265986523|ref|ZP_06099080.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265992983|ref|ZP_06105540.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265996215|ref|ZP_06108772.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|306845931|ref|ZP_07478498.1| conserved hypothetical protein [Brucella sp. BO1]
 gi|32130035|sp|Q8FW65|RUVX_BRUSU RecName: Full=Putative Holliday junction resolvase
 gi|189046087|sp|A9MBN7|RUVX_BRUC2 RecName: Full=Putative Holliday junction resolvase
 gi|189046088|sp|A9WYR6|RUVX_BRUSI RecName: Full=Putative Holliday junction resolvase
 gi|254767499|sp|C0RLB8|RUVX_BRUMB RecName: Full=Putative Holliday junction resolvase
 gi|23463956|gb|AAN33786.1| conserved hypothetical protein TIGR00250 [Brucella suis 1330]
 gi|161337470|gb|ABX63774.1| conserved hypothetical protein [Brucella canis ATCC 23365]
 gi|163675472|gb|ABY39582.1| conserved hypothetical protein [Brucella suis ATCC 23445]
 gi|225615586|gb|EEH12635.1| conserved hypothetical protein [Brucella ceti str. Cudo]
 gi|225642488|gb|ACO02401.1| conserved hypothetical protein [Brucella melitensis ATCC 23457]
 gi|255998034|gb|ACU49721.1| putative Holliday junction resolvase [Brucella microti CCM 4915]
 gi|260154780|gb|EEW89861.1| ribonuclease RNase H fold containing protein [Brucella suis bv. 4
           str. 40]
 gi|260919018|gb|EEX85671.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261297948|gb|EEY01445.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261299139|gb|EEY02636.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261302362|gb|EEY05859.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261736788|gb|EEY24784.1| ribonuclease RNase H fold containing protein [Brucella sp. F5/99]
 gi|261740060|gb|EEY27986.1| holliday junction resolvase YqgF [Brucella suis bv. 5 str. 513]
 gi|261743333|gb|EEY31259.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262550512|gb|EEZ06673.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262763853|gb|EEZ09885.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263092212|gb|EEZ16509.1| ribonuclease RNase H [Brucella melitensis bv. 2 str. 63/9]
 gi|264658720|gb|EEZ28981.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|306273566|gb|EFM55411.1| conserved hypothetical protein [Brucella sp. BO1]
 gi|326410755|gb|ADZ67819.1| Holliday junction resolvase-like protein [Brucella melitensis M28]
 gi|326554047|gb|ADZ88686.1| Holliday junction resolvase-like protein [Brucella melitensis
           M5-90]
          Length = 162

 Score =  151 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 81/158 (51%), Positives = 107/158 (67%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+   IE++   LKP Q +A +DLGTK IGLA+SD G  FAHPRP + R K T  A  LL
Sbjct: 1   MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAHPRPVIKRVKFTIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + T+ +   +IGLP+NM+G+ GPRV +TRAFV  M      +PFVFWDERL+TV+A++
Sbjct: 61  KALETDKVGVIVIGLPMNMDGTAGPRVQATRAFVRTM-QPLTDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            LI M+VSR KR  ++DS AAA ILQ  LDR+  +  +
Sbjct: 120 ALIGMDVSRGKRADRIDSAAAAFILQGALDRLHMMRRN 157


>gi|288958770|ref|YP_003449111.1| holliday junction resolvase [Azospirillum sp. B510]
 gi|288911078|dbj|BAI72567.1| holliday junction resolvase [Azospirillum sp. B510]
          Length = 178

 Score =  150 bits (380), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 68/162 (41%), Positives = 96/162 (59%), Gaps = 5/162 (3%)

Query: 3   ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSF 62
           I  +EDL   L  NQ +  +D+GTK +GLA++DPG   A P   L R K TQ A EL   
Sbjct: 2   IHTLEDLAARLGRNQRLLGLDVGTKTVGLAVADPGLIVASPIGTLKRTKFTQDARELGKT 61

Query: 63  ITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRK----VYVPFVFWDERLTTVSA 118
           I    I   ++GLPLNM+GSEGPR  S RAF +N+++R           FWDERL+T + 
Sbjct: 62  IRDYGIGGLVVGLPLNMDGSEGPRAESVRAFANNLLERSDLLGWEAEIAFWDERLSTSAV 121

Query: 119 QQILI-DMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           ++ +I + +++RK+R + VD +AAA ILQ  LD ++      
Sbjct: 122 ERFMIGEADMTRKRRDEVVDKMAAAYILQGALDMLANQRRLA 163


>gi|254712407|ref|ZP_05174218.1| Holliday junction resolvase-like protein [Brucella ceti M644/93/1]
 gi|254715479|ref|ZP_05177290.1| Holliday junction resolvase-like protein [Brucella ceti M13/05/1]
 gi|261217214|ref|ZP_05931495.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261320085|ref|ZP_05959282.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260922303|gb|EEX88871.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292775|gb|EEX96271.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 162

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 80/158 (50%), Positives = 107/158 (67%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+   IE++   LKP Q +A +DLGTK IGLA+SD G  FA+PRP + R K T  A  LL
Sbjct: 1   MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAYPRPVIKRVKFTIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + T+ +   +IGLP+NM+G+ GPRV +TRAFV  M      +PFVFWDERL+TV+A++
Sbjct: 61  KALETDKVGVIVIGLPMNMDGTAGPRVQATRAFVRTM-QPLTDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            LI M+VSR KR  ++DS AAA ILQ  LDR+  +  +
Sbjct: 120 ALIGMDVSRGKRADRIDSAAAAFILQGALDRLHMMRRN 157


>gi|126725473|ref|ZP_01741315.1| hypothetical protein RB2150_04693 [Rhodobacterales bacterium
           HTCC2150]
 gi|126704677|gb|EBA03768.1| hypothetical protein RB2150_04693 [Rhodobacterales bacterium
           HTCC2150]
          Length = 156

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 66/156 (42%), Positives = 90/156 (57%), Gaps = 2/156 (1%)

Query: 1   MSIL-LIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALEL 59
           M+I+    +   SLK   PI ++D G K IG+A SD  R  A P   + R K T  A  L
Sbjct: 1   MAIIEDFVEFGSSLKEMSPIFALDFGDKTIGIATSDIFRNIATPLETIRRTKFTADAERL 60

Query: 60  LSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQ 119
           L       +  F++GLP NM+GSEG R   TRAF    ++R   +   FWDERL+TV+A+
Sbjct: 61  LELAKQRQVTGFVLGLPRNMDGSEGVRCQKTRAFAR-NLERLTEINIAFWDERLSTVAAE 119

Query: 120 QILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           + LI+ + SR KR Q +D +AA  ILQ  LDR++ L
Sbjct: 120 RALIEADTSRAKRAQIIDHVAAGYILQGALDRLAHL 155


>gi|319898952|ref|YP_004159045.1| resolvase [Bartonella clarridgeiae 73]
 gi|319402916|emb|CBI76467.1| putative resolvase [Bartonella clarridgeiae 73]
          Length = 164

 Score =  150 bits (379), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 80/158 (50%), Positives = 109/158 (68%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+I+ I ++   L   Q IAS+DLGTK IG+AISD    F++PRP + RKK T  AL L+
Sbjct: 1   MAIININEVTTHLLLGQTIASLDLGTKTIGIAISDISLTFSNPRPVIHRKKFTLDALTLV 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+ A +IGLP+NM+GS GPRV +T+ FV NM      +PFVFWDERL+T +A++
Sbjct: 61  KVFNNENVGAIVIGLPINMDGSNGPRVQATKTFVSNM-AMYTKIPFVFWDERLSTTAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L+++++SR KR  ++DS AAA ILQ  LDRI  L S+
Sbjct: 120 YLLEIDMSRSKRKSRIDSAAAAFILQGALDRIQTLPSN 157


>gi|238926881|ref|ZP_04658641.1| YqgF family crossover junction endodeoxyribonuclease [Selenomonas
           flueggei ATCC 43531]
 gi|238885413|gb|EEQ49051.1| YqgF family crossover junction endodeoxyribonuclease [Selenomonas
           flueggei ATCC 43531]
          Length = 143

 Score =  150 bits (379), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 50/143 (34%), Positives = 72/143 (50%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            +   S+DLG   IG+A+SD     A     + R  +      L   +    + A + GL
Sbjct: 1   MKRYMSLDLGDATIGIAVSDLLGLTAQGVETVRRTNIEADLAHLGQLMQEYEVDALVAGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MNG EG R    RAF+  + +        +WDERL+TV+A + LI  +VSRKKR + 
Sbjct: 61  PKHMNGDEGERCSIVRAFMAEVEEHFPGTEVHYWDERLSTVAASRALIAGDVSRKKRRKV 120

Query: 136 VDSIAAALILQEVLDRISFLESS 158
           +D +AA  ILQ  LDR +     
Sbjct: 121 IDKMAAVYILQGFLDRQNMGNHG 143


>gi|319404280|emb|CBI77873.1| putative resolvase [Bartonella rochalimae ATCC BAA-1498]
          Length = 163

 Score =  150 bits (379), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 84/158 (53%), Positives = 112/158 (70%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+I+ I +++  L   Q IAS+DLGTK IG+AISD    F++PRP + RKK T  AL L+
Sbjct: 1   MAIISINEVMTHLSLGQTIASLDLGTKTIGIAISDISLTFSNPRPVIYRKKFTLDALTLI 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+ A IIGLPLNMNGS GPRV +T+ FV NM      +PFVFWDERL+T++A++
Sbjct: 61  QIFNNENVGAIIIGLPLNMNGSNGPRVQATKTFVSNM-ATYTEIPFVFWDERLSTIAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           +L++M++SR KR  ++DS AAA ILQ  LDRI  L S+
Sbjct: 120 LLLEMDMSRSKRKSRIDSAAAAFILQGALDRIKTLPSN 157


>gi|255527853|ref|ZP_05394701.1| Holliday junction resolvase YqgF [Clostridium carboxidivorans P7]
 gi|296185454|ref|ZP_06853864.1| RNAse H-fold protein YqgF [Clostridium carboxidivorans P7]
 gi|255508464|gb|EET84856.1| Holliday junction resolvase YqgF [Clostridium carboxidivorans P7]
 gi|296050288|gb|EFG89712.1| RNAse H-fold protein YqgF [Clostridium carboxidivorans P7]
          Length = 138

 Score =  150 bits (379), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 75/138 (54%), Gaps = 1/138 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G + IG+A+SDP    A     + RK       EL +     N+   + GLP
Sbjct: 1   MRILGLDVGDRTIGVAVSDPLGFTAQGITTIRRKSQDADIKELKNICDEYNVETIVSGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP+      F   +I  K+ +P   WDERLTTV+A + +++ ++SR KR + V
Sbjct: 61  KNMNGTLGPQSEKVLKFCE-VIKEKIGLPIKMWDERLTTVAAHRAMLEADLSRNKRKKIV 119

Query: 137 DSIAAALILQEVLDRISF 154
           D +AA  ILQ  LD IS 
Sbjct: 120 DKMAAIYILQGYLDSISN 137


>gi|226311491|ref|YP_002771385.1| Holliday junction resolvase [Brevibacillus brevis NBRC 100599]
 gi|226094439|dbj|BAH42881.1| putative Holliday junction resolvase [Brevibacillus brevis NBRC
           100599]
          Length = 138

 Score =  150 bits (379), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 80/138 (57%), Gaps = 1/138 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              +  +D+G K IG+A+SD     A     + R+   +    L   ++   I AF++GL
Sbjct: 1   MTRLMGLDVGDKTIGVAVSDELGWTAQGVETIKRQSKEKDFARLSELVSQYQIGAFVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMNG+ GPR    +AF   +++ +  +P   WDERLTT++A+++LI  +VSR+KR   
Sbjct: 61  PKNMNGTIGPRAEMCQAFGK-LLEERTSLPVHMWDERLTTMAAERMLISADVSRQKRKTV 119

Query: 136 VDSIAAALILQEVLDRIS 153
           +D +AA LILQ  LD  S
Sbjct: 120 IDKMAATLILQGYLDAKS 137


>gi|302874707|ref|YP_003843340.1| Holliday junction resolvase YqgF [Clostridium cellulovorans 743B]
 gi|307690680|ref|ZP_07633126.1| Holliday junction resolvase-like protein [Clostridium cellulovorans
           743B]
 gi|302577564|gb|ADL51576.1| Holliday junction resolvase YqgF [Clostridium cellulovorans 743B]
          Length = 135

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 75/136 (55%), Gaps = 1/136 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             +  +D+G K IG+A+SDP    A     + RK +      ++++     +   ++GLP
Sbjct: 1   MRVLGLDVGNKTIGVAVSDPLGFTAQGITTINRKNIKTDIETVVNYCNEYTVDTIVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP+     AFV   + +   +    WDERLTTV+A + +++ ++SR KR + V
Sbjct: 61  KNMNGTLGPQSEKVMAFVE-KLKKNTDINIKMWDERLTTVAAHKAMLEADLSRAKRNKIV 119

Query: 137 DSIAAALILQEVLDRI 152
           D +AA  ILQ  LD I
Sbjct: 120 DKVAATYILQGYLDSI 135


>gi|154253281|ref|YP_001414105.1| Holliday junction resolvase YqgF [Parvibaculum lavamentivorans
           DS-1]
 gi|154157231|gb|ABS64448.1| Holliday junction resolvase YqgF [Parvibaculum lavamentivorans
           DS-1]
          Length = 182

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 62/154 (40%), Positives = 93/154 (60%), Gaps = 1/154 (0%)

Query: 2   SILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS 61
           ++  + +L   L  N+ +  +DLG+K IGLA+SD     A P   + R K T  A  L++
Sbjct: 30  NLKPLAELKVGLGRNRRLIGVDLGSKTIGLALSDVSLSIASPLETIRRTKFTADAERLIA 89

Query: 62  FITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQI 121
                +  A + GLPLNM+G+EGPR  STRAF+   +++   +P  FWDERL+T++  + 
Sbjct: 90  LAKEHDAGALVFGLPLNMDGTEGPRCQSTRAFIR-NLEKLTDLPIAFWDERLSTMAVTRT 148

Query: 122 LIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           L+D + SR +R + VD +AAA ILQ  LDR+  L
Sbjct: 149 LLDADASRARRAELVDKMAAAYILQGALDRLRKL 182


>gi|153010985|ref|YP_001372199.1| Holliday junction resolvase YqgF [Ochrobactrum anthropi ATCC 49188]
 gi|167012742|sp|A6X566|RUVX_OCHA4 RecName: Full=Putative Holliday junction resolvase
 gi|151562873|gb|ABS16370.1| Holliday junction resolvase YqgF [Ochrobactrum anthropi ATCC 49188]
          Length = 165

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 78/159 (49%), Positives = 107/159 (67%), Gaps = 1/159 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ IE++   L+  Q IA +DLGTK IGLA+SD G  FAHPRP + R K +  A  LL
Sbjct: 1   MAVVEIEEIPALLQSGQTIAGLDLGTKTIGLAVSDLGLSFAHPRPVIKRVKFSIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +  + +   +IGLP+NM+G+ GPRV +TRAFV  M      +PFVFWDERL+TV+A++
Sbjct: 61  KALDADKVGVIVIGLPMNMDGTSGPRVQATRAFVRTM-QPLTDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
            LI M+VSR KR  ++DS AA+ ILQ  LDR+  +  S 
Sbjct: 120 ALIGMDVSRGKRADRIDSAAASFILQGALDRLHSIRRSA 158


>gi|260886204|ref|ZP_05897467.1| putative holliday junction resolvase [Selenomonas sputigena ATCC
           35185]
 gi|330838890|ref|YP_004413470.1| Holliday junction resolvase [Selenomonas sputigena ATCC 35185]
 gi|260864067|gb|EEX78567.1| putative holliday junction resolvase [Selenomonas sputigena ATCC
           35185]
 gi|329746654|gb|AEC00011.1| Holliday junction resolvase [Selenomonas sputigena ATCC 35185]
          Length = 149

 Score =  150 bits (378), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 73/137 (53%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            + + ++D+G + IG+A SD     A     + RK   +    L   +       FI+GL
Sbjct: 2   RKRVLALDVGDRTIGVAASDGLGLTAQGVETIRRKSWDKDFARLKELMELYETDTFIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMNG++G R    R F   +  +      VFWDERL+TV+A++ LI  +VSR KR + 
Sbjct: 62  PKNMNGTQGERCDVVRDFAQRLQKKFKGSQVVFWDERLSTVAAERSLIAADVSRAKRRKV 121

Query: 136 VDSIAAALILQEVLDRI 152
           +D +AA  ILQ  LD +
Sbjct: 122 IDKMAAVFILQGYLDNL 138


>gi|62317546|ref|YP_223399.1| Holliday junction resolvase-like protein [Brucella abortus bv. 1
           str. 9-941]
 gi|83269527|ref|YP_418818.1| Holliday junction resolvase-like protein [Brucella melitensis
           biovar Abortus 2308]
 gi|189022801|ref|YP_001932542.1| Ribonuclease RNase H fold containing [Brucella abortus S19]
 gi|237817094|ref|ZP_04596086.1| conserved hypothetical protein [Brucella abortus str. 2308 A]
 gi|254691043|ref|ZP_05154297.1| Holliday junction resolvase-like protein [Brucella abortus bv. 6
           str. 870]
 gi|254695650|ref|ZP_05157478.1| Holliday junction resolvase-like protein [Brucella abortus bv. 3
           str. Tulya]
 gi|254698827|ref|ZP_05160655.1| Holliday junction resolvase-like protein [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254732274|ref|ZP_05190852.1| Holliday junction resolvase-like protein [Brucella abortus bv. 4
           str. 292]
 gi|256256228|ref|ZP_05461764.1| Holliday junction resolvase-like protein [Brucella abortus bv. 9
           str. C68]
 gi|260544782|ref|ZP_05820603.1| ribonuclease RNase H fold containing protein [Brucella abortus NCTC
           8038]
 gi|260756639|ref|ZP_05868987.1| holliday junction resolvase YqgF [Brucella abortus bv. 6 str. 870]
 gi|260760069|ref|ZP_05872417.1| holliday junction resolvase YqgF [Brucella abortus bv. 4 str. 292]
 gi|260763308|ref|ZP_05875640.1| holliday junction resolvase YqgF [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882456|ref|ZP_05894070.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261216050|ref|ZP_05930331.1| holliday junction resolvase YqgF [Brucella abortus bv. 3 str.
           Tulya]
 gi|297249585|ref|ZP_06933286.1| hypothetical protein BAYG_02344 [Brucella abortus bv. 5 str. B3196]
 gi|81309292|sp|Q577Z6|RUVX_BRUAB RecName: Full=Putative Holliday junction resolvase
 gi|146325555|sp|Q2YKL6|RUVX_BRUA2 RecName: Full=Putative Holliday junction resolvase
 gi|226725492|sp|B2SB59|RUVX_BRUA1 RecName: Full=Putative Holliday junction resolvase
 gi|62197739|gb|AAX76038.1| conserved hypothetical protein TIGR00250 [Brucella abortus bv. 1
           str. 9-941]
 gi|82939801|emb|CAJ12809.1| Conserved hypothetical protein 250:Ribonuclease RNase H fold
           containing [Brucella melitensis biovar Abortus 2308]
 gi|189021375|gb|ACD74096.1| Ribonuclease RNase H fold containing [Brucella abortus S19]
 gi|237787907|gb|EEP62123.1| conserved hypothetical protein [Brucella abortus str. 2308 A]
 gi|260098053|gb|EEW81927.1| ribonuclease RNase H fold containing protein [Brucella abortus NCTC
           8038]
 gi|260670387|gb|EEX57327.1| holliday junction resolvase YqgF [Brucella abortus bv. 4 str. 292]
 gi|260673729|gb|EEX60550.1| holliday junction resolvase YqgF [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676747|gb|EEX63568.1| holliday junction resolvase YqgF [Brucella abortus bv. 6 str. 870]
 gi|260871984|gb|EEX79053.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260917657|gb|EEX84518.1| holliday junction resolvase YqgF [Brucella abortus bv. 3 str.
           Tulya]
 gi|297173454|gb|EFH32818.1| hypothetical protein BAYG_02344 [Brucella abortus bv. 5 str. B3196]
          Length = 162

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 81/158 (51%), Positives = 107/158 (67%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+   IE++   LKP Q +A +DLGTK IGLA+SD G  FAHPRP + R K T  A  LL
Sbjct: 1   MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAHPRPVIKRVKFTIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + T+ +   +IGLP+NM+G+ GPRV +TRAFV  M      +PFVFWDERL+TV+A++
Sbjct: 61  KALETDKVGVIMIGLPMNMDGTAGPRVQATRAFVRTM-QPLTDLPFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            LI M+VSR KR  ++DS AAA ILQ  LDR+  +  +
Sbjct: 120 ALIGMDVSRGKRADRIDSAAAAFILQGALDRLHMMRRN 157


>gi|330814160|ref|YP_004358399.1| putative Holliday junction resolvase [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487255|gb|AEA81660.1| putative Holliday junction resolvase [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 156

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 52/151 (34%), Positives = 83/151 (54%), Gaps = 1/151 (0%)

Query: 2   SILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS 61
           ++L   D  K +     +  ID G + +G+AI DP    A P   +  KK+     EL  
Sbjct: 5   NLLENSDFAKLITEGSRLLGIDPGKRNVGIAICDPSHLIATPYETIQAKKLKNLLEELDK 64

Query: 62  FITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQI 121
            I   NI   ++G P+NM+G+EGPR  ST+ FV N+I +  ++P   WDERL++V A + 
Sbjct: 65  IIIENNIKGIVVGHPINMDGTEGPRSQSTKDFVKNII-KHTHLPVTLWDERLSSVGAFKS 123

Query: 122 LIDMNVSRKKRIQKVDSIAAALILQEVLDRI 152
           + D+ ++   +  K+D  +AA ILQ  +D +
Sbjct: 124 MQDLGINSSSKKDKLDENSAAFILQGFIDYL 154


>gi|118442957|ref|YP_878351.1| Holliday junction resolvase-like protein [Clostridium novyi NT]
 gi|167012715|sp|A0Q149|RUVX_CLONN RecName: Full=Putative Holliday junction resolvase
 gi|118133413|gb|ABK60457.1| Putative Holliday junction resolvase [Clostridium novyi NT]
          Length = 135

 Score =  149 bits (376), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 49/136 (36%), Positives = 73/136 (53%), Gaps = 1/136 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             +  +D+G + IG+A+SDP    A     + RK V +   EL        +   I GLP
Sbjct: 1   MRVLGLDVGDRTIGVAVSDPLGFTAQGITTVHRKSVKEDIDELKKICKEYAVELIISGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ G +      F   ++  ++ +P   WDERLTTV+A + +++ N+SR KR + V
Sbjct: 61  KNMNGTVGEQGEKVIEFCE-LLKSELKMPIKMWDERLTTVAAHRAMLEANLSRAKRKKIV 119

Query: 137 DSIAAALILQEVLDRI 152
           D +AA  ILQ  LD I
Sbjct: 120 DKMAATYILQGYLDSI 135


>gi|297584728|ref|YP_003700508.1| Holliday junction resolvase YqgF [Bacillus selenitireducens MLS10]
 gi|297143185|gb|ADH99942.1| Holliday junction resolvase YqgF [Bacillus selenitireducens MLS10]
          Length = 138

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 53/139 (38%), Positives = 74/139 (53%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV--TQTALELLSFITTENIAAFIIG 74
             I  +D+GTK IG+A+SDP    A       RKK    +    ++  +  E     ++G
Sbjct: 1   MKIIGLDVGTKTIGIAVSDPFGWTAQGVETHRRKKGKENEDVQRIVDLVEEEGAEQIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ GP     +AF    +     +P + WDERLTT +A++ LI  +VSRKKR  
Sbjct: 61  LPKNMNGTIGPSGELCQAFAE-SLKEATGLPVILWDERLTTAAAEKTLISADVSRKKRKN 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA  ILQ  LD  S
Sbjct: 120 VIDKMAAVFILQGYLDSRS 138


>gi|17989017|ref|NP_541650.1| Holliday junction resolvase-like protein [Brucella melitensis bv. 1
           str. 16M]
 gi|148558591|ref|YP_001257584.1| Holliday junction resolvase-like protein [Brucella ovis ATCC 25840]
 gi|256043494|ref|ZP_05446421.1| Holliday junction resolvase-like protein [Brucella melitensis bv. 1
           str. Rev.1]
 gi|260564689|ref|ZP_05835174.1| ribonuclease RNase [Brucella melitensis bv. 1 str. 16M]
 gi|265989912|ref|ZP_06102469.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|32130048|sp|Q8YC60|RUVX_BRUME RecName: Full=Putative Holliday junction resolvase
 gi|167012699|sp|A5VUS9|RUVX_BRUO2 RecName: Full=Putative Holliday junction resolvase
 gi|17984856|gb|AAL53914.1| DNA integration/recombination/invertion protein [Brucella
           melitensis bv. 1 str. 16M]
 gi|148369876|gb|ABQ62748.1| conserved hypothetical protein TIGR00250 [Brucella ovis ATCC 25840]
 gi|260152332|gb|EEW87425.1| ribonuclease RNase [Brucella melitensis bv. 1 str. 16M]
 gi|263000581|gb|EEZ13271.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 162

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 80/158 (50%), Positives = 106/158 (67%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+   IE++   LKP Q +A +DLGTK IGLA+SD G  FAHPRP + R K T  A  LL
Sbjct: 1   MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAHPRPVIKRVKFTIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + T+ +   +IGLP+NM+G+ GPRV +TRAFV  M      +PFVFWDERL+TV+ ++
Sbjct: 61  KALETDKVGVIVIGLPMNMDGTAGPRVQATRAFVRTM-QPLTDLPFVFWDERLSTVAVER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            LI M+VSR KR  ++DS AAA ILQ  LDR+  +  +
Sbjct: 120 ALIGMDVSRGKRADRIDSAAAAFILQGALDRLHMMRRN 157


>gi|83594508|ref|YP_428260.1| Holliday junction resolvase YqgF [Rhodospirillum rubrum ATCC 11170]
 gi|146325602|sp|Q2RPH2|RUVX_RHORT RecName: Full=Putative Holliday junction resolvase
 gi|83577422|gb|ABC23973.1| Holliday junction resolvase YqgF [Rhodospirillum rubrum ATCC 11170]
          Length = 161

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 57/153 (37%), Positives = 88/153 (57%), Gaps = 2/153 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I  ++    +L P +P+  +DLGT+ IG+A SD     A P   + R+K T    EL 
Sbjct: 1   MPICSLQTFADALPPGRPVLGLDLGTRTIGVATSDVRLTLATPIITIKRRKFTLDVQELF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +       A  ++GLP+ M+GSEGPR  +TRAF  N++     +P + WDERL+T +  +
Sbjct: 61  ALADGRAAAGLVLGLPVEMDGSEGPRCQATRAFARNLL-ALRDLPVLLWDERLSTAAVNR 119

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLDRI 152
            L+ + +++R +R + VD  AAA ILQ  LD +
Sbjct: 120 FLVGEADMTRARRAEVVDRAAAAYILQGALDAL 152


>gi|167462225|ref|ZP_02327314.1| hypothetical protein Plarl_06660 [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322382969|ref|ZP_08056801.1| Holliday junction resolvase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321153089|gb|EFX45547.1| Holliday junction resolvase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 136

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 53/135 (39%), Positives = 76/135 (56%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
                +D G + IG+A+SD     A     + RKK  +    +   I    ++  ++GLP
Sbjct: 1   MRKMGLDYGDRTIGVAVSDLLGLTAQGVEVIRRKKQEEDLARIGELIREYEVSELVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR    + F   ++ R+  +P   WDERLTTVSA + L++ +VSRKKR Q V
Sbjct: 61  KNMNGTIGPRGELCQEFAG-LLKRQFGLPVHLWDERLTTVSATRTLLEADVSRKKRKQVV 119

Query: 137 DSIAAALILQEVLDR 151
           D +AAALILQ  +D 
Sbjct: 120 DKMAAALILQGYMDS 134


>gi|315645822|ref|ZP_07898943.1| Holliday junction resolvase YqgF [Paenibacillus vortex V453]
 gi|315278583|gb|EFU41897.1| Holliday junction resolvase YqgF [Paenibacillus vortex V453]
          Length = 137

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 51/138 (36%), Positives = 78/138 (56%), Gaps = 1/138 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            + I  +D G +RIG+AISD     A     + R++     + + + +    +   ++GL
Sbjct: 1   MKKIMGLDYGDRRIGVAISDVFGWTAQGVEVIERRRDEGELVRIATLVKENEVGEVVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMNG+ GPR      F +  +   + +P   WDERL+TVSA++ L++ +VSRKKR Q 
Sbjct: 61  PKNMNGTIGPRGEICMEFAN-TLRESLSLPVHLWDERLSTVSAERTLLEADVSRKKRKQV 119

Query: 136 VDSIAAALILQEVLDRIS 153
           VD +AA+LILQ  LD   
Sbjct: 120 VDKMAASLILQNYLDSKR 137


>gi|294084181|ref|YP_003550939.1| putative Holliday junction resolvase [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663754|gb|ADE38855.1| Putative Holliday junction resolvase [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 159

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 59/152 (38%), Positives = 86/152 (56%), Gaps = 1/152 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I  + D+ +S+   Q +  +D+G K IGLA+SD G + A P   L R K T    EL 
Sbjct: 1   MPICKLNDVKQSISDGQRLLGLDIGKKTIGLALSDAGLKIATPVKILYRTKFTPDVAELF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +  +N+   ++G P+NM+GS GPR  STR F    + R   VP  F DERL+T + + 
Sbjct: 61  KLVDEQNVGGLVLGWPVNMDGSTGPRCDSTRDFA-YALMRIRDVPVFFQDERLSTQAVES 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRI 152
            +I  +++R KR  + D++AA  ILQ  LD I
Sbjct: 120 AMIAADMTRAKRAVRRDALAAGWILQSALDTI 151


>gi|32130021|sp|Q89K24|RUVX_BRAJA RecName: Full=Putative Holliday junction resolvase
          Length = 161

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 66/162 (40%), Positives = 91/162 (56%), Gaps = 3/162 (1%)

Query: 1   MS--ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE 58
           M   IL + D          +  +DLGTK IG+A+S+P RR A     + RK   Q A  
Sbjct: 1   MPALILPLVDAATHWPERGGLVGLDLGTKTIGVAVSNPDRRLATGVETIQRKAFKQDAAR 60

Query: 59  LLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSA 118
           LL+      +  F++GLP+NM+GSEGPR  STRAF    +     +P   WDERL+T + 
Sbjct: 61  LLAIAAERKVVGFVLGLPINMDGSEGPRAQSTRAFAR-NLANLTTLPIGLWDERLSTAAV 119

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           ++ LI M+VSR KR + +D  AA  ILQ  LDR++ L +  G
Sbjct: 120 ERELIGMDVSRAKRAEVIDEHAAIFILQGALDRLANLRTGNG 161


>gi|253574901|ref|ZP_04852241.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251845947|gb|EES73955.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 138

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 56/137 (40%), Positives = 76/137 (55%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D G +RIG+A+SD     A     + R+K       +   +    +   ++GLP
Sbjct: 1   MKIMGLDYGDRRIGVAVSDSLGWTAQGLETIERRKEGSEFERIAELVKQHEVEEIVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR     AF    +  K+ +P   WDERLTTVSAQ+ L+D +VSRKKR   V
Sbjct: 61  KNMNGTIGPRGEICMAFAE-DLRAKLNLPVHLWDERLTTVSAQRTLLDADVSRKKRKGVV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA+LILQ  LD  S
Sbjct: 120 DKMAASLILQNYLDSKS 136


>gi|16126678|ref|NP_421242.1| hypothetical protein CC_2439 [Caulobacter crescentus CB15]
 gi|221235457|ref|YP_002517894.1| endonuclease involved in recombination [Caulobacter crescentus
           NA1000]
 gi|32130061|sp|Q9A5K8|RUVX_CAUCR RecName: Full=Putative Holliday junction resolvase
 gi|254767503|sp|B8GZJ7|RUVX_CAUCN RecName: Full=Putative Holliday junction resolvase
 gi|13423984|gb|AAK24410.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220964630|gb|ACL95986.1| endonuclease involved in recombination [Caulobacter crescentus
           NA1000]
          Length = 156

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 60/156 (38%), Positives = 92/156 (58%), Gaps = 1/156 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +L IED   +L     +  +D G K IG+A+SD  R  A P   + + K ++ A +L 
Sbjct: 1   MPVLDIEDFADALPQYAAVVGLDPGEKTIGVAVSDVTRTVASPLALIEKTKFSKDAEQLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + +    A +IGLP+NM+G+EG R  S RA   N++  K  +P  FWDERL+T +  +
Sbjct: 61  KLMDSRGAVAIVIGLPMNMDGTEGVRCQSNRALGRNLLRLKPDLPITFWDERLSTAAVTR 120

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           +LI + ++SRK+R + VD +AA  ILQ  L+R+  L
Sbjct: 121 VLIDEHDISRKRRDEVVDKMAAGWILQGALERLRGL 156


>gi|149174656|ref|ZP_01853281.1| Holliday junction resolvase YqgF [Planctomyces maris DSM 8797]
 gi|148846350|gb|EDL60688.1| Holliday junction resolvase YqgF [Planctomyces maris DSM 8797]
          Length = 162

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 48/145 (33%), Positives = 79/145 (54%), Gaps = 1/145 (0%)

Query: 9   LVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENI 68
                     +  +D GTKR+G+AIS   +  A P     R+ + Q    LLS IT    
Sbjct: 11  FEAEFPAEGRLLGLDYGTKRVGIAISTFEQNIASPLDNYNRQSLPQDQKHLLSIITEYRC 70

Query: 69  AAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVS 128
              ++GLP++M+G EG +    R F + +  +   +P  +WDER ++ +A++IL+++N+S
Sbjct: 71  KGLVVGLPVHMSGDEGQKAKEARQFGNWV-SQFAEIPVRYWDERYSSATAEEILVNLNMS 129

Query: 129 RKKRIQKVDSIAAALILQEVLDRIS 153
           R KR   +D +AA +ILQ  LD  +
Sbjct: 130 RNKRKAYLDKLAAQIILQSFLDSPN 154


>gi|303229331|ref|ZP_07316121.1| RNAse H domain protein, YqgF family [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302515867|gb|EFL57819.1| RNAse H domain protein, YqgF family [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 140

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 53/141 (37%), Positives = 79/141 (56%), Gaps = 1/141 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I ++D+G++ IG+A SD     A     + R  +      L   I+   +   ++G+P
Sbjct: 1   MRIMALDVGSRTIGIACSDALLMTAQGIETIRRTSLENDFNRLRELISEYEVHELVVGMP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG++G R   T  FV  M    + +P  FWDERL+TV A++ LI  +VSRKKR   +
Sbjct: 61  KNMNGTKGERAEKTEEFVEKM-KAVIDLPVTFWDERLSTVMAERQLIAADVSRKKRKGVI 119

Query: 137 DSIAAALILQEVLDRISFLES 157
           D +AA +ILQ  LDR+ F +S
Sbjct: 120 DKMAAVVILQGYLDRLQFSKS 140


>gi|254456227|ref|ZP_05069656.1| conserved hypothetical protein TIGR00250 [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207083229|gb|EDZ60655.1| conserved hypothetical protein TIGR00250 [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 151

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 49/152 (32%), Positives = 80/152 (52%), Gaps = 1/152 (0%)

Query: 3   ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSF 62
           ++ IEDL K       +  +DLG+KRIG++I D  +  A P   + +    +   EL   
Sbjct: 1   MITIEDLKKKQSETSRLIGLDLGSKRIGVSICDEKQSIATPFKTINKTNTNELINELKKI 60

Query: 63  ITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL 122
           I   +I   ++G P+NM+G+ G    S    V + ID+ + +    WDERL+TV A  + 
Sbjct: 61  IEEYDIKGIVVGNPINMDGTLGRSSQSVND-VSDNIDKAIDIDVCLWDERLSTVGAFNLS 119

Query: 123 IDMNVSRKKRIQKVDSIAAALILQEVLDRISF 154
             ++V+  KR + +D  AAA ILQ  +D ++ 
Sbjct: 120 SQLDVNVSKREKNIDQNAAAFILQGAIDFLNN 151


>gi|182678862|ref|YP_001833008.1| Holliday junction resolvase-like protein [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|226725489|sp|B2IEC1|RUVX_BEII9 RecName: Full=Putative Holliday junction resolvase
 gi|182634745|gb|ACB95519.1| Holliday junction resolvase YqgF [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 165

 Score =  148 bits (374), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 71/157 (45%), Positives = 97/157 (61%), Gaps = 1/157 (0%)

Query: 3   ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSF 62
           +L + +L   L P Q +  IDLGTK IGL++SD  RR A P   + R K T+ A  LL+ 
Sbjct: 5   VLPLVELKPLLGPRQRLIGIDLGTKTIGLSLSDVERRIATPLETIRRTKFTKDAERLLAL 64

Query: 63  ITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL 122
               ++AAF+IGLPLNM+GS GPRV +T AFV   +      PF +WDERL+T +  + L
Sbjct: 65  ADQFDVAAFVIGLPLNMDGSAGPRVQATEAFVR-SLSGLTSRPFCYWDERLSTAAVTRDL 123

Query: 123 IDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           I  + SR KR   VD +AAA ILQ  LDR++++  + 
Sbjct: 124 IAQDASRAKRAAVVDKLAAAFILQGALDRLAWVHETA 160


>gi|304407567|ref|ZP_07389219.1| Holliday junction resolvase YqgF [Paenibacillus curdlanolyticus
           YK9]
 gi|304343518|gb|EFM09360.1| Holliday junction resolvase YqgF [Paenibacillus curdlanolyticus
           YK9]
          Length = 138

 Score =  148 bits (374), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 52/137 (37%), Positives = 74/137 (54%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D G + IG+A+SD     A     + R+       E+   +    +   ++GLP
Sbjct: 1   MRIMGLDYGDRNIGVAVSDAFGWTAQGTGVVQRRHNRGEFDEIAQLVKDHEVTEIVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNGS GPR     AF    + +K+ +P   WDERLTTVSA++ L++ +VSRKKR   V
Sbjct: 61  KNMNGSVGPRGEICIAFAE-ELQQKLNLPVHLWDERLTTVSAERTLLEADVSRKKRKLVV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA  ILQ  LD  +
Sbjct: 120 DKLAATFILQNYLDSKA 136


>gi|254420883|ref|ZP_05034607.1| conserved hypothetical protein TIGR00250 [Brevundimonas sp. BAL3]
 gi|196187060|gb|EDX82036.1| conserved hypothetical protein TIGR00250 [Brevundimonas sp. BAL3]
          Length = 159

 Score =  148 bits (374), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 64/154 (41%), Positives = 93/154 (60%), Gaps = 2/154 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +L + DL  +  P+ P   +DLG K IG+A+SD  R  A P   + + K T  A +L 
Sbjct: 1   MPVLDLLDLPAACPPDTPWMGLDLGEKTIGVAVSDATRLIASPLELIRKSKFTLEADQLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +    ++A +IGLP NM+G+EGPR  S RAF    ++R   V   FWDERL+T + ++
Sbjct: 61  KLMAHRKVSALVIGLPANMDGTEGPRAQSCRAFAR-NLERLRPVNIAFWDERLSTSAVER 119

Query: 121 ILID-MNVSRKKRIQKVDSIAAALILQEVLDRIS 153
            LI+ ++++RK+R Q VD  AAA ILQ  LDR+ 
Sbjct: 120 FLIEDLDLNRKRRAQVVDRTAAAWILQGALDRVR 153


>gi|304436654|ref|ZP_07396623.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304370350|gb|EFM24006.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 143

 Score =  148 bits (374), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 50/143 (34%), Positives = 72/143 (50%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            +   S+DLG   IG+A+SD     A     + R  +      L   +    + A + GL
Sbjct: 1   MKRYMSLDLGDATIGVAVSDLLGLTAQGVETVRRTTLEADIARLGQLMQEYEVDALVAGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MNG EG R    RAF+  + +        +WDERL+TV+A + LI  +VSRKKR + 
Sbjct: 61  PKHMNGDEGERCSIVRAFMAKVEEHFPRTEVHYWDERLSTVAASRALIAGDVSRKKRRKV 120

Query: 136 VDSIAAALILQEVLDRISFLESS 158
           +D +AA  ILQ  LDR +     
Sbjct: 121 IDKMAAVYILQGFLDRQNMENHG 143


>gi|169343788|ref|ZP_02864787.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens C
           str. JGS1495]
 gi|169298348|gb|EDS80438.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens C
           str. JGS1495]
          Length = 137

 Score =  148 bits (374), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 74/137 (54%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G+K IG+A+SDP    A     + R   T+    ++       +   ++G+P
Sbjct: 1   MRILGLDIGSKTIGVAVSDPLGWTAQGVTTIKRDCYTKDVEAVMKICKEYGVETIVVGMP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP     +      I++       FWDERLTTV+A + +++ ++SR KR + V
Sbjct: 61  KNMNGTIGPSGEMVKNLCE-QIEKSFDGKIEFWDERLTTVAAHRAMLEADLSRAKRKKIV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D IAA  ILQ  LDRIS
Sbjct: 120 DKIAATYILQGYLDRIS 136


>gi|146341407|ref|YP_001206455.1| Holliday junction resolvase-like protein [Bradyrhizobium sp.
           ORS278]
 gi|167012698|sp|A4YWF9|RUVX_BRASO RecName: Full=Putative Holliday junction resolvase
 gi|146194213|emb|CAL78235.1| putative Holliday junction resolvase [Bradyrhizobium sp. ORS278]
          Length = 161

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 64/157 (40%), Positives = 89/157 (56%), Gaps = 1/157 (0%)

Query: 2   SILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS 61
            IL + +          +  +DLGTK IG+A+SDP RR A     + RK     A  LL+
Sbjct: 4   PILPLIEAAGRWPERGALVGLDLGTKTIGVAVSDPDRRLATGVETIQRKAFKADAARLLA 63

Query: 62  FITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQI 121
                 +  F++GLP+NM+GSEGPR  STRAF    +     +P   WDERL+T + ++ 
Sbjct: 64  ICAERKVVGFVLGLPINMDGSEGPRAQSTRAFAR-NLAGLTDLPIGLWDERLSTAAVERE 122

Query: 122 LIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           LI M+VSR KR + +D+ AA  ILQ  LDR++ L  S
Sbjct: 123 LIGMDVSRAKRAEVIDTHAAIFILQGALDRLTTLRRS 159


>gi|115375305|ref|ZP_01462569.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|310823720|ref|YP_003956078.1| holliday junction resolvase [Stigmatella aurantiaca DW4/3-1]
 gi|115367678|gb|EAU66649.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|309396792|gb|ADO74251.1| Holliday junction resolvase [Stigmatella aurantiaca DW4/3-1]
          Length = 150

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 50/134 (37%), Positives = 77/134 (57%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
                +DLGTK IG+A+SD     A     + R  +      L         +  ++GLP
Sbjct: 1   MRTLGLDLGTKTIGVAVSDGLGLTAQALTTVRRTNLKADLAALAELAREHEASRIVLGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+GSEGPR  ++R F    + + +++P  FWDERL+TV+A++ L++ +++R KR Q +
Sbjct: 61  LNMDGSEGPRAEASRKFAD-ALGQALHLPVEFWDERLSTVAAERTLLEADLTRAKRKQVI 119

Query: 137 DSIAAALILQEVLD 150
           D +AA  ILQ  LD
Sbjct: 120 DQMAAQFILQGWLD 133


>gi|18310760|ref|NP_562694.1| Holliday junction resolvase-like protein [Clostridium perfringens
           str. 13]
 gi|110799090|ref|YP_696464.1| Holliday junction resolvase-like protein [Clostridium perfringens
           ATCC 13124]
 gi|110803306|ref|YP_699063.1| Holliday junction resolvase-like protein [Clostridium perfringens
           SM101]
 gi|168207854|ref|ZP_02633859.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens E
           str. JGS1987]
 gi|168211403|ref|ZP_02637028.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens B
           str. ATCC 3626]
 gi|168214255|ref|ZP_02639880.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens
           CPE str. F4969]
 gi|168218243|ref|ZP_02643868.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens
           NCTC 8239]
 gi|182625715|ref|ZP_02953484.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens D
           str. JGS1721]
 gi|32130045|sp|Q8XJH8|RUVX_CLOPE RecName: Full=Putative Holliday junction resolvase
 gi|118597205|sp|Q0TPH6|RUVX_CLOP1 RecName: Full=Putative Holliday junction resolvase
 gi|118597206|sp|Q0SS44|RUVX_CLOPS RecName: Full=Putative Holliday junction resolvase
 gi|18145441|dbj|BAB81484.1| conserved hypothetical protein [Clostridium perfringens str. 13]
 gi|110673737|gb|ABG82724.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens
           ATCC 13124]
 gi|110683807|gb|ABG87177.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens
           SM101]
 gi|170660825|gb|EDT13508.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens E
           str. JGS1987]
 gi|170710607|gb|EDT22789.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens B
           str. ATCC 3626]
 gi|170714263|gb|EDT26445.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens
           CPE str. F4969]
 gi|177909117|gb|EDT71592.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens D
           str. JGS1721]
 gi|182379748|gb|EDT77227.1| conserved hypothetical protein TIGR00250 [Clostridium perfringens
           NCTC 8239]
          Length = 137

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 73/137 (53%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G+K IG+A+SDP    A     + R   T+    ++       +   + G+P
Sbjct: 1   MRILGLDIGSKTIGVAVSDPLGWTAQGVTTIKRDCYTKDVEAVMKICKEYGVETIVAGMP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP     +      I++       FWDERLTTV+A + +++ ++SR KR + V
Sbjct: 61  KNMNGTIGPSGEMVKNLCE-QIEKSFDGKIEFWDERLTTVAAHRAMLEADLSRAKRKKIV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D IAA  ILQ  LDRIS
Sbjct: 120 DKIAATYILQGYLDRIS 136


>gi|329851398|ref|ZP_08266155.1| hypothetical UPF0081 family protein [Asticcacaulis biprosthecum
           C19]
 gi|328840244|gb|EGF89816.1| hypothetical UPF0081 family protein [Asticcacaulis biprosthecum
           C19]
          Length = 157

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 61/153 (39%), Positives = 87/153 (56%), Gaps = 2/153 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ I +L   L     +  +DLG K IG+A+SD     A P   + + K T  A  L 
Sbjct: 1   MAVIDITELKAGLPARHALLGLDLGEKTIGVAVSDISLTLASPLELIRKTKFTHEAERLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +     A  +IGLP+NM+G+EGPR  S RAF  N++ R   VP  FWDER ++ +  +
Sbjct: 61  HLMQAREAAGLVIGLPVNMDGTEGPRAQSCRAFARNLL-RLRDVPIAFWDERWSSAAMNR 119

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLDRI 152
            LI + ++SR KR + +D  AAA ILQ  LDRI
Sbjct: 120 FLIEEADLSRAKRAEVIDRNAAAYILQGALDRI 152


>gi|153953951|ref|YP_001394716.1| Holliday junction resolvase-like protein [Clostridium kluyveri DSM
           555]
 gi|219854565|ref|YP_002471687.1| hypothetical protein CKR_1222 [Clostridium kluyveri NBRC 12016]
 gi|189046093|sp|A5N7T7|RUVX_CLOK5 RecName: Full=Putative Holliday junction resolvase
 gi|254767509|sp|B9E198|RUVX_CLOK1 RecName: Full=Putative Holliday junction resolvase
 gi|146346832|gb|EDK33368.1| Predicted Holliday junction resolvase [Clostridium kluyveri DSM
           555]
 gi|219568289|dbj|BAH06273.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 137

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 52/137 (37%), Positives = 76/137 (55%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G K IG+A+SDP    A     + RK   +   EL +      +   + GLP
Sbjct: 1   MRILGLDIGNKTIGVALSDPLGITAQGITTIKRKGEDRDIEELKAICDKYKVEVIVCGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP+      F +  I+  + +P   WDERLTTV+A + +++ ++SR KR + V
Sbjct: 61  KNMNGTLGPQSEKVLKFCNI-IEEVINLPIKMWDERLTTVAANKAMLEADLSRAKRKKIV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA  ILQ  LDRIS
Sbjct: 120 DKMAATYILQGYLDRIS 136


>gi|27380205|ref|NP_771734.1| Holliday junction resolvase-like protein [Bradyrhizobium japonicum
           USDA 110]
 gi|27353359|dbj|BAC50359.1| blr5094 [Bradyrhizobium japonicum USDA 110]
          Length = 167

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 66/162 (40%), Positives = 91/162 (56%), Gaps = 3/162 (1%)

Query: 1   MS--ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE 58
           M   IL + D          +  +DLGTK IG+A+S+P RR A     + RK   Q A  
Sbjct: 7   MPALILPLVDAATHWPERGGLVGLDLGTKTIGVAVSNPDRRLATGVETIQRKAFKQDAAR 66

Query: 59  LLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSA 118
           LL+      +  F++GLP+NM+GSEGPR  STRAF    +     +P   WDERL+T + 
Sbjct: 67  LLAIAAERKVVGFVLGLPINMDGSEGPRAQSTRAFAR-NLANLTTLPIGLWDERLSTAAV 125

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           ++ LI M+VSR KR + +D  AA  ILQ  LDR++ L +  G
Sbjct: 126 ERELIGMDVSRAKRAEVIDEHAAIFILQGALDRLANLRTGNG 167


>gi|168186829|ref|ZP_02621464.1| conserved hypothetical protein [Clostridium botulinum C str.
           Eklund]
 gi|169295213|gb|EDS77346.1| conserved hypothetical protein [Clostridium botulinum C str.
           Eklund]
          Length = 135

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 51/136 (37%), Positives = 72/136 (52%), Gaps = 1/136 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G + IG+A+SDP    A     + RK V +   EL        +   I GLP
Sbjct: 1   MRILGLDVGDRTIGVAVSDPLGFTAQGVTTIHRKNVEEDIDELKKICKEYAVELIISGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ G +      F    +  K+ +P   WDERLTTV+A + +++ N+SR KR + V
Sbjct: 61  KNMNGTVGEQGEKVIEFCDI-LKTKLEIPIKMWDERLTTVAAHKAMLEANLSRAKRKKIV 119

Query: 137 DSIAAALILQEVLDRI 152
           D +AA  ILQ  LD I
Sbjct: 120 DKMAATYILQGYLDSI 135


>gi|298291510|ref|YP_003693449.1| Holliday junction resolvase YqgF [Starkeya novella DSM 506]
 gi|296928021|gb|ADH88830.1| Holliday junction resolvase YqgF [Starkeya novella DSM 506]
          Length = 160

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 62/161 (38%), Positives = 91/161 (56%), Gaps = 3/161 (1%)

Query: 1   MS--ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE 58
           M   IL + +    L     +  +DLGTK IG+A SDP RR A     + RK+ T  A  
Sbjct: 1   MPALILPVAEAAGILPARGSLIGLDLGTKTIGVASSDPDRRIAAGVETIARKQFTPDAGR 60

Query: 59  LLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSA 118
           +LS          ++GLP+NM+GSEGPR  ++RAF    + R   +P + WDERL+T + 
Sbjct: 61  VLSLAAARGAVGLVLGLPVNMDGSEGPRAQASRAFAR-NLSRLTELPIMLWDERLSTAAV 119

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           ++ +I  ++SR +R + VD  AAA ILQ  LDR+ F+   +
Sbjct: 120 ERDMIATDMSRARRAEVVDQQAAAFILQGALDRLRFIAEGR 160


>gi|303230717|ref|ZP_07317464.1| RNAse H domain protein, YqgF family [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514477|gb|EFL56472.1| RNAse H domain protein, YqgF family [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 140

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 53/141 (37%), Positives = 79/141 (56%), Gaps = 1/141 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I ++D+G++ IG+A SD     A     + R  +      L   I+   +   ++G+P
Sbjct: 1   MRIMALDVGSRTIGIACSDALLMTAQGIETIRRTSLENDFNRLRELISEYEVHELVVGMP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG++G R   T  FV  M    + +P  FWDERL+TV A++ LI  +VSRKKR   +
Sbjct: 61  KNMNGTKGDRAEKTEEFVEKM-KAVIDLPVTFWDERLSTVMAERQLIAADVSRKKRKGVI 119

Query: 137 DSIAAALILQEVLDRISFLES 157
           D +AA +ILQ  LDR+ F +S
Sbjct: 120 DKMAAVVILQGYLDRLQFSKS 140


>gi|294853606|ref|ZP_06794278.1| Holliday junction resolvase [Brucella sp. NVSL 07-0026]
 gi|294819261|gb|EFG36261.1| Holliday junction resolvase [Brucella sp. NVSL 07-0026]
          Length = 162

 Score =  147 bits (371), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 79/158 (50%), Positives = 105/158 (66%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+   IE++   LKP Q +A +DLGTK IGLA+SD G  FAHPRP + R K T  A  LL
Sbjct: 1   MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAHPRPVIKRVKFTIDAQVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + T+ +   +IGLP+N +G+ GPRV +TRAFV  M      + FVFWDERL+TV+A++
Sbjct: 61  KALETDKVGVIVIGLPMNTDGTAGPRVQATRAFVRTM-QPLTDLSFVFWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            LI M+VSR KR  ++DS AAA ILQ  LDR+  +  +
Sbjct: 120 ALIGMDVSRGKRADRIDSAAAAFILQGALDRLHMMRRN 157


>gi|253681805|ref|ZP_04862602.1| conserved hypothetical protein [Clostridium botulinum D str. 1873]
 gi|253561517|gb|EES90969.1| conserved hypothetical protein [Clostridium botulinum D str. 1873]
          Length = 135

 Score =  147 bits (371), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 52/136 (38%), Positives = 74/136 (54%), Gaps = 1/136 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G K IG+A+SDP    A     + RK++ +   E+        I   I GLP
Sbjct: 1   MRILGLDVGNKTIGVAVSDPLGFTAQGITTVHRKELEEDIQEIDKICHEYKIELIISGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ G +      F   ++  K+ +P   WDERLTTV+A + +++ N+SR KR + V
Sbjct: 61  KNMNGTIGEQGEKVLEFCD-VLKEKLDIPIKMWDERLTTVAAHKAMLEANLSRAKRKKIV 119

Query: 137 DSIAAALILQEVLDRI 152
           D IAA  ILQ  LD I
Sbjct: 120 DKIAATYILQGYLDSI 135


>gi|323702199|ref|ZP_08113866.1| Holliday junction resolvase YqgF [Desulfotomaculum nigrificans DSM
           574]
 gi|323532886|gb|EGB22758.1| Holliday junction resolvase YqgF [Desulfotomaculum nigrificans DSM
           574]
          Length = 140

 Score =  147 bits (371), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 77/136 (56%), Gaps = 2/136 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVR-KKVTQTALELLSFITTENIAAFIIGL 75
             +  +D+G K IG+A+SDP    A     + R   + +    L   +    +   ++GL
Sbjct: 1   MRVMGLDVGDKTIGVALSDPLGWTAQALEVIRRGDNLDKDLNRLAEIVQEYQVEQILVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMNG+ GP+     AF+   +  ++ +P   WDERL+TV+A++ L++ +VSR KR + 
Sbjct: 61  PKNMNGTLGPQGEKVLAFIE-RLKERINLPVKTWDERLSTVAAERALLEADVSRSKRKKV 119

Query: 136 VDSIAAALILQEVLDR 151
           +D +AAA+ILQ  LD 
Sbjct: 120 IDKMAAAVILQGYLDS 135


>gi|299135137|ref|ZP_07028328.1| Holliday junction resolvase YqgF [Afipia sp. 1NLS2]
 gi|298590114|gb|EFI50318.1| Holliday junction resolvase YqgF [Afipia sp. 1NLS2]
          Length = 165

 Score =  147 bits (371), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 65/160 (40%), Positives = 90/160 (56%), Gaps = 3/160 (1%)

Query: 1   MS--ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE 58
           M   IL + +      P   +  +DLGTK IG+A+SDP RR A     + RK  T+ A E
Sbjct: 6   MPALILPLTEAATHWTPRGALIGLDLGTKTIGVAVSDPDRRLATGVTTIQRKTFTKDAAE 65

Query: 59  LLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSA 118
           LL        + F++GLP+NM+GSEGPR  STRAF  N   +   +    WDERL+T + 
Sbjct: 66  LLRIAGERASSGFVLGLPINMDGSEGPRAQSTRAFARNF-SKLTDLAIGLWDERLSTAAV 124

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           ++ LI  +VSR +R + +D  AA  ILQ  LDR++ L   
Sbjct: 125 ERELIANDVSRARRAEVIDEHAAIFILQGALDRLAALSRQ 164


>gi|261405445|ref|YP_003241686.1| Holliday junction resolvase YqgF [Paenibacillus sp. Y412MC10]
 gi|261281908|gb|ACX63879.1| Holliday junction resolvase YqgF [Paenibacillus sp. Y412MC10]
          Length = 137

 Score =  147 bits (371), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 51/138 (36%), Positives = 77/138 (55%), Gaps = 1/138 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            + I  +D G +RIG+AISD     A     + R++       + + +    +   ++GL
Sbjct: 1   MKKIMGLDYGDRRIGVAISDAFGWTAQGVEVIERRRDEGELDRIAALVKDNEVGEIVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMNG+ GPR      F +  +   + +P   WDERL+TVSA++ L++ +VSRKKR Q 
Sbjct: 61  PKNMNGTIGPRGEICMEFAN-TLRESLSLPVHLWDERLSTVSAERTLLEADVSRKKRKQV 119

Query: 136 VDSIAAALILQEVLDRIS 153
           VD +AA+LILQ  LD   
Sbjct: 120 VDKMAASLILQNYLDSKR 137


>gi|121602720|ref|YP_989125.1| hypothetical protein BARBAKC583_0838 [Bartonella bacilliformis
           KC583]
 gi|167012695|sp|A1UT22|RUVX_BARBK RecName: Full=Putative Holliday junction resolvase
 gi|120614897|gb|ABM45498.1| conserved hypothetical protein TIGR00250 [Bartonella bacilliformis
           KC583]
          Length = 161

 Score =  147 bits (371), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 79/158 (50%), Positives = 108/158 (68%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+I+ I+ ++  L   Q IA +DLGTK IG+AISD    F++PRP + RKK T  AL+L+
Sbjct: 1   MAIITIDRVISHLLSKQTIAGLDLGTKTIGIAISDISLTFSNPRPVIQRKKFTLDALKLI 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+   IIGLP+NM+GS GPRV +TR FV   I     +PF+FWDERL+T++AQ+
Sbjct: 61  KIFDHENVGVAIIGLPINMDGSNGPRVQATRTFVS-NIAMYTKIPFIFWDERLSTIAAQR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
            L++++VSR KR  ++DS AAA ILQ  LDRI  L  +
Sbjct: 120 HLLEIDVSRIKRENRIDSAAAAFILQGALDRIQILRQN 157


>gi|329926758|ref|ZP_08281166.1| RNAse H domain protein, YqgF family [Paenibacillus sp. HGF5]
 gi|328938958|gb|EGG35326.1| RNAse H domain protein, YqgF family [Paenibacillus sp. HGF5]
          Length = 137

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 51/138 (36%), Positives = 77/138 (55%), Gaps = 1/138 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            + I  +D G +RIG+AISD     A     + R++       + + +    +   ++GL
Sbjct: 1   MKKIMGLDYGDRRIGVAISDVFGWTAQGVEVIERRRDEGELDRIAALVKDNEVGEIVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMNG+ GPR      F +  +   + +P   WDERL+TVSA++ L++ +VSRKKR Q 
Sbjct: 61  PKNMNGTIGPRGEICMEFAN-TLRESLSLPVHLWDERLSTVSAERTLLEADVSRKKRKQV 119

Query: 136 VDSIAAALILQEVLDRIS 153
           VD +AA+LILQ  LD   
Sbjct: 120 VDKMAASLILQNYLDSKR 137


>gi|292670704|ref|ZP_06604130.1| YqgF family crossover junction endodeoxyribonuclease [Selenomonas
           noxia ATCC 43541]
 gi|292647650|gb|EFF65622.1| YqgF family crossover junction endodeoxyribonuclease [Selenomonas
           noxia ATCC 43541]
          Length = 137

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 76/137 (55%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            S+D+G   IG+A+SD     A     + R+ ++     L   I      A + GLP +M
Sbjct: 1   MSLDIGDATIGVAVSDLLGLTAQGVETIRRRDLSDDLNRLGVLIQEYEADALVAGLPKHM 60

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           NG EG R    RAF+ +  +R   +   +WDERL+TV+A + L++ +VSRKKR + +D +
Sbjct: 61  NGQEGERCALVRAFMADAAERFPMMEIHYWDERLSTVAASRTLLEGDVSRKKRRKVIDKM 120

Query: 140 AAALILQEVLDRISFLE 156
           AA  ILQ  LDR   L+
Sbjct: 121 AAVYILQGFLDRQQHLK 137


>gi|91977491|ref|YP_570150.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris BisB5]
 gi|123735326|sp|Q135J0|RUVX_RHOPS RecName: Full=Putative Holliday junction resolvase
 gi|91683947|gb|ABE40249.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris BisB5]
          Length = 160

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 63/156 (40%), Positives = 86/156 (55%), Gaps = 1/156 (0%)

Query: 2   SILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS 61
            IL + +          +  +DLGTK IG+A+SDP R+ A     + R   T  A  +L+
Sbjct: 4   PILPLIEAAAHWPARGALLGLDLGTKTIGVAVSDPDRKLATGIETVARTAFTADAKRVLA 63

Query: 62  FITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQI 121
                +   F++GLPLNM+GSEGPR  STRAF  N   R   +P   WDERL+T + ++ 
Sbjct: 64  LAAERSACGFVLGLPLNMDGSEGPRAQSTRAFARNF-ARLTELPIGLWDERLSTAAVERA 122

Query: 122 LIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
           LI  +VSR KR + +D  AA  ILQ  LDR+  L  
Sbjct: 123 LIANDVSRAKRAKIIDEHAAIYILQGALDRLVALNR 158


>gi|148256069|ref|YP_001240654.1| Holliday junction resolvase-like protein [Bradyrhizobium sp. BTAi1]
 gi|167012697|sp|A5EKQ4|RUVX_BRASB RecName: Full=Putative Holliday junction resolvase
 gi|146408242|gb|ABQ36748.1| putative Holliday junction resolvase [Bradyrhizobium sp. BTAi1]
          Length = 161

 Score =  146 bits (370), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 63/157 (40%), Positives = 90/157 (57%), Gaps = 1/157 (0%)

Query: 2   SILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS 61
            IL + +          +  +DLGTK IG+A+SDP RR A     + RK     A  LL+
Sbjct: 4   PILPLIEAASRWPERGALVGLDLGTKTIGVAVSDPDRRLATGVETIQRKAFKADAARLLA 63

Query: 62  FITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQI 121
             +   +  F++GLP+NM+GSEGPR  STRAF    +     +P   WDERL+T + ++ 
Sbjct: 64  ISSERKVVGFVLGLPINMDGSEGPRAQSTRAFAR-NLANLTDLPIGLWDERLSTAAVERE 122

Query: 122 LIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           LI M+VSR +R + +D+ AA  ILQ  LDR++ L  S
Sbjct: 123 LIGMDVSRARRAEVIDTHAAIFILQGALDRLATLRRS 159


>gi|239627761|ref|ZP_04670792.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239517907|gb|EEQ57773.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 150

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 55/142 (38%), Positives = 79/142 (55%), Gaps = 4/142 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFI 72
           N  I  +D G+K +G+A+ DP    A     + RK   K+ QT   + + I    I   +
Sbjct: 2   NMRIMGLDFGSKTVGVAVCDPLGITAQTVETITRKDENKLRQTLARIEALIGQYEIERIV 61

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +G P NMN + G R   T  F    ++R+  +P V WDERLTTV+A ++LI+  V R+ R
Sbjct: 62  LGYPKNMNNTLGERAVKTEEF-KTSLERRTGLPVVLWDERLTTVAASRVLIESGVRREHR 120

Query: 133 IQKVDSIAAALILQEVLDRISF 154
            + VD IAAA+ILQ  LD +S 
Sbjct: 121 KESVDQIAAAMILQGYLDSLSN 142


>gi|103486415|ref|YP_615976.1| Holliday junction resolvase YqgF [Sphingopyxis alaskensis RB2256]
 gi|124107445|sp|Q1GUM9|RUVX_SPHAL RecName: Full=Putative Holliday junction resolvase
 gi|98976492|gb|ABF52643.1| Holliday junction resolvase YqgF [Sphingopyxis alaskensis RB2256]
          Length = 152

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 57/153 (37%), Positives = 90/153 (58%), Gaps = 2/153 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M      D   +L     +A +D+GTK IG+A+ D G  FA P   +VRK+ +     L 
Sbjct: 1   MITTAAPDFAAALPNGGRLAGLDVGTKTIGVALCDAGWSFASPDKTIVRKRFSADLDALK 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  + +   ++GLPLNM+GS+ PR  STRAF  N+    + +P + WDER +T + ++
Sbjct: 61  ALVAGQAVVGLVVGLPLNMDGSDSPRTQSTRAFARNL--APLGLPVLLWDERWSTAAVER 118

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
            +I  +VSR KR +++DS AAA ILQ  +D ++
Sbjct: 119 AMIAADVSRAKRAERIDSAAAAFILQGAIDAMT 151


>gi|258592801|emb|CBE69110.1| putative Holliday junction resolvase [NC10 bacterium 'Dutch
           sediment']
          Length = 144

 Score =  146 bits (369), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 54/143 (37%), Positives = 75/143 (52%), Gaps = 1/143 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            Q    ID GTKRIG+AISD     A P P L           +   +    I   ++GL
Sbjct: 1   MQRYLGIDFGTKRIGVAISDELGLTAQPLPTLEPSTDEAAVRAIREIMDQYGILDVVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMNG+ GP      AF    ++    V    WDERLT+++A+++LI+ ++SR KR ++
Sbjct: 61  PKNMNGTLGPSAERALAFAGQ-LEEGGSVKVTMWDERLTSLAAERLLIEADLSRAKRKRR 119

Query: 136 VDSIAAALILQEVLDRISFLESS 158
           VD +AA LILQ  LDR    +  
Sbjct: 120 VDQMAAVLILQGFLDRRHRQQEH 142


>gi|46907730|ref|YP_014119.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47093424|ref|ZP_00231189.1| conserved hypothetical protein TIGR00250 [Listeria monocytogenes
           str. 4b H7858]
 gi|226224103|ref|YP_002758210.1| hypothetical protein Lm4b_01512 [Listeria monocytogenes Clip81459]
 gi|254824439|ref|ZP_05229440.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|254852126|ref|ZP_05241474.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|254931437|ref|ZP_05264796.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|255521191|ref|ZP_05388428.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           FSL J1-175]
 gi|300764832|ref|ZP_07074822.1| conserved hypothetical protein [Listeria monocytogenes FSL N1-017]
 gi|62900990|sp|Q71ZG8|RUVX_LISMF RecName: Full=Putative Holliday junction resolvase
 gi|259495707|sp|C1KVE9|RUVX_LISMC RecName: Full=Putative Holliday junction resolvase
 gi|46880999|gb|AAT04296.1| conserved hypothetical protein TIGR00250 [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47018203|gb|EAL08971.1| conserved hypothetical protein TIGR00250 [Listeria monocytogenes
           str. 4b H7858]
 gi|225876565|emb|CAS05274.1| Hypothetical protein of unknown function [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|258605429|gb|EEW18037.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|293582988|gb|EFF95020.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|293593675|gb|EFG01436.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|300514508|gb|EFK41565.1| conserved hypothetical protein [Listeria monocytogenes FSL N1-017]
 gi|328465540|gb|EGF36769.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           1816]
          Length = 138

 Score =  146 bits (369), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 47/139 (33%), Positives = 80/139 (57%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +  +      +   +    +   ++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGWTAQGVETIQIDENRKQFGYDRVKELVLEYEVEKVVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR +
Sbjct: 61  LPKNMNNTIGPRAESSKIYAE-VLESRIGLPVVLWDERLTTSAAERTLIEADVSRKKRKE 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LD  +
Sbjct: 120 VIDKLAAVMILQSYLDTTN 138


>gi|118597217|sp|Q1QL26|RUVX_NITHX RecName: Full=Putative Holliday junction resolvase
          Length = 163

 Score =  146 bits (369), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 67/160 (41%), Positives = 92/160 (57%), Gaps = 3/160 (1%)

Query: 1   MS--ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE 58
           M   +L + +          +  +DLGTK IG+A+SDP RR A     L RK  T  A  
Sbjct: 1   MPASVLPLIEAAAHWPERGALVGLDLGTKTIGVAVSDPDRRLATGVETLQRKTFTADAAR 60

Query: 59  LLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSA 118
           LL+     N A F++GLP+NM+GSEGPR  STRAF    + R   +    WDERL+TV+ 
Sbjct: 61  LLAIAGERNAAGFVLGLPINMDGSEGPRAQSTRAFAR-NLARLTDLAIGLWDERLSTVAV 119

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           ++ LI M++SR KR + +D  AA  ILQ  LDR++ L  +
Sbjct: 120 ERELIGMDMSRAKRAKVIDEHAAIFILQGALDRLAVLRRT 159


>gi|300022168|ref|YP_003754779.1| Holliday junction resolvase YqgF [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523989|gb|ADJ22458.1| Holliday junction resolvase YqgF [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 166

 Score =  146 bits (369), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 56/148 (37%), Positives = 88/148 (59%), Gaps = 1/148 (0%)

Query: 5   LIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFIT 64
             ++ + +   +  +  ID GTK +GLA+SD  R  A     + R K T  A  LL+  T
Sbjct: 16  DPQEFIAAATASGRLIGIDGGTKTLGLALSDVTRTIASALETIRRTKFTADAARLLALAT 75

Query: 65  TENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID 124
              +   ++GLP N++G+EGPR  +TRA     +++   +P + WDERLTT  A+++LID
Sbjct: 76  EHGVTGLVLGLPRNLDGTEGPRAQATRALAR-NLNKLSPLPILLWDERLTTAEAERMLID 134

Query: 125 MNVSRKKRIQKVDSIAAALILQEVLDRI 152
            + SRK+R + +D +AA +ILQ  LDR+
Sbjct: 135 ADQSRKRRGEVIDKLAATIILQSALDRL 162


>gi|310643513|ref|YP_003948271.1| holliday junction resolvase-like protein [Paenibacillus polymyxa
           SC2]
 gi|309248463|gb|ADO58030.1| Holliday junction resolvase-like protein [Paenibacillus polymyxa
           SC2]
          Length = 138

 Score =  146 bits (369), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 76/137 (55%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             +  +D G +RIG+A+SD     A     + R+       ++ + +    I   ++GLP
Sbjct: 1   MKVMGLDYGDRRIGVAVSDAFGWTAQGLVVIERRGDDSEFGKIANLVREHEIGEVVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR      F +  +   + +P   WDERLTT SA++ L++ +VSRKKR Q V
Sbjct: 61  KNMNGTVGPRGEICIEFAN-RLKELLGLPVHLWDERLTTRSAERALLEADVSRKKRKQVV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA+LILQ  LD  S
Sbjct: 120 DKLAASLILQNYLDAHS 136


>gi|197104788|ref|YP_002130165.1| putative Holliday junction resolvase [Phenylobacterium zucineum
           HLK1]
 gi|226731635|sp|B4R966|RUVX_PHEZH RecName: Full=Putative Holliday junction resolvase
 gi|196478208|gb|ACG77736.1| putative Holliday junction resolvase [Phenylobacterium zucineum
           HLK1]
          Length = 156

 Score =  146 bits (369), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 59/156 (37%), Positives = 94/156 (60%), Gaps = 1/156 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ + DL     PN P+  +DLG K IG+A+SD  R  A P   + + K T  A  L 
Sbjct: 1   MAVVDLIDLPAIAPPNTPLVGLDLGEKTIGVAVSDATRMVASPLGLIRKTKFTDDAKALF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + +   +  +IGLP+NM+G+EG R  S RAF  N++  +  +P  FWDER++T++  +
Sbjct: 61  KLMESRRASGIVIGLPVNMDGTEGTRCQSNRAFARNLLRLREDLPIAFWDERMSTMAVNR 120

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           +L+ + +++R +R   VD +AAA ILQ  LDR+  L
Sbjct: 121 MLVGEADMTRARRADVVDKMAAAWILQGALDRLRNL 156


>gi|329889392|ref|ZP_08267735.1| conserved hypothetical UPF0081 family protein [Brevundimonas
           diminuta ATCC 11568]
 gi|328844693|gb|EGF94257.1| conserved hypothetical UPF0081 family protein [Brevundimonas
           diminuta ATCC 11568]
          Length = 154

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 62/154 (40%), Positives = 93/154 (60%), Gaps = 2/154 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +L + +L  +  PN P   +DLG   IG+++SD GR  A P   + + K +Q A +L 
Sbjct: 1   MPVLDLSELPAACPPNTPWLGLDLGENTIGVSVSDTGRIIASPLELIRKTKFSQDAEQLF 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +    ++A +IGLPLNM+G+EGPR  S RAF    ++R   V   F DERL+T + ++
Sbjct: 61  RIMDGRKVSALVIGLPLNMDGTEGPRAQSCRAFAR-NLERFRPVNVAFQDERLSTTAVER 119

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
            LI +++++RK+R   VD  AAA ILQ  LDR+ 
Sbjct: 120 FLIDELDLTRKRRADVVDRTAAAWILQGALDRLR 153


>gi|16800605|ref|NP_470873.1| Holliday junction resolvase-like protein [Listeria innocua
           Clip11262]
 gi|32130053|sp|Q92BL1|RUVX_LISIN RecName: Full=Putative Holliday junction resolvase
 gi|16414010|emb|CAC96768.1| lin1537 [Listeria innocua Clip11262]
 gi|313618843|gb|EFR90723.1| putative Holliday junction resolvase [Listeria innocua FSL S4-378]
 gi|313623694|gb|EFR93845.1| putative Holliday junction resolvase [Listeria innocua FSL J1-023]
          Length = 138

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/139 (33%), Positives = 80/139 (57%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +  +      +   +    +   ++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGWTAQGVETIQIDESRKQFGYDRVKELVLEYEVEKVVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR +
Sbjct: 61  LPKNMNNTIGPRAESSKIYAE-VLESRIGLPVVLWDERLTTSAAERTLIEADVSRKKRKE 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LD  +
Sbjct: 120 VIDKLAAVMILQSYLDTTN 138


>gi|16803542|ref|NP_465027.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           EGD-e]
 gi|224500668|ref|ZP_03669017.1| hypothetical protein LmonF1_13746 [Listeria monocytogenes Finland
           1988]
 gi|224501558|ref|ZP_03669865.1| hypothetical protein LmonFR_03407 [Listeria monocytogenes FSL
           R2-561]
 gi|254828264|ref|ZP_05232951.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|254829739|ref|ZP_05234394.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           10403S]
 gi|254898332|ref|ZP_05258256.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           J0161]
 gi|254912176|ref|ZP_05262188.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254936504|ref|ZP_05268201.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|255018845|ref|ZP_05290971.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           FSL F2-515]
 gi|290893861|ref|ZP_06556839.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
 gi|315282410|ref|ZP_07870829.1| putative Holliday junction resolvase [Listeria marthii FSL S4-120]
 gi|32130047|sp|Q8Y723|RUVX_LISMO RecName: Full=Putative Holliday junction resolvase
 gi|16410931|emb|CAC99580.1| lmo1502 [Listeria monocytogenes EGD-e]
 gi|258600652|gb|EEW13977.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|258609098|gb|EEW21706.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|290556578|gb|EFD90114.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
 gi|293590149|gb|EFF98483.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|313608700|gb|EFR84531.1| putative Holliday junction resolvase [Listeria monocytogenes FSL
           F2-208]
 gi|313613944|gb|EFR87669.1| putative Holliday junction resolvase [Listeria marthii FSL S4-120]
          Length = 138

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/139 (33%), Positives = 80/139 (57%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +  +      +   +    +   ++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGWTAQGVETIQIDENRKQFGYDRVKELVLEYEVEKVVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR +
Sbjct: 61  LPKNMNNTIGPRAESSKIYAE-VLEARIGLPVVLWDERLTTSAAERTLIEADVSRKKRKE 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LD  +
Sbjct: 120 VIDKLAAVMILQSYLDTTN 138


>gi|323136211|ref|ZP_08071293.1| Holliday junction resolvase YqgF [Methylocystis sp. ATCC 49242]
 gi|322398285|gb|EFY00805.1| Holliday junction resolvase YqgF [Methylocystis sp. ATCC 49242]
          Length = 157

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 68/150 (45%), Positives = 93/150 (62%), Gaps = 1/150 (0%)

Query: 6   IEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITT 65
           IE++ + L     +  +DLGTK IGLA+SD  RR A P   + R K +Q A  LL     
Sbjct: 8   IEEVARVLPAKGRLMGLDLGTKTIGLALSDVERRLASPLDTIKRVKFSQDAGALLQRAQD 67

Query: 66  ENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM 125
            ++ A + GLPLNM+G+ GPR  +TRAF+   + +   +PFVFWDERL+T +  + LI  
Sbjct: 68  FDVQALVFGLPLNMDGTAGPRAQATRAFMR-NLRKLTPIPFVFWDERLSTAAVTRELIAQ 126

Query: 126 NVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           + SR KR + VD +AAA ILQ  LDR+S L
Sbjct: 127 DASRAKRAEVVDRMAAAYILQGALDRLSRL 156


>gi|90423758|ref|YP_532128.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris
           BisB18]
 gi|146325601|sp|Q215X7|RUVX_RHOPB RecName: Full=Putative Holliday junction resolvase
 gi|90105772|gb|ABD87809.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris
           BisB18]
          Length = 163

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 63/156 (40%), Positives = 86/156 (55%), Gaps = 1/156 (0%)

Query: 2   SILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS 61
            IL + +          +  +DLGTK IG+A+SDP RR A     ++       A  LL 
Sbjct: 4   PILPLIEAAAQWPARGALIGLDLGTKTIGVAVSDPDRRLATGVETIIHTAFKANAARLLL 63

Query: 62  FITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQI 121
                N   F++GLP+NM+GSEGPR  STRAF  N   R   +P   WDERL+T + ++ 
Sbjct: 64  LAGQRNAVGFVLGLPINMDGSEGPRAQSTRAFARNF-ARLTDLPIGLWDERLSTSAVERE 122

Query: 122 LIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
           LI  +VSR KR + +D  AA  ILQ  LDR++ L +
Sbjct: 123 LIANDVSRAKRAKVIDEHAAIFILQGALDRLTVLNA 158


>gi|108758109|ref|YP_633960.1| hypothetical protein MXAN_5823 [Myxococcus xanthus DK 1622]
 gi|118597216|sp|Q1D063|RUVX_MYXXD RecName: Full=Putative Holliday junction resolvase
 gi|108461989|gb|ABF87174.1| conserved hypothetical protein TIGR00250 [Myxococcus xanthus DK
           1622]
          Length = 151

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 49/134 (36%), Positives = 75/134 (55%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
                +DLGTK IG+A+SD     A     + R  +      L +  +   +   ++GLP
Sbjct: 1   MRTMGLDLGTKTIGVAVSDGLGLTAQGITTVRRTSLKADLAALATVASEHEVTHVVLGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+GSEGPR  ++R F    + + + V    WDERL+TV+A + L++ +VSR +R + +
Sbjct: 61  LNMDGSEGPRAEASRKFAD-TLAQSLGVTVELWDERLSTVAATRTLLEADVSRARRREVI 119

Query: 137 DSIAAALILQEVLD 150
           D +AA  ILQ  LD
Sbjct: 120 DQVAAQFILQGWLD 133


>gi|92117802|ref|YP_577531.1| Holliday junction resolvase YqgF [Nitrobacter hamburgensis X14]
 gi|91800696|gb|ABE63071.1| Holliday junction resolvase YqgF [Nitrobacter hamburgensis X14]
          Length = 168

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 67/160 (41%), Positives = 92/160 (57%), Gaps = 3/160 (1%)

Query: 1   MS--ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE 58
           M   +L + +          +  +DLGTK IG+A+SDP RR A     L RK  T  A  
Sbjct: 6   MPASVLPLIEAAAHWPERGALVGLDLGTKTIGVAVSDPDRRLATGVETLQRKTFTADAAR 65

Query: 59  LLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSA 118
           LL+     N A F++GLP+NM+GSEGPR  STRAF    + R   +    WDERL+TV+ 
Sbjct: 66  LLAIAGERNAAGFVLGLPINMDGSEGPRAQSTRAFAR-NLARLTDLAIGLWDERLSTVAV 124

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           ++ LI M++SR KR + +D  AA  ILQ  LDR++ L  +
Sbjct: 125 ERELIGMDMSRAKRAKVIDEHAAIFILQGALDRLAVLRRT 164


>gi|315303254|ref|ZP_07873898.1| putative Holliday junction resolvase [Listeria ivanovii FSL F6-596]
 gi|313628366|gb|EFR96855.1| putative Holliday junction resolvase [Listeria ivanovii FSL F6-596]
          Length = 138

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/139 (33%), Positives = 80/139 (57%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +  +      +   +    +   ++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGWTAQGVETIQIDEKRKQFGYERVKELVLEYEVEKVVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR +
Sbjct: 61  LPKNMNNTIGPRAESSKIYAE-VLEARIGLPVVLWDERLTTTAAERTLIEADVSRKKRKE 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LD  +
Sbjct: 120 VIDKLAAVMILQSYLDTTN 138


>gi|254519280|ref|ZP_05131336.1| conserved hypothetical protein [Clostridium sp. 7_2_43FAA]
 gi|226913029|gb|EEH98230.1| conserved hypothetical protein [Clostridium sp. 7_2_43FAA]
          Length = 138

 Score =  145 bits (367), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 51/138 (36%), Positives = 71/138 (51%), Gaps = 1/138 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G+K IG+AISDP    A     + R K  Q   E+       ++   +IGLP
Sbjct: 1   MRILGLDVGSKTIGVAISDPLGWTAQGITTIRRSKKEQDIEEIKKLCKEYSVETIVIGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ G             I     +    WDERLTTV+A + +++ ++SR KR + V
Sbjct: 61  KNMNGTIGESGERVLELSEI-IKEATGIKVEMWDERLTTVAAHKAMLEADLSRGKRKKIV 119

Query: 137 DSIAAALILQEVLDRISF 154
           D IAA  ILQ  LDR+S 
Sbjct: 120 DKIAATYILQGYLDRLSM 137


>gi|158320692|ref|YP_001513199.1| Holliday junction resolvase YqgF [Alkaliphilus oremlandii OhILAs]
 gi|158140891|gb|ABW19203.1| Holliday junction resolvase YqgF [Alkaliphilus oremlandii OhILAs]
          Length = 139

 Score =  145 bits (367), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 73/138 (52%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
                 +D+G K IG+AISD     A     + R  + +    L   I   +I   ++GL
Sbjct: 1   MPRSMGLDVGDKTIGVAISDLFGWTAQGLETIQRIGIKKDLQRLEVIIKEHDINKIVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMNG+ GP+      F   +  R   V  V WDERLTTV+A++ LI+ +VSRKKR + 
Sbjct: 61  PKNMNGTIGPQGEKVLEFNERLKGRFKDVEIVLWDERLTTVAAERSLIEADVSRKKRKEV 120

Query: 136 VDSIAAALILQEVLDRIS 153
           +D +AA  ILQ  LD  S
Sbjct: 121 IDKMAAVYILQGYLDSAS 138


>gi|56963359|ref|YP_175090.1| holliday junction resolvase [Bacillus clausii KSM-K16]
 gi|62900942|sp|Q5WHM6|RUVX_BACSK RecName: Full=Putative Holliday junction resolvase
 gi|56909602|dbj|BAD64129.1| holliday junction resolvase [Bacillus clausii KSM-K16]
          Length = 142

 Score =  145 bits (367), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 55/137 (40%), Positives = 75/137 (54%), Gaps = 3/137 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVR--KKVTQTALELLSFITTENIAAFIIGLPL 77
             +D+GTK IG+AISD     A   P + R      +    L   I   ++   +IG P 
Sbjct: 4   IGLDVGTKTIGVAISDAFGWTAQGLPTIQRSEDDPNRDFEALAQLIKENDVQKVVIGYPK 63

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMNG+ G     +  F    ++++  V  V WDERLTT +AQ++LID +VSRKKR + VD
Sbjct: 64  NMNGTVGESATRSETFAR-TLEQQCNVQTVLWDERLTTAAAQRVLIDADVSRKKRKKAVD 122

Query: 138 SIAAALILQEVLDRISF 154
            +AA  ILQ  LDR S 
Sbjct: 123 KMAAVFILQGYLDRQSH 139


>gi|187778852|ref|ZP_02995325.1| hypothetical protein CLOSPO_02447 [Clostridium sporogenes ATCC
           15579]
 gi|187772477|gb|EDU36279.1| hypothetical protein CLOSPO_02447 [Clostridium sporogenes ATCC
           15579]
          Length = 137

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 71/137 (51%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G + IG+A+SDP    A     + RK       E+        +   + GLP
Sbjct: 1   MRILGLDIGDRTIGVALSDPLGFTAQGITTIRRKSEAYDLEEIKKICDKYEVDTIVSGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP+      F   +I   V +    WDERLTTV+A + +++ ++SR KR + V
Sbjct: 61  KNMNGTLGPQSEKVLEFCD-LIKEHVNIEIKMWDERLTTVAATRAMLEADLSRSKRKKIV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA  ILQ  LD +S
Sbjct: 120 DKMAATYILQGYLDSLS 136


>gi|319405723|emb|CBI79346.1| putative resolvase [Bartonella sp. AR 15-3]
          Length = 163

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 81/158 (51%), Positives = 110/158 (69%), Gaps = 1/158 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+I+ I ++   L   Q IAS+DLGTK IG+AISD    F++PRP + RKK T  AL L+
Sbjct: 1   MAIISINEVTIHLLFGQTIASLDLGTKTIGIAISDISLTFSNPRPVIYRKKFTLDALTLI 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+ A I+GLP+NMNGS GPRV +T+ FV NM      +PF+FWDERL+T++A++
Sbjct: 61  EIFNNENVGAIIVGLPINMNGSNGPRVQATKTFVSNM-ATYTKIPFIFWDERLSTIAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
             ++MN+SR KR  ++DS AAA ILQ  LDRI  L+S+
Sbjct: 120 YFLEMNMSRSKRKSRIDSAAAAFILQGALDRIKTLQSN 157


>gi|167628659|ref|YP_001679158.1| holliday junction resolvase, putative [Heliobacterium modesticaldum
           Ice1]
 gi|226725525|sp|B0TFZ0|RUVX_HELMI RecName: Full=Putative Holliday junction resolvase
 gi|167591399|gb|ABZ83147.1| holliday junction resolvase, putative [Heliobacterium modesticaldum
           Ice1]
          Length = 149

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 54/143 (37%), Positives = 80/143 (55%), Gaps = 1/143 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G K IG+A+SD     A     + R ++      L   + T  +   + GLP
Sbjct: 1   MRIMGLDVGDKTIGVAVSDLMGWTAQGVATIRRSRLAADLEHLRELVKTYEVERIVCGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR    R F   + ++K+ +P  +WDERLTTV+AQ+ LI  ++SR KR Q V
Sbjct: 61  RNMNGTYGPRAEGIRKFGSLV-EKKLNIPVDYWDERLTTVAAQKTLIAGDLSRAKRKQVV 119

Query: 137 DSIAAALILQEVLDRISFLESSK 159
           D +AA LILQ  +D  + L + +
Sbjct: 120 DKLAAVLILQNYMDAKAHLAAKE 142


>gi|313633177|gb|EFS00059.1| putative Holliday junction resolvase [Listeria seeligeri FSL
           N1-067]
 gi|313637761|gb|EFS03116.1| putative Holliday junction resolvase [Listeria seeligeri FSL
           S4-171]
          Length = 138

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 47/139 (33%), Positives = 80/139 (57%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +  +      +   +    +   ++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGWTAQGVETIQIDEKRKQFGYDRVKELVLEYEVEKVVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR +
Sbjct: 61  LPKNMNNTIGPRAESSKIYAE-VLEARIGLPVVLWDERLTTTAAERTLIEADVSRKKRKE 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LD  +
Sbjct: 120 VIDKLAAVMILQSYLDTTN 138


>gi|39936176|ref|NP_948452.1| Holliday junction resolvase-like protein [Rhodopseudomonas
           palustris CGA009]
 gi|192291893|ref|YP_001992498.1| Holliday junction resolvase-like protein [Rhodopseudomonas
           palustris TIE-1]
 gi|62900984|sp|Q6N569|RUVX_RHOPA RecName: Full=Putative Holliday junction resolvase
 gi|226731645|sp|B3Q9X0|RUVX_RHOPT RecName: Full=Putative Holliday junction resolvase
 gi|39650031|emb|CAE28554.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
 gi|192285642|gb|ACF02023.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris TIE-1]
          Length = 160

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 65/161 (40%), Positives = 89/161 (55%), Gaps = 3/161 (1%)

Query: 1   MS--ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE 58
           M   IL + +          +  +DLGTK IG+A SDP R+ A     + RK  T  A  
Sbjct: 1   MPALILPLIEAAVHWPVRGALLGLDLGTKTIGVAASDPDRKLATGVETIARKAFTADAAR 60

Query: 59  LLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSA 118
           LL+         F++GLPLNM+GSEGPR  STRAF    + R   +P   WDERL+T + 
Sbjct: 61  LLALAAERTACGFVLGLPLNMDGSEGPRAQSTRAFAR-NLSRLTELPIGLWDERLSTAAV 119

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           ++ LI  +VSR KR + +D  AA  ILQ  LDR++ L  ++
Sbjct: 120 ERELIANDVSRAKRAKVIDEHAAIFILQGALDRLAALRRAE 160


>gi|331269728|ref|YP_004396220.1| Holliday junction resolvase YqgF [Clostridium botulinum BKT015925]
 gi|329126278|gb|AEB76223.1| Holliday junction resolvase YqgF [Clostridium botulinum BKT015925]
          Length = 135

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 52/136 (38%), Positives = 73/136 (53%), Gaps = 1/136 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G K IG+A+SDP    A     + RK++ +   E+        I   I GLP
Sbjct: 1   MRILGLDIGNKTIGVAVSDPLGFTAQGITTIHRKELEKDIEEVGKICHEYKIELIISGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ G +      F   + D+   +P   WDERLTTV+A + +++ N+SR KR + V
Sbjct: 61  KNMNGTIGEQGEKVLEFCDVLKDKL-DIPIKMWDERLTTVAAHRAMLEANLSRAKRKKIV 119

Query: 137 DSIAAALILQEVLDRI 152
           D IAA  ILQ  LD I
Sbjct: 120 DKIAATYILQGYLDSI 135


>gi|254294342|ref|YP_003060365.1| Holliday junction resolvase YqgF [Hirschia baltica ATCC 49814]
 gi|254042873|gb|ACT59668.1| Holliday junction resolvase YqgF [Hirschia baltica ATCC 49814]
          Length = 150

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 59/155 (38%), Positives = 90/155 (58%), Gaps = 6/155 (3%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVR-KKVTQTALEL 59
           M+IL ++ L     P  P+  +D GTK IG+A +D  R  A P   + + KK+      L
Sbjct: 1   MAILELDQL----PPRGPLLGLDPGTKTIGIAAADGLRMIASPVETIKKGKKLAPALTRL 56

Query: 60  LSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQ 119
                       +IGLP+NM+GS GPRV + RA   N+++++  VP  FWDERL+T + +
Sbjct: 57  FELYDDRVCVGLVIGLPVNMDGSHGPRVQAVRALARNILEKR-DVPIAFWDERLSTAAVE 115

Query: 120 QILIDMNVSRKKRIQKVDSIAAALILQEVLDRISF 154
           + L++ + SR KR + +D +AAA ILQ  +DR+S 
Sbjct: 116 RTLLEADTSRAKRAEVIDKMAAAYILQGAIDRLSN 150


>gi|217976928|ref|YP_002361075.1| Holliday junction resolvase-like protein [Methylocella silvestris
           BL2]
 gi|254767519|sp|B8EPC5|RUVX_METSB RecName: Full=Putative Holliday junction resolvase
 gi|217502304|gb|ACK49713.1| Holliday junction resolvase YqgF [Methylocella silvestris BL2]
          Length = 161

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 77/157 (49%), Positives = 101/157 (64%), Gaps = 1/157 (0%)

Query: 3   ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSF 62
           IL + DL   + P Q +  IDLGTK IGLA+SD  RR A P   + R K ++ A+ L+  
Sbjct: 5   ILEVADLPARVGPRQRLIGIDLGTKTIGLALSDVERRIATPLETIQRIKFSKDAVRLIEL 64

Query: 63  ITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL 122
               +  A IIGLPLNM+GS+GPRV +TRAFV   +   V  PFV+WDERL+T +  + L
Sbjct: 65  AEKFDAGALIIGLPLNMDGSQGPRVQATRAFVR-SLSALVSKPFVYWDERLSTAAVTRSL 123

Query: 123 IDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
           ID +VSR KR + VD +AAA ILQ VLDR+  +E+  
Sbjct: 124 IDQDVSRLKRAEVVDKMAAAYILQGVLDRLRRIEADA 160


>gi|154247845|ref|YP_001418803.1| Holliday junction resolvase YqgF [Xanthobacter autotrophicus Py2]
 gi|154161930|gb|ABS69146.1| Holliday junction resolvase YqgF [Xanthobacter autotrophicus Py2]
          Length = 176

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 61/152 (40%), Positives = 83/152 (54%), Gaps = 1/152 (0%)

Query: 2   SILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS 61
            I  + D+   L P   +  +DLGTK IG+A  DP RR A     + R K T  A  LL+
Sbjct: 9   PIGPLADIAPLLPPRGALLGLDLGTKTIGVASCDPDRRVATVVETVQRTKFTADAQRLLA 68

Query: 62  FITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQI 121
                    F++GLPLNM+ SEGPR  ++RAF    + R   +P   WDERL+T + ++ 
Sbjct: 69  LAAERRAVGFVLGLPLNMDASEGPRAQASRAFAR-NLARLTALPIALWDERLSTAAVERA 127

Query: 122 LIDMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
           LI  +VSR +R   VD  AAA IL+  L  +S
Sbjct: 128 LISADVSRARRAAVVDQHAAAFILEGALGFLS 159


>gi|322806899|emb|CBZ04469.1| putative Holliday junction resolvase [Clostridium botulinum H04402
           065]
          Length = 137

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 71/137 (51%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G + IG+AISDP    A     + RK       E+        +   + GLP
Sbjct: 1   MRILGLDIGDRTIGIAISDPLGFTAQGITTIRRKSEAYDLEEIKKICDKYEVDTIVSGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP+      F   +I   + +    WDERLTTV+A + +++ ++SR KR + V
Sbjct: 61  KNMNGTLGPQSEKVLEFCD-LIKEHLNIEIKMWDERLTTVAATRAMLEADLSRSKRKKIV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA  ILQ  LD +S
Sbjct: 120 DKVAATYILQGYLDSLS 136


>gi|300854403|ref|YP_003779387.1| putative Holliday junction resolvase [Clostridium ljungdahlii DSM
           13528]
 gi|300434518|gb|ADK14285.1| predicted Holliday junction resolvase [Clostridium ljungdahlii DSM
           13528]
          Length = 137

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 52/137 (37%), Positives = 76/137 (55%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G + IG+A+SDP    A     + RK   +   EL S      +   + GLP
Sbjct: 1   MRILGLDIGDRTIGVALSDPLGITAQGITTVRRKNQEKDIEELKSICEKYGVECIVSGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ G +     +F   +I++ + VP   WDERLTTV+A + +I+ ++SR KR + V
Sbjct: 61  KNMNGTLGLQSEKVLSFCK-VIEQSIKVPIKMWDERLTTVAAHRAMIEGDLSRAKRKKIV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA  ILQ  LD IS
Sbjct: 120 DKMAAIYILQGYLDSIS 136


>gi|148380517|ref|YP_001255058.1| hypothetical protein CBO2562 [Clostridium botulinum A str. ATCC
           3502]
 gi|153933531|ref|YP_001384804.1| Holliday junction resolvase-like protein [Clostridium botulinum A
           str. ATCC 19397]
 gi|153935898|ref|YP_001388274.1| Holliday junction resolvase-like protein [Clostridium botulinum A
           str. Hall]
 gi|153940927|ref|YP_001391859.1| Holliday junction resolvase-like protein [Clostridium botulinum F
           str. Langeland]
 gi|168180549|ref|ZP_02615213.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum
           NCTC 2916]
 gi|168182640|ref|ZP_02617304.1| RNAse H-fold protein YqgF [Clostridium botulinum Bf]
 gi|170757368|ref|YP_001782177.1| Holliday junction resolvase-like protein [Clostridium botulinum B1
           str. Okra]
 gi|170760496|ref|YP_001787880.1| Holliday junction resolvase-like protein [Clostridium botulinum A3
           str. Loch Maree]
 gi|226949917|ref|YP_002805008.1| hypothetical protein TIGR00250 [Clostridium botulinum A2 str.
           Kyoto]
 gi|237796000|ref|YP_002863552.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum Ba4
           str. 657]
 gi|167012712|sp|A7FWJ3|RUVX_CLOB1 RecName: Full=Putative Holliday junction resolvase
 gi|167012713|sp|A5I4Z3|RUVX_CLOBH RecName: Full=Putative Holliday junction resolvase
 gi|167012714|sp|A7GGE9|RUVX_CLOBL RecName: Full=Putative Holliday junction resolvase
 gi|226725504|sp|B1IJG5|RUVX_CLOBK RecName: Full=Putative Holliday junction resolvase
 gi|226725505|sp|B1KXB5|RUVX_CLOBM RecName: Full=Putative Holliday junction resolvase
 gi|254767507|sp|C1FTB8|RUVX_CLOBJ RecName: Full=Putative Holliday junction resolvase
 gi|259495699|sp|C3L148|RUVX_CLOB6 RecName: Full=Putative Holliday junction resolvase
 gi|148290001|emb|CAL84120.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC
           3502]
 gi|152929575|gb|ABS35075.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum A
           str. ATCC 19397]
 gi|152931812|gb|ABS37311.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum A
           str. Hall]
 gi|152936823|gb|ABS42321.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum F
           str. Langeland]
 gi|169122580|gb|ACA46416.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum B1
           str. Okra]
 gi|169407485|gb|ACA55896.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum A3
           str. Loch Maree]
 gi|182668482|gb|EDT80461.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum
           NCTC 2916]
 gi|182674156|gb|EDT86117.1| RNAse H-fold protein YqgF [Clostridium botulinum Bf]
 gi|226841351|gb|ACO84017.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum A2
           str. Kyoto]
 gi|229261948|gb|ACQ52981.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum Ba4
           str. 657]
 gi|295319884|gb|ADG00262.1| conserved hypothetical protein TIGR00250 [Clostridium botulinum F
           str. 230613]
          Length = 137

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 71/137 (51%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G + IG+AISDP    A     + RK       E+        +   + GLP
Sbjct: 1   MRILGLDIGDRTIGIAISDPLGFTAQGITTIRRKSEAYDLEEIKKICDKYEVDTIVSGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP+      F   +I   + +    WDERLTTV+A + +++ ++SR KR + V
Sbjct: 61  KNMNGTLGPQSEKVLEFCD-LIKEHLNIEIKMWDERLTTVAATRAMLEADLSRSKRKKIV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA  ILQ  LD +S
Sbjct: 120 DKVAATYILQGYLDSLS 136


>gi|238018987|ref|ZP_04599413.1| hypothetical protein VEIDISOL_00849 [Veillonella dispar ATCC 17748]
 gi|313892893|ref|ZP_07826470.1| RNAse H domain protein, YqgF family [Veillonella sp. oral taxon 158
           str. F0412]
 gi|237864471|gb|EEP65761.1| hypothetical protein VEIDISOL_00849 [Veillonella dispar ATCC 17748]
 gi|313442246|gb|EFR60661.1| RNAse H domain protein, YqgF family [Veillonella sp. oral taxon 158
           str. F0412]
          Length = 139

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 52/140 (37%), Positives = 78/140 (55%), Gaps = 1/140 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I S+D+G++ IG+A SD     A     + R  + +    L   I    +   ++G+P
Sbjct: 1   MRIMSLDVGSRTIGIACSDALLMTAQGIETIRRTSLEKDFNRLQELIAEYEVHELVVGMP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG++G R   T  FV  M    + +P  +WDERL+TV A++ LI  +VSRKKR   +
Sbjct: 61  KNMNGTKGERAEKTEEFVEKM-KEVIDLPVSYWDERLSTVMAERQLIAADVSRKKRKSVI 119

Query: 137 DSIAAALILQEVLDRISFLE 156
           D +AA +ILQ  LDR+ F +
Sbjct: 120 DKMAAVVILQGYLDRLQFNK 139


>gi|269798239|ref|YP_003312139.1| Holliday junction resolvase YqgF [Veillonella parvula DSM 2008]
 gi|282850477|ref|ZP_06259856.1| RNAse YqgF [Veillonella parvula ATCC 17745]
 gi|269094868|gb|ACZ24859.1| Holliday junction resolvase YqgF [Veillonella parvula DSM 2008]
 gi|282579970|gb|EFB85374.1| RNAse YqgF [Veillonella parvula ATCC 17745]
          Length = 139

 Score =  145 bits (365), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 52/140 (37%), Positives = 79/140 (56%), Gaps = 1/140 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I S+D+G++ IG+A SD     A     + R  + +    L   I+   +   ++G+P
Sbjct: 1   MRIMSLDVGSRTIGIACSDALLMTAQGIETIRRTSLEKDFNRLQELISEYEVHELVVGMP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG++G R   T  FV  M    + +P  +WDERL+TV A++ LI  +VSRKKR   +
Sbjct: 61  KNMNGTKGERAEKTEEFVAKM-KEVIDLPVTYWDERLSTVMAERQLIAADVSRKKRKSVI 119

Query: 137 DSIAAALILQEVLDRISFLE 156
           D +AA +ILQ  LDR+ F +
Sbjct: 120 DKMAAVVILQGYLDRLQFNK 139


>gi|296445897|ref|ZP_06887848.1| Holliday junction resolvase YqgF [Methylosinus trichosporium OB3b]
 gi|296256565|gb|EFH03641.1| Holliday junction resolvase YqgF [Methylosinus trichosporium OB3b]
          Length = 160

 Score =  145 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 67/153 (43%), Positives = 92/153 (60%), Gaps = 1/153 (0%)

Query: 5   LIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFIT 64
            +E+L   L     +  +D+GTK IGLA+SD  RR A P   + R K T  A  L + + 
Sbjct: 7   TVEELAALLPAKGRLMGLDVGTKTIGLALSDVERRLASPLETIRRGKFTSDAERLGALVA 66

Query: 65  TENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID 124
             +IAA I+GLPLNM+GSEGPR  +TRAF+   +  +  + + FWDERL+T +  + L+ 
Sbjct: 67  QFDIAALIVGLPLNMDGSEGPRAQATRAFMR-NLGARFALRYAFWDERLSTAAVTRELLA 125

Query: 125 MNVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
            + SR KR   VD +AAA ILQ  LDR+  L S
Sbjct: 126 QDASRAKRAAVVDRMAAAYILQGALDRLRRLAS 158


>gi|308070325|ref|YP_003871930.1| Holliday junction resolvase [Paenibacillus polymyxa E681]
 gi|305859604|gb|ADM71392.1| Putative Holliday junction resolvase [Paenibacillus polymyxa E681]
          Length = 138

 Score =  145 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 50/137 (36%), Positives = 76/137 (55%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             +  +D G +RIG+A+SD     A     + R+       ++ + +    +   ++GLP
Sbjct: 1   MKVMGLDYGDRRIGVAVSDAFGWTAQGLEVIERRGDDSEFGKIANLVRDNEVGEIVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR      F +  +   + +P   WDERLTT SA++ L++ +VSRKKR Q V
Sbjct: 61  KNMNGTVGPRGEICIEFAN-RLKELLGLPVHLWDERLTTRSAERALLEADVSRKKRKQVV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA+LILQ  LD  S
Sbjct: 120 DKLAASLILQNYLDAHS 136


>gi|260881084|ref|ZP_05403565.2| putative holliday junction resolvase [Mitsuokella multacida DSM
           20544]
 gi|260849464|gb|EEX69471.1| putative holliday junction resolvase [Mitsuokella multacida DSM
           20544]
          Length = 138

 Score =  145 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 47/138 (34%), Positives = 72/138 (52%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            +   S+D+G + IG+A+SD     A     + RK +      L   +      + + GL
Sbjct: 1   MKRYMSLDIGDRTIGIAVSDLLGLTAQGVETIRRKSLADDLKRLGELMQAYETKSLVSGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NM+G+EG R    + F+  +      V   FWDERL+TV+A + LI+ +VSR+KR + 
Sbjct: 61  PKNMDGTEGDRCAIVKEFMAEVKKAYPDVEVFFWDERLSTVAATRSLIEADVSRRKRKKV 120

Query: 136 VDSIAAALILQEVLDRIS 153
           +D +AA  ILQ  LD   
Sbjct: 121 IDKMAAVFILQGFLDSKR 138


>gi|302382947|ref|YP_003818770.1| Holliday junction resolvase YqgF [Brevundimonas subvibrioides ATCC
           15264]
 gi|302193575|gb|ADL01147.1| Holliday junction resolvase YqgF [Brevundimonas subvibrioides ATCC
           15264]
          Length = 173

 Score =  145 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 62/154 (40%), Positives = 88/154 (57%), Gaps = 2/154 (1%)

Query: 2   SILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS 61
            +L + DL  +  P+     +DLG   IG+A SD  R  A P   + + K T  A  L  
Sbjct: 10  PVLNLTDLAAACPPDTAWMGLDLGETTIGVATSDTSRMIASPLELIRKSKFTAEAHALFR 69

Query: 62  FITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQI 121
            +    ++A +IGLP+NM+G+EGPR  S RAF    +DR   V   FWDERL+T + ++ 
Sbjct: 70  LMDHRKVSALVIGLPVNMDGTEGPRAQSCRAFAR-NLDRIRPVNVAFWDERLSTSAVERF 128

Query: 122 LI-DMNVSRKKRIQKVDSIAAALILQEVLDRISF 154
           LI ++++SRK+R   VD  AAA ILQ  LDR+  
Sbjct: 129 LIDELDLSRKRRAGVVDRTAAAWILQGALDRVRH 162


>gi|258645601|ref|ZP_05733070.1| putative Holliday junction resolvase [Dialister invisus DSM 15470]
 gi|260402959|gb|EEW96506.1| putative Holliday junction resolvase [Dialister invisus DSM 15470]
          Length = 142

 Score =  144 bits (364), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 53/142 (37%), Positives = 79/142 (55%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I S+D+G++ IG+A+SD     A     +      +  + L       N+  F+IG+P
Sbjct: 1   MRIMSLDVGSQTIGVAVSDLFGWTAQGVETIRHTTREKDFVRLRHLADEYNVEEFVIGMP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNMNG++G R   T  F   +      +P+ FWDERLTTV AQ+ LI+ +VSRKKR + +
Sbjct: 61  LNMNGTKGMRAEQTEKFAEALAAAFPDIPYHFWDERLTTVMAQRQLIEADVSRKKRKKVI 120

Query: 137 DSIAAALILQEVLDRISFLESS 158
           D +AA +IL+  L  +SF    
Sbjct: 121 DKMAAVVILEGYLQHLSFKNRG 142


>gi|302391206|ref|YP_003827026.1| Holliday junction resolvase YqgF [Acetohalobium arabaticum DSM
           5501]
 gi|302203283|gb|ADL11961.1| Holliday junction resolvase YqgF [Acetohalobium arabaticum DSM
           5501]
          Length = 138

 Score =  144 bits (364), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 50/138 (36%), Positives = 73/138 (52%), Gaps = 1/138 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I  +D G KRIG A SD     A  +  +      +   E+ S I   ++   ++GL
Sbjct: 1   MSRILGLDFGDKRIGAATSDALGWTAQGKKVIQNTSWEEVVAEINSLIEQYDVGKVVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMNG+ GPR   T  FV   +  ++  P + WDERL+T +A++ L+  +VSR KR   
Sbjct: 61  PKNMNGTLGPRAEKTLDFVEQ-LKEEIEPPIITWDERLSTAAAERTLLKADVSRAKRKDV 119

Query: 136 VDSIAAALILQEVLDRIS 153
           +D +AA +ILQ  LD  S
Sbjct: 120 IDKMAAVVILQSYLDAQS 137


>gi|86749549|ref|YP_486045.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris HaA2]
 gi|146325600|sp|Q2IXC6|RUVX_RHOP2 RecName: Full=Putative Holliday junction resolvase
 gi|86572577|gb|ABD07134.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris HaA2]
          Length = 160

 Score =  144 bits (364), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 69/159 (43%), Positives = 90/159 (56%), Gaps = 3/159 (1%)

Query: 1   MS--ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE 58
           M   IL + +          +  +DLGTK IG+A+SDP RR A     + RK  T  A  
Sbjct: 1   MPALILPLIEAAGHWPARGSLLGLDLGTKTIGVAVSDPDRRLATGIETVARKAFTADAQR 60

Query: 59  LLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSA 118
           LL+     N   F++GLPLNM+GSEGPRV STRAF  N   R   +P   WDERL+T + 
Sbjct: 61  LLALAAGRNACGFVLGLPLNMDGSEGPRVQSTRAFARNF-ARLTELPIGLWDERLSTAAV 119

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLES 157
           ++ LI  +VSR KR + +D  AA  ILQ  LDR++ L  
Sbjct: 120 ERELIANDVSRAKRAKIIDEHAAIYILQGALDRLATLNR 158


>gi|168702140|ref|ZP_02734417.1| hypothetical protein GobsU_21610 [Gemmata obscuriglobus UQM 2246]
          Length = 169

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 49/142 (34%), Positives = 70/142 (49%), Gaps = 3/142 (2%)

Query: 12  SLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAF 71
           S  P   +  +D GTKRIG+A+ DP R  A P          +              A  
Sbjct: 10  SFPPRGALLGVDYGTKRIGVAVCDPDRVIASPVGTQANDATREP--YFRDLCARSKFAGV 67

Query: 72  IIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           ++GLPL+ +G E P     RAF    +     +P V WDER T+ +A+  L+   ++RKK
Sbjct: 68  VVGLPLHASGEESPMSGEARAFARW-LSDLTGLPVVMWDERHTSFAAESALLGAGLTRKK 126

Query: 132 RIQKVDSIAAALILQEVLDRIS 153
           R +KVD +AA +ILQ  +D  S
Sbjct: 127 RKEKVDRVAAQMILQTFIDAGS 148


>gi|291548156|emb|CBL21264.1| conserved hypothetical protein TIGR00250 [Ruminococcus sp. SR1/5]
          Length = 150

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 44/146 (30%), Positives = 76/146 (52%), Gaps = 4/146 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             +  +D G+K +G+A+SDP    A     + RK   K+ +T   +   I+   +   ++
Sbjct: 1   MRVLGLDYGSKTVGVAVSDPLGLTAQGVETVWRKQENKLRRTLARIEEIISEYQVTEIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN + G R   +  F    ++++  +P V WDERLTT++A + L +  V ++ R 
Sbjct: 61  GYPKNMNNTVGERAEKSLEFKEM-LEKRTGLPVVMWDERLTTMAADRTLEETGVHKEDRK 119

Query: 134 QKVDSIAAALILQEVLDRISFLESSK 159
           Q +D +AA  ILQ  LD  ++    +
Sbjct: 120 QYLDQVAAVFILQGYLDAAAYRREQQ 145


>gi|259502866|ref|ZP_05745768.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
 gi|259169233|gb|EEW53728.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
          Length = 147

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 47/138 (34%), Positives = 80/138 (57%), Gaps = 3/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+A+SDP    A     +   +  +      +   +  E +A F++G
Sbjct: 1   MRLLGLDVGSKTVGVAVSDPLGWTAQAVEIIPIDEDAEVFGLDRVAELVHKEQVAGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRI 133
           LP NMN +EGPRV +++ +   + +R   +P  F DERLTTV A ++L+ + ++SR K+ 
Sbjct: 61  LPKNMNNTEGPRVAASKHYGELLQERFPQLPIDFQDERLTTVEAHRMLVEEADISRAKQK 120

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA  ILQ  LDR
Sbjct: 121 KVIDEVAATFILQSYLDR 138


>gi|226324641|ref|ZP_03800159.1| hypothetical protein COPCOM_02426 [Coprococcus comes ATCC 27758]
 gi|225207089|gb|EEG89443.1| hypothetical protein COPCOM_02426 [Coprococcus comes ATCC 27758]
          Length = 143

 Score =  144 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 52/140 (37%), Positives = 72/140 (51%), Gaps = 4/140 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFI 72
              I  +D GTK +G+A+SDP    A     + RK   K+ +T   + S  T   +  F+
Sbjct: 1   MMRIMGLDYGTKTVGVAVSDPLGITAQAVETVTRKDENKLRKTLARIESLATEYGVEKFV 60

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           IG P +MN   G R      F    + R+  +  V WDERLTTV A++ L++  V R+ R
Sbjct: 61  IGFPKHMNNDIGERAEKALEFGEM-LKRRTGIEIVMWDERLTTVEAERTLMESGVRRENR 119

Query: 133 IQKVDSIAAALILQEVLDRI 152
            Q VD IAA  ILQ  LD +
Sbjct: 120 KQYVDQIAAVFILQGYLDSL 139


>gi|114570258|ref|YP_756938.1| Holliday junction resolvase YqgF [Maricaulis maris MCS10]
 gi|114340720|gb|ABI66000.1| Holliday junction resolvase YqgF [Maricaulis maris MCS10]
          Length = 151

 Score =  144 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 61/156 (39%), Positives = 86/156 (55%), Gaps = 6/156 (3%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I+ +EDL     P+ P+ ++D G+K IG+A     R  + P   + R K T  A  + 
Sbjct: 1   MPIVTLEDL-----PDGPLIALDPGSKTIGVAACGASRGLSTPVETIKRTKFTADAERVF 55

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +      A ++GLP+NM+GSEGPRV S RA     + R   +P  F DERL+T  A++
Sbjct: 56  ALLDERQAVAIVMGLPVNMDGSEGPRVQSVRAMAR-NLMRLRDLPIAFQDERLSTFEAEE 114

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLE 156
            LI   V R KR   +D+ AAA ILQ  LDR+  L 
Sbjct: 115 KLISAGVRRDKRKDIIDAHAAANILQSALDRLEMLR 150


>gi|313896256|ref|ZP_07829809.1| RNAse H domain protein, YqgF family [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|312975055|gb|EFR40517.1| RNAse H domain protein, YqgF family [Selenomonas sp. oral taxon 137
           str. F0430]
          Length = 142

 Score =  144 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 51/140 (36%), Positives = 72/140 (51%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
                S+D+G   IG+A+SD     A     + R         L + +    + A + GL
Sbjct: 1   MNRYMSLDIGDVTIGIAVSDLLGLTAQGVETIRRTTPAADFERLGTLMRDYEVDALVAGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MNG EG R    RAF+     R   V   +WDERL+TV+A + L++ +VSRKKR + 
Sbjct: 61  PKHMNGDEGTRCEMVRAFMAEAAQRFPGVKIHYWDERLSTVAATRTLLEGDVSRKKRRKV 120

Query: 136 VDSIAAALILQEVLDRISFL 155
           +D +AA  ILQ  LDR   L
Sbjct: 121 IDKMAAVYILQGFLDRQRNL 140


>gi|227498473|ref|ZP_03928619.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226903931|gb|EEH89849.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 138

 Score =  144 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 75/137 (54%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +DLGT+ IG+A+SD     A     + R         L   +  E + AF++G P
Sbjct: 1   MRIMGLDLGTRTIGVAVSDEMGLIARGIETIRRSGTKNDLARLHELVQKEEVGAFVLGYP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ G R  ++ AF   +           WDERL+TV+A+++LID +++RKKR + +
Sbjct: 61  KNMNGTIGERGKASEAFSKLLQTEFPDAKITLWDERLSTVAAEKVLIDADLTRKKRKKVI 120

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA +ILQ  LD + 
Sbjct: 121 DMMAAVVILQNYLDSLR 137


>gi|15613832|ref|NP_242135.1| hypothetical protein BH1269 [Bacillus halodurans C-125]
 gi|32130069|sp|Q9KDE4|RUVX_BACHD RecName: Full=Putative Holliday junction resolvase
 gi|10173885|dbj|BAB04988.1| BH1269 [Bacillus halodurans C-125]
          Length = 140

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 71/137 (51%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIG 74
                +D+GTK IG+A+SD     A       R    +      + S +    +   +IG
Sbjct: 1   MRTLGLDVGTKTIGIAVSDALGWTAQGLETWRRSDANEQADFEHIASLVKEHEVTTIVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NM+GS GP    +  F    + R V    V WDERLTT +A+++LI  +VSRKKR  
Sbjct: 61  LPKNMDGSIGPSGERSETFAA-ELRRYVPCEIVMWDERLTTTAAERMLISADVSRKKRKS 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LDR
Sbjct: 120 VIDKMAAVMILQGYLDR 136


>gi|84684665|ref|ZP_01012565.1| hypothetical protein 1099457000245_RB2654_02114 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667000|gb|EAQ13470.1| hypothetical protein RB2654_02114 [Rhodobacterales bacterium
           HTCC2654]
          Length = 155

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 60/141 (42%), Positives = 85/141 (60%), Gaps = 2/141 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVR-KKVTQTALELLSFITTENIAAFIIG 74
              +A +D G K IG+A+SD  R+ A P   + R KK TQ A  L++ +    I+  ++G
Sbjct: 16  MTALAGLDYGDKTIGVAVSDGMRQVATPLDTIRRGKKFTQDAEALMAILDERAISGLVLG 75

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NM+G+EGPR   TRAF    + R    P  FWDERL+TV+A++ L++ + SR KR  
Sbjct: 76  LPRNMDGTEGPRCQKTRAFAR-NLSRLTERPITFWDERLSTVAAERALLEADTSRAKRSG 134

Query: 135 KVDSIAAALILQEVLDRISFL 155
            +D +AA  ILQ  LDR+  L
Sbjct: 135 VIDHVAAGYILQGALDRMRHL 155


>gi|284048258|ref|YP_003398597.1| Holliday junction resolvase YqgF [Acidaminococcus fermentans DSM
           20731]
 gi|283952479|gb|ADB47282.1| Holliday junction resolvase YqgF [Acidaminococcus fermentans DSM
           20731]
          Length = 139

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 50/135 (37%), Positives = 78/135 (57%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +DLGT+ IG+++SD     A     + RK +      L   +  E +  F++G P
Sbjct: 1   MRIMGLDLGTRTIGVSVSDETGFIARGVETIRRKGLENDLKRLGELVEQEEVGQFVLGYP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNGS G R  ++  F   + +R   +P V WDERL+TV+A+++LI+ ++ RKKR + +
Sbjct: 61  KNMNGSIGDRARASEEFKTILEERFPSIPVVLWDERLSTVAAEKVLIEADLQRKKRKKII 120

Query: 137 DSIAAALILQEVLDR 151
           D +AA +ILQ  LD 
Sbjct: 121 DMMAAVVILQNYLDS 135


>gi|75676194|ref|YP_318615.1| Holliday junction resolvase YqgF [Nitrobacter winogradskyi Nb-255]
 gi|146325584|sp|Q3SR28|RUVX_NITWN RecName: Full=Putative Holliday junction resolvase
 gi|74421064|gb|ABA05263.1| Holliday junction resolvase YqgF [Nitrobacter winogradskyi Nb-255]
          Length = 163

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 62/162 (38%), Positives = 88/162 (54%), Gaps = 3/162 (1%)

Query: 1   MS--ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE 58
           M   +L + +          +  +DLGTK IG+A+SDP RR A     + RK  T  A  
Sbjct: 1   MPASVLPLVEAAAHWPARGALVGLDLGTKTIGVAVSDPDRRLATGVETIRRKTFTADAAR 60

Query: 59  LLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSA 118
           LL+         FI+GLP+NM+GSEGPR  STRAF    + R        WDERL+T + 
Sbjct: 61  LLAIAGERRAEGFILGLPINMDGSEGPRAQSTRAFAR-NLARLTDFAIGLWDERLSTAAV 119

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           ++ LI +++SR +R + +D  AA  ILQ  LDR++    + G
Sbjct: 120 ERELIGLDMSRARRAKVIDEHAAIFILQGALDRLATQRRTSG 161


>gi|326390159|ref|ZP_08211720.1| Holliday junction resolvase YqgF [Thermoanaerobacter ethanolicus JW
           200]
 gi|325993807|gb|EGD52238.1| Holliday junction resolvase YqgF [Thermoanaerobacter ethanolicus JW
           200]
          Length = 139

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 50/136 (36%), Positives = 74/136 (54%), Gaps = 2/136 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G K IG+AISD     A     + R    +    +   I    +   I+GLP
Sbjct: 1   MRIMGLDVGDKTIGVAISDLSGTIAQGLTTIKRSSNKKDFERIKQIINEYEVGMIIVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQK 135
            NMNG+ GP+      FV + +   + +P + WDERLTTV A+++LI+  ++SR KR + 
Sbjct: 61  KNMNGTLGPQGQKVVRFVEH-LKEAINIPIILWDERLTTVEAERVLIEKADISRAKRKEV 119

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LD 
Sbjct: 120 IDKLAAVLILQNYLDS 135


>gi|150015990|ref|YP_001308244.1| Holliday junction resolvase-like protein [Clostridium beijerinckii
           NCIMB 8052]
 gi|189046092|sp|A6LSF8|RUVX_CLOB8 RecName: Full=Putative Holliday junction resolvase
 gi|149902455|gb|ABR33288.1| Holliday junction resolvase YqgF [Clostridium beijerinckii NCIMB
           8052]
          Length = 138

 Score =  143 bits (362), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 53/137 (38%), Positives = 77/137 (56%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +DLG+K IG+A+SDP    A     + R    +   E+  F    +    +IGLP
Sbjct: 1   MRILGLDLGSKTIGVAVSDPLGFTAQGLTTVRRTNKEKDIAEIKKFCDEYDAKVIVIGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP      AF   +I+ ++ V   FWDERLTTV+A + +++ ++SR KR + V
Sbjct: 61  KNMNGTIGPSGEIAMAFGK-VIEEELNVEVKFWDERLTTVAAHKAMLEADLSRNKRKKIV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D +A+  ILQ  LD IS
Sbjct: 120 DKVASTYILQGYLDMIS 136


>gi|291087071|ref|ZP_06345320.2| putative Holliday junction resolvase [Clostridium sp. M62/1]
 gi|291076386|gb|EFE13750.1| putative Holliday junction resolvase [Clostridium sp. M62/1]
          Length = 175

 Score =  143 bits (362), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 52/140 (37%), Positives = 77/140 (55%), Gaps = 4/140 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+K  G+A+SDP    A     +VRK   K+ QT   +   I    I A ++
Sbjct: 36  MRIMGLDFGSKTTGVAVSDPLGLTAQGLETIVRKDENKLRQTCARIEELIEEYQIEAIVL 95

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN + G R   T +F    ++R+   P + WDERLTT++A+++L++  V R+ R 
Sbjct: 96  GYPKNMNNTAGERAEKTESFKEM-LERRTGKPVILWDERLTTIAAERMLMESGVRRENRK 154

Query: 134 QKVDSIAAALILQEVLDRIS 153
             +D +AAALILQ  LD   
Sbjct: 155 AVIDKVAAALILQGYLDSQR 174


>gi|315500169|ref|YP_004088972.1| holliday junction resolvase yqgf [Asticcacaulis excentricus CB 48]
 gi|315418181|gb|ADU14821.1| Holliday junction resolvase YqgF [Asticcacaulis excentricus CB 48]
          Length = 167

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 61/164 (37%), Positives = 89/164 (54%), Gaps = 11/164 (6%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+IL I +L  +L P + +  +DLG K IG+A+SD       P   + + K TQ A  LL
Sbjct: 1   MAILDITELKAALPPRRALIGLDLGEKTIGVAVSDISLSIGSPLELIKKSKFTQEAERLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRK----------VYVPFVFWD 110
             +     +  +IGLP+NM+G+EGPR  S RAF  N++               +P  FWD
Sbjct: 61  LLMKQREASGLVIGLPVNMDGTEGPRCQSVRAFARNLLRLPAEKFAAAGLEPDLPIAFWD 120

Query: 111 ERLTTVSAQQILI-DMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
           ER ++    + LI + +++R KR + +D  AAA ILQ  LDRI 
Sbjct: 121 ERWSSSVMNRFLIEEADLTRAKRAEVIDRSAAAYILQGALDRIR 164


>gi|160940886|ref|ZP_02088226.1| hypothetical protein CLOBOL_05778 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436130|gb|EDP13897.1| hypothetical protein CLOBOL_05778 [Clostridium bolteae ATCC
           BAA-613]
          Length = 171

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 51/142 (35%), Positives = 78/142 (54%), Gaps = 4/142 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVR---KKVTQTALELLSFITTENIAAFI 72
           N  I  +D G+K +G+A+ DP    A     + R    K+ QT   +   I    I   +
Sbjct: 30  NMRIMGLDFGSKTVGVAVCDPLGITAQTVETITRASENKMRQTLARIEQLIGEYEIERIV 89

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +G P NMN + G R   T+ F    ++R+  +  + WDERLTTV+A+++LI+  V R+ R
Sbjct: 90  LGYPKNMNNTVGERGEKTQEF-KAALERRTGLEVILWDERLTTVAAERVLIESGVRRENR 148

Query: 133 IQKVDSIAAALILQEVLDRISF 154
            + VD IAAA+ILQ  LD + +
Sbjct: 149 KKSVDQIAAAMILQGYLDSLQY 170


>gi|302389909|ref|YP_003825730.1| Holliday junction resolvase YqgF [Thermosediminibacter oceani DSM
           16646]
 gi|302200537|gb|ADL08107.1| Holliday junction resolvase YqgF [Thermosediminibacter oceani DSM
           16646]
          Length = 145

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 49/140 (35%), Positives = 79/140 (56%), Gaps = 1/140 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G KRIG+A+SD     A     + R  V +    +   +    +   IIGLP
Sbjct: 1   MRILGLDVGNKRIGVAVSDELGITAQGVGVIERGDVKRDIERISEIVKRYQVKKVIIGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNMNG+ GP+    + F    +   + +   +WDERL+TV+A+++LID ++SR+KR   +
Sbjct: 61  LNMNGTLGPQGQLVKDFGE-KLRHSLNLDVEYWDERLSTVTAEKVLIDADISRRKRKGVI 119

Query: 137 DSIAAALILQEVLDRISFLE 156
           D ++A +ILQ  LD  S ++
Sbjct: 120 DKLSAIVILQSFLDSRSNID 139


>gi|299535708|ref|ZP_07049029.1| putative Holliday junction resolvase [Lysinibacillus fusiformis
           ZC1]
 gi|298728908|gb|EFI69462.1| putative Holliday junction resolvase [Lysinibacillus fusiformis
           ZC1]
          Length = 138

 Score =  143 bits (361), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 45/139 (32%), Positives = 75/139 (53%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK--KVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+A+SD     A     +             +   +    I  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAVSDALGWTAQGIETVKIDEANGEFGIDRIAELVKEYTITEFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P NMN + GPR  ++  +   +++    +P   WDERLTT++A+++LI+ +VSRKKR Q
Sbjct: 61  FPKNMNNTVGPRGEASENY-KKLLEEHFSLPVKLWDERLTTMAAERMLIEADVSRKKRKQ 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LD  +
Sbjct: 120 VIDKMAAVMILQGYLDSKN 138


>gi|304320050|ref|YP_003853693.1| putative endonuclease [Parvularcula bermudensis HTCC2503]
 gi|303298953|gb|ADM08552.1| putative endonuclease [Parvularcula bermudensis HTCC2503]
          Length = 158

 Score =  143 bits (361), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 55/139 (39%), Positives = 84/139 (60%), Gaps = 1/139 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P  P+  +D G+K IG+A+S P RR A P   + R K  + A  L +      +   IIG
Sbjct: 13  PKGPLLGLDPGSKTIGVAVSTPERRLATPVTVIRRTKFGKDAEALFALAEARGVVGLIIG 72

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           +PLNM+GSEGPR  S R F    + ++  +P  +WDERL++V+A++ L+  + SR +R +
Sbjct: 73  VPLNMDGSEGPRAQSARTFGR-NLSQRGPLPVAYWDERLSSVAAERALLATDTSRARRAE 131

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D+ AA  ILQ  LDR++
Sbjct: 132 VIDAHAATHILQGALDRLA 150


>gi|312870461|ref|ZP_07730581.1| RNAse H domain protein, YqgF family [Lactobacillus oris PB013-T2-3]
 gi|311094018|gb|EFQ52342.1| RNAse H domain protein, YqgF family [Lactobacillus oris PB013-T2-3]
          Length = 147

 Score =  143 bits (361), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 47/138 (34%), Positives = 80/138 (57%), Gaps = 3/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+A+SDP    A     +   +  +      +   +  E +A F++G
Sbjct: 1   MRLLGLDVGSKTVGIAVSDPLGWTAQAVEIIPIDEDEEVFGLDRVAELVDKEQVAGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRI 133
           LP NMN +EGPRV +++ +   + +R   +P  F DERLTTV A ++L+ + ++SR K+ 
Sbjct: 61  LPKNMNNTEGPRVAASKHYGELLQERFPQIPIDFQDERLTTVEAHRMLVEEADISRAKQK 120

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA  ILQ  LDR
Sbjct: 121 KVIDEVAATFILQSYLDR 138


>gi|78044200|ref|YP_359400.1| hypothetical protein CHY_0542 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|146325559|sp|Q3AEN4|RUVX_CARHZ RecName: Full=Putative Holliday junction resolvase
 gi|77996315|gb|ABB15214.1| conserved hypothetical protein TIGR00250 [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 138

 Score =  143 bits (361), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 74/137 (54%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             +  +D+G K+IG+A+SD     A     + R  + +   E+   I   ++   +IG P
Sbjct: 1   MKVLGLDVGDKKIGVALSDELGLTAQGLTVIYRTSLKKDLEEIKKIIDLHHVTEVVIGYP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR    + F   +       P  FWDERL+TV A+++LI  ++SR+KR + +
Sbjct: 61  RNMNGTAGPRAELVKRFARELYKFTGIKPV-FWDERLSTVEAEKLLISGDISRRKRKKVI 119

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA LIL   L+  S
Sbjct: 120 DKLAATLILSGYLNYKS 136


>gi|164688537|ref|ZP_02212565.1| hypothetical protein CLOBAR_02182 [Clostridium bartlettii DSM
           16795]
 gi|164602950|gb|EDQ96415.1| hypothetical protein CLOBAR_02182 [Clostridium bartlettii DSM
           16795]
          Length = 141

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 75/137 (54%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G K IG+A+SD     A     + R+   +   EL + I    +   + GLP
Sbjct: 4   GRIMGLDIGDKTIGVAVSDIMGITAQGVKTIRRESKKKDIEELKNIIKERQVNKIVSGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP+          +I  +  +   FWDERLTTV+A++ LI+ +VSRKKR + +
Sbjct: 64  KNMNGTLGPQGEKVLKLCE-LIKEETGLEIDFWDERLTTVAAERSLIEGDVSRKKRKKVI 122

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA +ILQ  LD  S
Sbjct: 123 DMLAAVIILQGYLDSKS 139


>gi|114566022|ref|YP_753176.1| Holliday junction resolvase YqgF [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|122318867|sp|Q0AZP9|RUVX_SYNWW RecName: Full=Putative Holliday junction resolvase
 gi|114336957|gb|ABI67805.1| Holliday junction resolvase YqgF [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 141

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 52/134 (38%), Positives = 77/134 (57%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +DLG KRIG+A SDP    A     L RK + +    L        +   ++GLP
Sbjct: 1   MRIMGLDLGEKRIGIAFSDPMGWTAQGHSILQRKGLKKDLSYLQELCQEFQVEKIVLGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNMNG+ GP+   T+ F    +   + +P  FWDERL++ SA+++L++ ++SRK+R + +
Sbjct: 61  LNMNGTMGPKALETQEFAR-ALQEALKIPVDFWDERLSSKSAERVLLEADLSRKRRKELI 119

Query: 137 DSIAAALILQEVLD 150
           D IAA  ILQ  LD
Sbjct: 120 DKIAAVHILQAYLD 133


>gi|328474865|gb|EGF45665.1| Holliday junction resolvase-like protein [Listeria monocytogenes
           220]
 gi|332311944|gb|EGJ25039.1| Putative Holliday junction resolvase [Listeria monocytogenes str.
           Scott A]
          Length = 135

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 46/136 (33%), Positives = 79/136 (58%), Gaps = 3/136 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +   +  +      +   +    +   ++GLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGWTAQGVETIQIDENRKQFGYDRVKELVLEYEVEKVVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR + +D
Sbjct: 61  NMNNTIGPRAESSKIYAE-VLESRIGLPVVLWDERLTTSAAERTLIEADVSRKKRKEVID 119

Query: 138 SIAAALILQEVLDRIS 153
            +AA +ILQ  LD  +
Sbjct: 120 KLAAVMILQSYLDTTN 135


>gi|167037467|ref|YP_001665045.1| Holliday junction resolvase-like protein [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320115881|ref|YP_004186040.1| Holliday junction resolvase YqgF [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|226695311|sp|B0K996|RUVX_THEP3 RecName: Full=Putative Holliday junction resolvase
 gi|166856301|gb|ABY94709.1| Holliday junction resolvase YqgF [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319928972|gb|ADV79657.1| Holliday junction resolvase YqgF [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
          Length = 139

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 51/136 (37%), Positives = 73/136 (53%), Gaps = 2/136 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G K IG+AISD     A     + R    +    +   I    +   I+GLP
Sbjct: 1   MRIMGLDVGDKTIGVAISDLSGTIAQGLTTIKRSSNKKDFERIKQIINEYEVGMIIVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQK 135
            NMNG+ GP+      FV + +     +P + WDERLTTV AQ++LI+  ++SR KR + 
Sbjct: 61  KNMNGTLGPQGQKVMRFVEH-LKEAFSIPIILWDERLTTVEAQRVLIEKADISRAKRKEV 119

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LD 
Sbjct: 120 IDKLAAVLILQNYLDS 135


>gi|295092198|emb|CBK78305.1| conserved hypothetical protein TIGR00250 [Clostridium cf.
           saccharolyticum K10]
          Length = 140

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 52/140 (37%), Positives = 77/140 (55%), Gaps = 4/140 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+K  G+A+SDP    A     +VRK   K+ QT   +   I    I A ++
Sbjct: 1   MRIMGLDFGSKTTGVAVSDPLGLTAQGLETIVRKDENKLRQTCARIEELIEEYQIEAIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN + G R   T +F    ++R+   P + WDERLTT++A+++L++  V R+ R 
Sbjct: 61  GYPKNMNNTAGERAEKTESFKEM-LERRTGKPVILWDERLTTIAAERMLMESGVRRENRK 119

Query: 134 QKVDSIAAALILQEVLDRIS 153
             +D +AAALILQ  LD   
Sbjct: 120 AVIDKVAAALILQGYLDSQR 139


>gi|289578245|ref|YP_003476872.1| Holliday junction resolvase YqgF [Thermoanaerobacter italicus Ab9]
 gi|289527958|gb|ADD02310.1| Holliday junction resolvase YqgF [Thermoanaerobacter italicus Ab9]
          Length = 139

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 50/136 (36%), Positives = 74/136 (54%), Gaps = 2/136 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G K IG+AISD     A     + R    +    +   I    +   I+GLP
Sbjct: 1   MRIMGLDVGDKTIGIAISDLSGTIAQGLTTIKRSSNKKDFERIKQIINEYEVGMIIVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQK 135
            NMNG+ GP+      FV + + +   +P + WDERLTTV A+++LI+  ++SR KR + 
Sbjct: 61  KNMNGTLGPQGQKVVRFVEH-LKKAFSIPIILWDERLTTVEAERVLIEKADISRAKRKEV 119

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LD 
Sbjct: 120 IDKLAAVLILQNYLDS 135


>gi|153854408|ref|ZP_01995686.1| hypothetical protein DORLON_01681 [Dorea longicatena DSM 13814]
 gi|149752934|gb|EDM62865.1| hypothetical protein DORLON_01681 [Dorea longicatena DSM 13814]
          Length = 146

 Score =  143 bits (360), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 49/141 (34%), Positives = 75/141 (53%), Gaps = 4/141 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+K +G+A+SDP    A     + RK   K+ +T   + + I    +   ++
Sbjct: 3   MRIMGLDYGSKTVGVAVSDPLGITAQGVETICRKDENKLRKTCARIEALIEEYQVTKIVL 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP +MN   G R   + AF    + R+  +  V WDERLTTV A++ LI+  V R+ R 
Sbjct: 63  GLPKHMNNDIGDRAEKSMAFGEM-LKRRTGLEVVMWDERLTTVEAERTLIENKVRREDRK 121

Query: 134 QKVDSIAAALILQEVLDRISF 154
           + +D IAA  ILQ  LD ++ 
Sbjct: 122 KYIDKIAAVFILQGYLDSLAH 142


>gi|331085955|ref|ZP_08335038.1| Holliday junction resolvase [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330406878|gb|EGG86383.1| Holliday junction resolvase [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 151

 Score =  143 bits (360), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 52/145 (35%), Positives = 78/145 (53%), Gaps = 4/145 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+K +G+AISDP    A     + RK   K+ +T   + + +    +   ++
Sbjct: 1   MRIMGLDYGSKTVGVAISDPLGLTAQGIETICRKEENKLRKTLARIEALVQEYQVEEIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN + G R   +  F    ++R+  +P   WDERLTTV A++ LI+ NV R+ R 
Sbjct: 61  GFPKNMNNTVGDRAEKSLEFKEM-LERRTALPVTMWDERLTTVEAERTLIENNVRREDRK 119

Query: 134 QKVDSIAAALILQEVLDRISFLESS 158
           + VD IAA  ILQ  LD + F + S
Sbjct: 120 KYVDKIAAVFILQGYLDSVYFRQKS 144


>gi|28210758|ref|NP_781702.1| Holliday junction resolvase-like protein [Clostridium tetani E88]
 gi|32130019|sp|Q896F1|RUVX_CLOTE RecName: Full=Putative Holliday junction resolvase
 gi|28203196|gb|AAO35639.1| DNA integration/recombination protein [Clostridium tetani E88]
          Length = 138

 Score =  143 bits (360), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 71/136 (52%), Gaps = 1/136 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G + IG+AISDP    A     + R  +     E+        +   + GLP
Sbjct: 1   MRILGLDVGDRTIGVAISDPLGWTAQGVKTIKRSNLKNDIKEIEDICNEYKVDKIVSGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP+      F    + +++    + WDERLTTV+A + +I+ ++SR KR + V
Sbjct: 61  KNMNGTLGPQSEKVTEFCDI-LKKELEKEIIMWDERLTTVAAHKAMIEGDLSRAKRKKIV 119

Query: 137 DSIAAALILQEVLDRI 152
           D IAA  ILQ  LD +
Sbjct: 120 DKIAAIYILQGYLDSV 135


>gi|291563945|emb|CBL42761.1| conserved hypothetical protein TIGR00250 [butyrate-producing
           bacterium SS3/4]
          Length = 144

 Score =  143 bits (360), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 52/137 (37%), Positives = 79/137 (57%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+K +G+A+SD     A     + RK   K+ +T   +   I    +   ++
Sbjct: 1   MRILGLDFGSKTVGVAVSDGLLLTAQGVETIERKDENKLRKTCARIEELIAEYEVTEIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NM+ +EG RV  T+AF    ++R+  +P  +WDERLTTV+A+QIL++  V R+ R 
Sbjct: 61  GLPKNMDNTEGERVEKTKAFGEM-LERRTGLPVHYWDERLTTVAAEQILMESGVRRENRK 119

Query: 134 QKVDSIAAALILQEVLD 150
             +D +AA LILQ  LD
Sbjct: 120 AVIDKVAAGLILQGYLD 136


>gi|217964351|ref|YP_002350029.1| hypothetical protein LMHCC_1067 [Listeria monocytogenes HCC23]
 gi|284801892|ref|YP_003413757.1| hypothetical protein LM5578_1647 [Listeria monocytogenes 08-5578]
 gi|284995034|ref|YP_003416802.1| hypothetical protein LM5923_1599 [Listeria monocytogenes 08-5923]
 gi|217333621|gb|ACK39415.1| conserved hypothetical protein [Listeria monocytogenes HCC23]
 gi|284057454|gb|ADB68395.1| hypothetical protein LM5578_1647 [Listeria monocytogenes 08-5578]
 gi|284060501|gb|ADB71440.1| hypothetical protein LM5923_1599 [Listeria monocytogenes 08-5923]
 gi|307571083|emb|CAR84262.1| holliday junction resolvase, putative [Listeria monocytogenes L99]
          Length = 135

 Score =  143 bits (360), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 46/136 (33%), Positives = 79/136 (58%), Gaps = 3/136 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +   +  +      +   +    +   ++GLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGWTAQGVETIQIDENRKQFGYDRVKELVLEYEVEKVVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR + +D
Sbjct: 61  NMNNTIGPRAESSKIYAE-VLEARIGLPVVLWDERLTTSAAERTLIEADVSRKKRKEVID 119

Query: 138 SIAAALILQEVLDRIS 153
            +AA +ILQ  LD  +
Sbjct: 120 KLAAVMILQSYLDTTN 135


>gi|13470868|ref|NP_102437.1| hypothetical protein mlr0681 [Mesorhizobium loti MAFF303099]
 gi|32130057|sp|Q98M90|RUVX_RHILO RecName: Full=Putative Holliday junction resolvase
 gi|14021611|dbj|BAB48223.1| mlr0681 [Mesorhizobium loti MAFF303099]
          Length = 166

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 78/147 (53%), Positives = 105/147 (71%), Gaps = 1/147 (0%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           L   + +A +DLG K IG+A+SD G  FAHPRP ++R+K +  A  LL+ +  EN+ A  
Sbjct: 5   LADGRTLAGLDLGDKTIGVAVSDRGFAFAHPRPVIMRRKFSLDAAVLLALLKKENVGAVA 64

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           IGLP+NM+GSEGPR   +RAFV NM  +   +PFVFWDERL+TV+A++ LI+M+ SR KR
Sbjct: 65  IGLPINMDGSEGPRAQKSRAFVRNM-AQLSDLPFVFWDERLSTVAAERTLIEMDFSRAKR 123

Query: 133 IQKVDSIAAALILQEVLDRISFLESSK 159
             K+DS AAA ILQ VLDR+  L+S+ 
Sbjct: 124 AGKIDSAAAAFILQGVLDRLQSLDSAA 150


>gi|147677400|ref|YP_001211615.1| endonuclease [Pelotomaculum thermopropionicum SI]
 gi|189046102|sp|A5D3C3|RUVX_PELTS RecName: Full=Putative Holliday junction resolvase
 gi|146273497|dbj|BAF59246.1| predicted endonuclease [Pelotomaculum thermopropionicum SI]
          Length = 154

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 51/145 (35%), Positives = 76/145 (52%), Gaps = 2/145 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV-TQTALELLSFITTENIAAFIIGL 75
             I  +DLG K+IG+A+SDP    A     +  K     +   +   +    +   ++GL
Sbjct: 1   MRIMGLDLGDKKIGVALSDPMGWTAQGLDVIAVKGPPEASVERISELVRQYGVGKIVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMNGS GPR    RAF    +   + +P   WDER+TT+ A+++LI+ ++SR +R Q 
Sbjct: 61  PRNMNGSFGPRAERARAFAGC-LAGALNLPVELWDERMTTLEAEKLLIEADLSRARRRQV 119

Query: 136 VDSIAAALILQEVLDRISFLESSKG 160
           +D +AA LILQ  LD         G
Sbjct: 120 IDKMAAVLILQSFLDSQGRPRREAG 144


>gi|134298642|ref|YP_001112138.1| Holliday junction resolvase YqgF [Desulfotomaculum reducens MI-1]
 gi|172044263|sp|A4J2L0|RUVX_DESRM RecName: Full=Putative Holliday junction resolvase
 gi|134051342|gb|ABO49313.1| Holliday junction resolvase YqgF [Desulfotomaculum reducens MI-1]
          Length = 137

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 48/135 (35%), Positives = 78/135 (57%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G K IG+A+SDP    A     + R  + +    L   I+  ++   ++G+P
Sbjct: 1   MRIMGLDVGDKTIGVALSDPLGWTAQGLEVIRRDTIEKDMNRLAQIISEYSVERILVGMP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ G +     AF+  + ++   +P   WDERL+TV+A+++LI  +VSR KR + +
Sbjct: 61  KNMNGTVGSQGEKVLAFIEKVKEKI-DLPIKTWDERLSTVAAEKMLIQADVSRGKRKKVI 119

Query: 137 DSIAAALILQEVLDR 151
           D +AAA+ILQ  LD 
Sbjct: 120 DKMAAAVILQGYLDS 134


>gi|295109588|emb|CBL23541.1| conserved hypothetical protein TIGR00250 [Ruminococcus obeum
           A2-162]
          Length = 140

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 49/140 (35%), Positives = 71/140 (50%), Gaps = 4/140 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+K +G+A+SDP    A     + RK   K+ QT   +   I    +   ++
Sbjct: 1   MRILGLDYGSKTVGVAVSDPLGLTAQKVETIWRKQENKLRQTLARIEELIAEYEVEKIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN + G R      F    + ++  +  + WDERLTTV A + LI+  V R+ R 
Sbjct: 61  GFPKNMNNTVGERAEKALEFGEM-LKKRTGLEVIMWDERLTTVEADRTLIEAGVRRENRK 119

Query: 134 QKVDSIAAALILQEVLDRIS 153
           Q +D IAA  ILQ  LD +S
Sbjct: 120 QYLDGIAAVFILQGYLDSLS 139


>gi|126653902|ref|ZP_01725749.1| Holliday junction resolvase-like protein [Bacillus sp. B14905]
 gi|126589627|gb|EAZ83766.1| Holliday junction resolvase-like protein [Bacillus sp. B14905]
          Length = 138

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 45/139 (32%), Positives = 75/139 (53%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK--KVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+A+SD     A     +             +   +    I  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAVSDALGWTAQGIETVKIDEANGEFGIDRIAELVKEYAITEFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P NMN + GPR  ++  +   +++    +P   WDERLTT++A+++LI+ +VSRKKR Q
Sbjct: 61  FPKNMNNTVGPRGEASENY-KTLLEETFSLPVKLWDERLTTMAAERMLIEADVSRKKRKQ 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LD  +
Sbjct: 120 VIDKMAAVMILQGYLDSKN 138


>gi|71083767|ref|YP_266487.1| putative Holliday junction resolvase [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|91763197|ref|ZP_01265161.1| Putative Holliday junction resolvase [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|146325587|sp|Q4FLQ5|RUVX_PELUB RecName: Full=Putative Holliday junction resolvase
 gi|71062880|gb|AAZ21883.1| Putative Holliday junction resolvase [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|91717610|gb|EAS84261.1| Putative Holliday junction resolvase [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 151

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 49/152 (32%), Positives = 77/152 (50%), Gaps = 1/152 (0%)

Query: 3   ILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSF 62
           ++ IED             +DLG+KRIG++I D  +  A P   + +    +   EL   
Sbjct: 1   MITIEDFKIKHTNKVRFIGLDLGSKRIGVSICDERQSIATPFKTINKTNTNELIDELKII 60

Query: 63  ITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL 122
           I   NI   I+G P+NM+GS G    S        I + + +P + WDERL+TV A  + 
Sbjct: 61  IKDNNIGGIIVGNPVNMDGSLGRSAQSVNDVAS-NISKSIDLPVILWDERLSTVGAFNLS 119

Query: 123 IDMNVSRKKRIQKVDSIAAALILQEVLDRISF 154
             ++V+  KR++ +D  AAA ILQ  +D ++ 
Sbjct: 120 SLLDVNVSKRVKTIDQNAAAFILQGAIDFLNN 151


>gi|253580719|ref|ZP_04857983.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848090|gb|EES76056.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 140

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 46/140 (32%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             +  +D G+K +G+AISDP    A     + RK    + QT   +   ++  ++   ++
Sbjct: 1   MRVLGLDYGSKTVGVAISDPLGITAQGVETIWRKQENHLRQTLARIEELVSEYHVEKIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN + G R   +  F    ++R+  +  + WDERLTTV A + L++ +V R+ R 
Sbjct: 61  GYPKNMNNTIGERAQKSLEFKEM-LERRTGLEVIMWDERLTTVEANRTLMEASVRRENRK 119

Query: 134 QKVDSIAAALILQEVLDRIS 153
           Q +D +AA  ILQ  LD +S
Sbjct: 120 QYLDQLAAVFILQGYLDSLS 139


>gi|254460515|ref|ZP_05073931.1| conserved hypothetical protein TIGR00250 [Rhodobacterales bacterium
           HTCC2083]
 gi|206677104|gb|EDZ41591.1| conserved hypothetical protein TIGR00250 [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 160

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 63/159 (39%), Positives = 93/159 (58%), Gaps = 1/159 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    I+D   +L   + +  +DLGTK IG+++SD     A P   + R K T  A  L 
Sbjct: 1   MIFETIDDFAAALPRARALVGLDLGTKTIGVSVSDGLLSVASPLETIKRTKYTADAARLE 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             I    I   ++GLP NM+GSEGPR  STRAF    + R+  +P  +WDERL+TV+A++
Sbjct: 61  QIIEARYIGGIVLGLPFNMDGSEGPRCQSTRAFAR-NLARQSELPITYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSK 159
            L+  + SR++R + +D++AAA ILQ  LDR+S +    
Sbjct: 120 ALLAADASRRRRAEVIDNVAAAYILQGALDRLSHIRREA 158


>gi|227529702|ref|ZP_03959751.1| crossover junction endodeoxyribonuclease [Lactobacillus vaginalis
           ATCC 49540]
 gi|227350368|gb|EEJ40659.1| crossover junction endodeoxyribonuclease [Lactobacillus vaginalis
           ATCC 49540]
          Length = 147

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 46/138 (33%), Positives = 77/138 (55%), Gaps = 3/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+A+SDP    A     +   +  +      +   +    +A F++G
Sbjct: 1   MRLLGLDVGSKTVGIAVSDPLGWTAQAVEIIPINEDEEIFGIDRVAEIVKQRQVAGFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRI 133
           LP NMN +EGPRV ++  +   +  R   +P  F DERLTTV A ++L+ + ++SR K+ 
Sbjct: 61  LPKNMNNTEGPRVEASHHYGELLKKRFPSIPVDFQDERLTTVEAHRMLVEEADISRAKQK 120

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA  ILQ  LDR
Sbjct: 121 KVIDEVAATFILQSYLDR 138


>gi|89895164|ref|YP_518651.1| hypothetical protein DSY2418 [Desulfitobacterium hafniense Y51]
 gi|219669581|ref|YP_002460016.1| Holliday junction resolvase-like protein [Desulfitobacterium
           hafniense DCB-2]
 gi|146325570|sp|Q24UT5|RUVX_DESHY RecName: Full=Putative Holliday junction resolvase
 gi|254767513|sp|B8FQB9|RUVX_DESHD RecName: Full=Putative Holliday junction resolvase
 gi|89334612|dbj|BAE84207.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219539841|gb|ACL21580.1| Holliday junction resolvase YqgF [Desulfitobacterium hafniense
           DCB-2]
          Length = 142

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 72/137 (52%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D G + IG+A+SD     A     + R    +   EL + +    +   ++G P
Sbjct: 1   MRIMGLDFGERTIGVAVSDAMLLTAQGVKTIRRS--PKELEELKTMLQDYEVDHIVLGYP 58

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  +T  F    +  +  +P   WDERL+T+ AQ+ L++ +VSR KR Q +
Sbjct: 59  KNMNGTLGPRAQATEEFAQI-LKEEFGLPVTLWDERLSTMGAQRSLLEADVSRAKRKQVI 117

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA  ILQ  LD I 
Sbjct: 118 DKMAAVFILQGYLDYIR 134


>gi|295695754|ref|YP_003588992.1| Holliday junction resolvase YqgF [Bacillus tusciae DSM 2912]
 gi|295411356|gb|ADG05848.1| Holliday junction resolvase YqgF [Bacillus tusciae DSM 2912]
          Length = 157

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 47/135 (34%), Positives = 67/135 (49%), Gaps = 1/135 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I  +D+G  RIG+A+SDP    A     L           +   I    +   ++GL
Sbjct: 1   MSRILGLDVGRVRIGVAVSDPLGLVAQGLEVLAVDDEESALARIEGLIAEWGVERVVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NM+ S G +   T  F    +  +V VP   WDERLTTV A++ LID  + R +R + 
Sbjct: 61  PRNMDASLGAQGRYTEEFAE-KLRHRVRVPVDLWDERLTTVVAEKTLIDAGLRRARRKKV 119

Query: 136 VDSIAAALILQEVLD 150
           VD +AA ++LQ  LD
Sbjct: 120 VDQVAATVLLQSYLD 134


>gi|289434782|ref|YP_003464654.1| holliday junction resolvase, putative [Listeria seeligeri serovar
           1/2b str. SLCC3954]
 gi|289171026|emb|CBH27568.1| holliday junction resolvase, putative [Listeria seeligeri serovar
           1/2b str. SLCC3954]
          Length = 135

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 46/136 (33%), Positives = 79/136 (58%), Gaps = 3/136 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +   +  +      +   +    +   ++GLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGWTAQGVETIQIDEKRKQFGYDRVKELVLEYEVEKVVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR + +D
Sbjct: 61  NMNNTIGPRAESSKIYAE-VLEARIGLPVVLWDERLTTTAAERTLIEADVSRKKRKEVID 119

Query: 138 SIAAALILQEVLDRIS 153
            +AA +ILQ  LD  +
Sbjct: 120 KLAAVMILQSYLDTTN 135


>gi|167040129|ref|YP_001663114.1| Holliday junction resolvase-like protein [Thermoanaerobacter sp.
           X514]
 gi|256752542|ref|ZP_05493398.1| Holliday junction resolvase YqgF [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300914213|ref|ZP_07131529.1| Holliday junction resolvase YqgF [Thermoanaerobacter sp. X561]
 gi|307724552|ref|YP_003904303.1| Holliday junction resolvase YqgF [Thermoanaerobacter sp. X513]
 gi|226695312|sp|B0K0Q3|RUVX_THEPX RecName: Full=Putative Holliday junction resolvase
 gi|166854369|gb|ABY92778.1| Holliday junction resolvase YqgF [Thermoanaerobacter sp. X514]
 gi|256748608|gb|EEU61656.1| Holliday junction resolvase YqgF [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300889148|gb|EFK84294.1| Holliday junction resolvase YqgF [Thermoanaerobacter sp. X561]
 gi|307581613|gb|ADN55012.1| Holliday junction resolvase YqgF [Thermoanaerobacter sp. X513]
          Length = 139

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 49/136 (36%), Positives = 74/136 (54%), Gaps = 2/136 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G K IG+AISD     A     + R    +    +   I    +   I+GLP
Sbjct: 1   MRIMGLDVGDKTIGIAISDLSGTIAQGLTTIKRSSNKKDFERIKQIINEYEVGMIIVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQK 135
            N+NG+ GP+      FV + +   + +P + WDERLTTV A+++LI+  ++SR KR + 
Sbjct: 61  KNLNGTLGPQGQKVVRFVEH-LKEAINIPIILWDERLTTVEAERVLIEKADISRAKRKEV 119

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LD 
Sbjct: 120 IDKLAAVLILQNYLDS 135


>gi|56551681|ref|YP_162520.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241761198|ref|ZP_04759286.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|260752737|ref|YP_003225630.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56543255|gb|AAV89409.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241374105|gb|EER63602.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|258552100|gb|ACV75046.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 179

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 55/157 (35%), Positives = 87/157 (55%), Gaps = 6/157 (3%)

Query: 2   SILLIED----LVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL 57
           +IL  ++      ++L     +A +D+GTK IGLA+ D     A P   + RKK T    
Sbjct: 24  NILKKQEELRLFQEALPRKGRLAGLDVGTKTIGLALCDSQWIIASPAETIRRKKFTLDLE 83

Query: 58  ELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVS 117
            L  F+  + +   +IGLPLN++GS+ PR  S RAF  N+    + +P + WDER +T +
Sbjct: 84  LLRQFVEKQQVKGLVIGLPLNLDGSDSPRTQSVRAFAKNV--APLSLPVLMWDERWSTKA 141

Query: 118 AQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISF 154
             + L++ + SR +R + VD +AAA ILQ  +D  + 
Sbjct: 142 VTRTLLEADASRARRSEVVDKMAAAYILQGAIDSFAM 178


>gi|319940102|ref|ZP_08014456.1| crossover junction endodeoxyribonuclease [Streptococcus anginosus
           1_2_62CV]
 gi|319810816|gb|EFW07143.1| crossover junction endodeoxyribonuclease [Streptococcus anginosus
           1_2_62CV]
          Length = 139

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 83/138 (60%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+A+SDP    A     +    +K       L   +    +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAVSDPLGFTAQGLEIIPIDEEKGEFGFDRLSELVKEYKVNKFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I++  ++P  + DERLTTV+A+++LI+  +VSRKKR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGA-KIEQLFHLPVEYQDERLTTVAAERMLIEQADVSRKKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|116872931|ref|YP_849712.1| holliday junction resolvase, putative [Listeria welshimeri serovar
           6b str. SLCC5334]
 gi|116741809|emb|CAK20933.1| holliday junction resolvase, putative [Listeria welshimeri serovar
           6b str. SLCC5334]
          Length = 135

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 46/136 (33%), Positives = 79/136 (58%), Gaps = 3/136 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +   +  +      +   +    +   ++GLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGWTAQGVETIQIDEKRKQFGYDRVKELVLEYEVEKVVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMN + GPR  S++ +   +++ ++ +P V WDERLTT +A++ LI+ +VSRKKR + +D
Sbjct: 61  NMNNTIGPRAESSKIYAE-VLEARIGLPVVLWDERLTTSAAERTLIEADVSRKKRKEVID 119

Query: 138 SIAAALILQEVLDRIS 153
            +AA +ILQ  LD  +
Sbjct: 120 KLAAVMILQSYLDTTN 135


>gi|307265209|ref|ZP_07546768.1| Holliday junction resolvase YqgF [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306919831|gb|EFN50046.1| Holliday junction resolvase YqgF [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 139

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 50/136 (36%), Positives = 73/136 (53%), Gaps = 2/136 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G K IG+AISD     A     + R    +    +   I    +   I+GLP
Sbjct: 1   MRIMGLDVGDKTIGVAISDLSGTIAQGLTTIKRSSNKKDFERIKQIINEYEVGMIIVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQK 135
            NM+G+ GP+      FV + +     +P + WDERLTTV AQ++LI+  ++SR KR + 
Sbjct: 61  KNMSGTLGPQGQKVVRFVEH-LKEAFSIPIILWDERLTTVEAQRVLIEKADISRAKRKEV 119

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LD 
Sbjct: 120 IDKLAAVLILQNYLDS 135


>gi|210622572|ref|ZP_03293254.1| hypothetical protein CLOHIR_01202 [Clostridium hiranonis DSM 13275]
 gi|210154155|gb|EEA85161.1| hypothetical protein CLOHIR_01202 [Clostridium hiranonis DSM 13275]
          Length = 140

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 51/134 (38%), Positives = 72/134 (53%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G K IG+A+SD     A     + R        E+   I  + +   + GLP
Sbjct: 4   GRIMGLDIGDKTIGVAVSDLMGMTAQGIKTIKRTSKKNDIEEIKQIIKEKQVNLIVSGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP+    + F   +I  +  +   FWDERLTTV+A++ LI  +VSRKKR   +
Sbjct: 64  KNMNGTVGPQGEKVQKFCE-LIKEETGLEIEFWDERLTTVAAEKTLITADVSRKKRKNVI 122

Query: 137 DSIAAALILQEVLD 150
           D +AA LILQ  LD
Sbjct: 123 DMMAAVLILQGYLD 136


>gi|51893132|ref|YP_075823.1| hypothetical protein STH1994 [Symbiobacterium thermophilum IAM
           14863]
 gi|62900963|sp|Q67MW4|RUVX_SYMTH RecName: Full=Putative Holliday junction resolvase
 gi|51856821|dbj|BAD40979.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 144

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 48/134 (35%), Positives = 78/134 (58%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G K IG+A+SD     A     + R+ + Q    L        +  +++G+P
Sbjct: 1   MRIGGLDVGEKTIGVALSDELGLTAQALEVIRRRSLEQDLARLDEIARHYGVVRWVVGMP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR   TRAF+   +     +P   WDERL+T++A+++L++ +VSR +R + +
Sbjct: 61  RNMNGTYGPRAELTRAFME-RLAGHSGLPVEAWDERLSTMAAERVLLEADVSRARRRKVI 119

Query: 137 DSIAAALILQEVLD 150
           D +AAA+ILQ  LD
Sbjct: 120 DKMAAAVILQGYLD 133


>gi|309791342|ref|ZP_07685865.1| Holliday junction resolvase YqgF [Oscillochloris trichoides DG6]
 gi|308226652|gb|EFO80357.1| Holliday junction resolvase YqgF [Oscillochloris trichoides DG6]
          Length = 148

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 47/138 (34%), Positives = 79/138 (57%), Gaps = 1/138 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           Q +  +D+G +RIG+A+SD     A P   +     +Q    +   +    +   ++GLP
Sbjct: 4   QRLLGLDVGDRRIGVALSDALGMLASPLTTINANPRSQAITMIARLVREHEVQGIVVGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           L + G  GP+   TR+F    ++R+V +P + +DER TT  A+Q+L +M V  +KR Q++
Sbjct: 64  LTLRGEIGPQAEQTRSFAQ-ELERQVGLPVMLFDERYTTTVAEQLLREMGVKPEKRKQQI 122

Query: 137 DSIAAALILQEVLDRISF 154
           D +AA++ILQ+ LD I  
Sbjct: 123 DQVAASIILQDYLDHIRN 140


>gi|182418929|ref|ZP_02950186.1| conserved hypothetical protein [Clostridium butyricum 5521]
 gi|237669098|ref|ZP_04529082.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT
           E BL5262]
 gi|182377212|gb|EDT74780.1| conserved hypothetical protein [Clostridium butyricum 5521]
 gi|237657446|gb|EEP55002.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT
           E BL5262]
          Length = 140

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 51/138 (36%), Positives = 75/138 (54%), Gaps = 1/138 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            + I  +DLG K IG+AISDP    A     + R    +   +L        +   +IGL
Sbjct: 1   MKRILGLDLGQKTIGVAISDPLGFTAQGLTTIRRGSKEKDIEDLKKICDEYKVETIVIGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMNG+ GP      AF   +++ +  +   FWDERLTTV+A + +++ ++SR KR + 
Sbjct: 61  PKNMNGTIGPSGEIAMAFGK-LLEEEFQIEIKFWDERLTTVAAHKAMLEADLSRNKRKKI 119

Query: 136 VDSIAAALILQEVLDRIS 153
           VD +A+  ILQ  LD IS
Sbjct: 120 VDKVASTYILQGYLDMIS 137


>gi|157693142|ref|YP_001487604.1| Holliday junction resolvase-like protein [Bacillus pumilus
           SAFR-032]
 gi|194017226|ref|ZP_03055838.1| conserved hypothetical protein [Bacillus pumilus ATCC 7061]
 gi|167012693|sp|A8FFM7|RUVX_BACP2 RecName: Full=Putative Holliday junction resolvase
 gi|157681900|gb|ABV63044.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Bacillus pumilus SAFR-032]
 gi|194011094|gb|EDW20664.1| conserved hypothetical protein [Bacillus pumilus ATCC 7061]
          Length = 138

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 48/139 (34%), Positives = 79/139 (56%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             I  +DLGTK +G+AISD     A     +   +         L   ++       ++G
Sbjct: 1   MRILGLDLGTKTLGVAISDEMGWTAQGIETIKIDEAGGDFGLSRLSEIVSQYGTDKIVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P NMNG+ GPR  ++++F   +++    VP V WDERL+T++A+++LI  +VSR+KR +
Sbjct: 61  FPKNMNGTVGPRGEASQSFAK-VLENTYNVPVVLWDERLSTMAAEKMLISADVSRQKRKK 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LD ++
Sbjct: 120 VIDKMAAVMILQGYLDSLN 138


>gi|255655297|ref|ZP_05400706.1| putative holliday junction resolvase [Clostridium difficile
           QCD-23m63]
 gi|296451281|ref|ZP_06893021.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Clostridium difficile NAP08]
 gi|296880367|ref|ZP_06904330.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Clostridium difficile NAP07]
 gi|296259887|gb|EFH06742.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Clostridium difficile NAP08]
 gi|296428608|gb|EFH14492.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Clostridium difficile NAP07]
          Length = 141

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 47/134 (35%), Positives = 74/134 (55%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G K IG+A+SD     A     + R    +   EL + I  + +   + GLP
Sbjct: 4   GRIMGLDVGDKTIGVAVSDLMGLTAQGVKTIKRVGKKKDIEELKAIIKEKQVNKIVSGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP+      F   + +    +   FWDERL+TV+A++ L++ +VSR+KR + +
Sbjct: 64  KNMNGTLGPQGEKVIKFCELVKEET-GIDVEFWDERLSTVAAERSLLEADVSRQKRKKVI 122

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 123 DMLAAVIILQGYLD 136


>gi|85716409|ref|ZP_01047381.1| Holliday junction resolvase YqgF [Nitrobacter sp. Nb-311A]
 gi|85696766|gb|EAQ34652.1| Holliday junction resolvase YqgF [Nitrobacter sp. Nb-311A]
          Length = 166

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 61/159 (38%), Positives = 89/159 (55%), Gaps = 1/159 (0%)

Query: 2   SILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS 61
            +L + +          +  +DLGT+ IG+A+SDP RR A     + RK  T  A  LL+
Sbjct: 4   PVLPLIEAAAHWPERGALVGLDLGTRTIGVAVSDPDRRLATGVETIRRKAFTADAARLLA 63

Query: 62  FITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQI 121
                +   FI+GLP+NM+GSEGPR  STRAF    + R   +    WDERL+T + ++ 
Sbjct: 64  IAGERHAKGFILGLPINMDGSEGPRAQSTRAFAR-NLARLTDLAIGLWDERLSTAAVERE 122

Query: 122 LIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
           LI +++SR +R + +D  AA  ILQ  LDR++    S G
Sbjct: 123 LIGLDMSRARRARVIDEHAAIFILQGALDRLAAQRRSSG 161


>gi|89054672|ref|YP_510123.1| Holliday junction resolvase YqgF [Jannaschia sp. CCS1]
 gi|88864221|gb|ABD55098.1| Holliday junction resolvase YqgF [Jannaschia sp. CCS1]
          Length = 145

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 60/144 (41%), Positives = 85/144 (59%), Gaps = 2/144 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            + +  +DLGTK IG+A+SD     A     + RKK    A  L   I    +   I+GL
Sbjct: 1   MRGLIGLDLGTKTIGVALSDRLLTSASALETVKRKKFGVDADALAGLIAKHEVGGIILGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFV--FWDERLTTVSAQQILIDMNVSRKKRI 133
           P NM+GSEGPR  +TRAF  N+  R  +      FWDERL+TV+A++ LI  + SRK+R 
Sbjct: 61  PRNMDGSEGPRAQATRAFALNLSRRGDFAHLALGFWDERLSTVAAERALIAADTSRKRRS 120

Query: 134 QKVDSIAAALILQEVLDRISFLES 157
           + +D++AA+ ILQ  LDR+  L +
Sbjct: 121 EVIDAVAASYILQGALDRLRHLRA 144


>gi|118597226|sp|Q5NPF1|RUVX_ZYMMO RecName: Full=Putative Holliday junction resolvase
          Length = 163

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 55/157 (35%), Positives = 87/157 (55%), Gaps = 6/157 (3%)

Query: 2   SILLIED----LVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL 57
           +IL  ++      ++L     +A +D+GTK IGLA+ D     A P   + RKK T    
Sbjct: 8   NILKKQEELRLFQEALPRKGRLAGLDVGTKTIGLALCDSQWIIASPAETIRRKKFTLDLE 67

Query: 58  ELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVS 117
            L  F+  + +   +IGLPLN++GS+ PR  S RAF  N+    + +P + WDER +T +
Sbjct: 68  LLRQFVEKQQVKGLVIGLPLNLDGSDSPRTQSVRAFAKNV--APLSLPVLMWDERWSTKA 125

Query: 118 AQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISF 154
             + L++ + SR +R + VD +AAA ILQ  +D  + 
Sbjct: 126 VTRTLLEADASRARRSEVVDKMAAAYILQGAIDSFAM 162


>gi|296333169|ref|ZP_06875622.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305675325|ref|YP_003866997.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296149367|gb|EFG90263.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305413569|gb|ADM38688.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 138

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 50/139 (35%), Positives = 78/139 (56%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             I  +DLGTK +G+A+SD     A     +   +         L   I    I   ++G
Sbjct: 1   MRILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLSRLSELIKEYTIDKIVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P NMNG+ GPR  +++ F   +++    VP V WDERLTT++A+++LI  +VSR+KR +
Sbjct: 61  FPKNMNGTVGPRGEASQTFAK-VLETTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKK 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LD ++
Sbjct: 120 VIDKMAAVMILQGYLDSLN 138


>gi|294792100|ref|ZP_06757248.1| putative Holliday junction resolvase [Veillonella sp. 6_1_27]
 gi|294793971|ref|ZP_06759108.1| putative Holliday junction resolvase [Veillonella sp. 3_1_44]
 gi|294455541|gb|EFG23913.1| putative Holliday junction resolvase [Veillonella sp. 3_1_44]
 gi|294457330|gb|EFG25692.1| putative Holliday junction resolvase [Veillonella sp. 6_1_27]
          Length = 136

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 78/137 (56%), Gaps = 1/137 (0%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            S+D+G++ IG+A SD     A     + R  + +    L   I+   +   ++G+P NM
Sbjct: 1   MSLDVGSRTIGIACSDALLMTAQGIETIRRTSLEKDFNRLQELISEYEVHELVVGMPKNM 60

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           NG++G R   T  FV  M    + +P  +WDERL+TV A++ LI  +VSRKKR   +D +
Sbjct: 61  NGTKGERAEKTEEFVAKM-KEVIDLPVTYWDERLSTVMAERQLIAADVSRKKRKSVIDKM 119

Query: 140 AAALILQEVLDRISFLE 156
           AA +ILQ  LDR+ F +
Sbjct: 120 AAVVILQGYLDRLQFNK 136


>gi|326386640|ref|ZP_08208262.1| Holliday junction resolvase YqgF [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208955|gb|EGD59750.1| Holliday junction resolvase YqgF [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 155

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 60/153 (39%), Positives = 90/153 (58%), Gaps = 2/153 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    I +   +L     +  +D GTK IG+A+ D G RFA P   L R+K  Q   E++
Sbjct: 1   MITTAIGEFRAALSEGGVLMGLDPGTKTIGIALCDAGWRFASPSHTLNRRKFAQDKAEIV 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             I   ++   +IGLPLNM+GSE PR  + RA   N+ D    +P + WDER TT +A++
Sbjct: 61  GIIAQRSVRGIVIGLPLNMDGSESPRSQAARAMARNLADLA--LPTLLWDERWTTQAAER 118

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
            +I  ++SR KR +++D+ AAALILQ  +D ++
Sbjct: 119 AMIAQDMSRAKRAERIDAHAAALILQGAIDALA 151


>gi|323483777|ref|ZP_08089157.1| hypothetical protein HMPREF9474_00906 [Clostridium symbiosum
           WAL-14163]
 gi|323692750|ref|ZP_08106978.1| hypothetical protein HMPREF9475_01841 [Clostridium symbiosum
           WAL-14673]
 gi|323402968|gb|EGA95286.1| hypothetical protein HMPREF9474_00906 [Clostridium symbiosum
           WAL-14163]
 gi|323503192|gb|EGB19026.1| hypothetical protein HMPREF9475_01841 [Clostridium symbiosum
           WAL-14673]
          Length = 163

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 52/156 (33%), Positives = 83/156 (53%), Gaps = 6/156 (3%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQ---TAL 57
           M+I  +  ++  +K    +  +D G+K  G+A+SDP    A     + R+   +   T  
Sbjct: 1   MAICQL--VLLWVKQLMRVLGLDFGSKTTGVAVSDPLGFTAQGLETITREDENKLRRTCA 58

Query: 58  ELLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVS 117
            +   I    I   ++G P NMN + G RV  T AF    ++R+  +  + WDERLTT +
Sbjct: 59  RIEELIREYQIETIVLGYPKNMNNTSGERVEKTLAFKEM-LERRTGLSVILWDERLTTTA 117

Query: 118 AQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
           A+QILI+  V R+ R   +D +AA+LILQ  LD ++
Sbjct: 118 AEQILIESGVRRENRKAVIDKVAASLILQGYLDSLA 153


>gi|315221498|ref|ZP_07863418.1| conserved hypothetical protein TIGR00250 [Streptococcus anginosus
           F0211]
 gi|315189332|gb|EFU23027.1| conserved hypothetical protein TIGR00250 [Streptococcus anginosus
           F0211]
          Length = 139

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 83/138 (60%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+A+SDP    A     +    +K       L   +    +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAVSDPLGFTAQGLEIIPIDEEKGEFGFDRLNGLVQEYKVDKFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I++  ++P  + DERLTTV+A+++LI+  +VSRKKR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYG-TKIEQLFHLPVEYQDERLTTVAAERMLIEQADVSRKKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|241890070|ref|ZP_04777368.1| putative Holliday junction resolvase [Gemella haemolysans ATCC
           10379]
 gi|241863692|gb|EER68076.1| putative Holliday junction resolvase [Gemella haemolysans ATCC
           10379]
          Length = 142

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 47/139 (33%), Positives = 75/139 (53%), Gaps = 2/139 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV--TQTALELLSFITTENIAAFIIG 74
           + I  +D G+K IG+A+SD     A     +   +         +   +   N+   ++G
Sbjct: 4   KRIMGLDYGSKTIGVAVSDLLGFTAQGIETININEQVKDFKIKRIKELVQEHNVGTIVVG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NM+ S G R  +T  FV  +  +   V  +  DERLTT+ A+++L++ NVSRKKR  
Sbjct: 64  LPKNMDNSVGFRGEATLYFVEVLKKKIKNVEIILQDERLTTMGAERVLLEANVSRKKRKN 123

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA LILQ  LD+++
Sbjct: 124 VIDKMAAVLILQTYLDKLN 142


>gi|312143794|ref|YP_003995240.1| Holliday junction resolvase YqgF [Halanaerobium sp. 'sapolanicus']
 gi|311904445|gb|ADQ14886.1| Holliday junction resolvase YqgF [Halanaerobium sp. 'sapolanicus']
          Length = 136

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 78/137 (56%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  ID G KR+G+A+SD     A P   L +    +  +EL  +I   ++   I+G+P
Sbjct: 1   MRILGIDYGNKRVGIAVSDALGWTAQPLTTLKQHGHQELLVELRQYIEKYDVEKIIVGMP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NM+GS G R   T+AF++  +   + +P    DERLTT  A+ IL++ ++SR +R   +
Sbjct: 61  YNMDGSRGKRAEITQAFINF-LKNNLEIPVEIQDERLTTSQAENILLEADLSRSRRKDVI 119

Query: 137 DSIAAALILQEVLDRIS 153
           D +AAALILQ  LD  +
Sbjct: 120 DKLAAALILQSYLDLNN 136


>gi|239827825|ref|YP_002950449.1| Holliday junction resolvase YqgF [Geobacillus sp. WCH70]
 gi|259495706|sp|C5D4Z1|RUVX_GEOSW RecName: Full=Putative Holliday junction resolvase
 gi|239808118|gb|ACS25183.1| Holliday junction resolvase YqgF [Geobacillus sp. WCH70]
          Length = 138

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 78/137 (56%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFL--VRKKVTQTALELLSFITTENIAAFIIG 74
             +  +DLGTK +G+A+SD     A     +    ++       L   I    +   ++G
Sbjct: 1   MRVLGLDLGTKTLGVAVSDELGWTAQGIETISIDEERGEYGLKRLREIIDEYEVDTIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P NMNG+ GPR  +++ F   +++ +  +P + WDERL+T++A+++LI  +VSRKKR Q
Sbjct: 61  FPKNMNGTVGPRAEASQRFAK-LLESEFSLPVILWDERLSTMAAERMLITADVSRKKRKQ 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LD 
Sbjct: 120 VIDKMAAVVILQSYLDS 136


>gi|309389102|gb|ADO76982.1| Holliday junction resolvase YqgF [Halanaerobium praevalens DSM
           2228]
          Length = 135

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 50/136 (36%), Positives = 80/136 (58%), Gaps = 1/136 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  ID G KR+G+A+SD     A P   L      +  +E+  +I   ++   I+G+P
Sbjct: 1   MRILGIDYGNKRVGIAVSDALGWTAQPLVTLKMNGHQKLLVEIKKYIDKYDVEKIIVGMP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            N++GS G R   T+AF++  ++ ++ +P    DERLTT  AQ IL++ +VSR+ R + +
Sbjct: 61  YNLDGSRGKRAEITQAFINF-LNNQLEIPIQIQDERLTTKQAQNILLEADVSRQGRKKVI 119

Query: 137 DSIAAALILQEVLDRI 152
           D +AA+LILQ  LD +
Sbjct: 120 DKLAASLILQSYLDSL 135


>gi|121535968|ref|ZP_01667762.1| Holliday junction resolvase YqgF [Thermosinus carboxydivorans Nor1]
 gi|121305460|gb|EAX46408.1| Holliday junction resolvase YqgF [Thermosinus carboxydivorans Nor1]
          Length = 140

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 68/137 (49%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I ++D+G K IG A+SD     A     + R         +            I+GLP
Sbjct: 1   MRILALDVGEKTIGAAVSDELLLTAQGVEVIRRMSPEADMARIRELAEHFEATVIIVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP+    +AF   + +    +    WDERL+TV+A++ LI  +V R KR Q +
Sbjct: 61  KNMNGTIGPQGEKVKAFASELQNYLAGIEVRLWDERLSTVAAERSLIAADVRRAKRRQVI 120

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA  ILQ  LD +S
Sbjct: 121 DKMAAVFILQGYLDSLS 137


>gi|126698882|ref|YP_001087779.1| putative holliday junction resolvase [Clostridium difficile 630]
 gi|254974830|ref|ZP_05271302.1| putative holliday junction resolvase [Clostridium difficile
           QCD-66c26]
 gi|255092218|ref|ZP_05321696.1| putative holliday junction resolvase [Clostridium difficile CIP
           107932]
 gi|255100303|ref|ZP_05329280.1| putative holliday junction resolvase [Clostridium difficile
           QCD-63q42]
 gi|255306242|ref|ZP_05350414.1| putative holliday junction resolvase [Clostridium difficile ATCC
           43255]
 gi|255313957|ref|ZP_05355540.1| putative holliday junction resolvase [Clostridium difficile
           QCD-76w55]
 gi|255516637|ref|ZP_05384313.1| putative holliday junction resolvase [Clostridium difficile
           QCD-97b34]
 gi|255649736|ref|ZP_05396638.1| putative holliday junction resolvase [Clostridium difficile
           QCD-37x79]
 gi|260682892|ref|YP_003214177.1| putative holliday junction resolvase [Clostridium difficile CD196]
 gi|260686490|ref|YP_003217623.1| putative holliday junction resolvase [Clostridium difficile R20291]
 gi|306519845|ref|ZP_07406192.1| putative Holliday junction resolvase [Clostridium difficile
           QCD-32g58]
 gi|118597204|sp|Q18BF1|RUVX_CLOD6 RecName: Full=Putative Holliday junction resolvase
 gi|115250319|emb|CAJ68141.1| putative Holliday junction resolvase [Clostridium difficile]
 gi|260209055|emb|CBA62181.1| putative holliday junction resolvase [Clostridium difficile CD196]
 gi|260212506|emb|CBE03438.1| putative holliday junction resolvase [Clostridium difficile R20291]
          Length = 141

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 47/134 (35%), Positives = 74/134 (55%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G K IG+A+SD     A     + R    +   EL + I  + +   + GLP
Sbjct: 4   GRIMGLDVGDKTIGVAVSDLMGLTAQGVKTIKRVGKKKDIEELKAIIKEKQVNKIVSGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP+      F   +   +  +   FWDERL+TV+A++ L++ +VSR+KR + +
Sbjct: 64  KNMNGTLGPQGEKVIKFCELV-KAETGIDVEFWDERLSTVAAERSLLEADVSRQKRKKVI 122

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 123 DMLAAVIILQGYLD 136


>gi|332799383|ref|YP_004460882.1| Holliday junction resolvase [Tepidanaerobacter sp. Re1]
 gi|332697118|gb|AEE91575.1| Holliday junction resolvase [Tepidanaerobacter sp. Re1]
          Length = 143

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 76/137 (55%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV--TQTALELLSFITTENIAAFIIG 74
             I  +D+G KR+G+AISD     A     + RK     +    +   I+  N+   I+G
Sbjct: 1   MRILGLDVGEKRVGVAISDELGLTAQGIDVIERKNDGKNKDIDRICRIISDYNVTKVIVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ GP   +   +    + + + +   FWDERLTT +A++ILI+ +VSR+KR  
Sbjct: 61  LPKNMNGTLGPSSEAVENYTK-KLQKAISIDLEFWDERLTTAAAERILIEADVSRQKRKG 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA LILQ  LD 
Sbjct: 120 VIDKLAAVLILQSYLDS 136


>gi|212638590|ref|YP_002315110.1| RNase H-like ribonuclease [Anoxybacillus flavithermus WK1]
 gi|212560070|gb|ACJ33125.1| RNase H-like ribonuclease [Anoxybacillus flavithermus WK1]
          Length = 145

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 48/139 (34%), Positives = 75/139 (53%), Gaps = 3/139 (2%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAF 71
             +  I  +D GTK +G+A+SD     A     +    +        L   I    +   
Sbjct: 3   NRHMRILGLDFGTKTLGVAVSDELGWTAQGIETIRIDEEHGEYGFDRLRQLIEQYAVEEI 62

Query: 72  IIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           ++G P NMNG+ GPR  +T+ F   +  +   +P V WDERL+T++A+++LI  +VSRKK
Sbjct: 63  VVGFPKNMNGTIGPRGEATQRFAEQV-KQTFSLPVVLWDERLSTMAAERMLIAADVSRKK 121

Query: 132 RIQKVDSIAAALILQEVLD 150
           R + +D +AA +ILQ  LD
Sbjct: 122 RKKVIDKMAAVMILQSYLD 140


>gi|225387769|ref|ZP_03757533.1| hypothetical protein CLOSTASPAR_01539 [Clostridium asparagiforme
           DSM 15981]
 gi|225046130|gb|EEG56376.1| hypothetical protein CLOSTASPAR_01539 [Clostridium asparagiforme
           DSM 15981]
          Length = 151

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 51/141 (36%), Positives = 77/141 (54%), Gaps = 4/141 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+K +G+A+ DP    A     +VRK   K+ +T   +   I    I   ++
Sbjct: 1   MRIMGLDYGSKTVGVAVCDPLGITAQTVETIVRKDENKLRKTLARIEELIGAYEIERIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN + G R           ++R+  +P + WDERLTTV+A ++L++  V R+ R 
Sbjct: 61  GYPKNMNNTVGERAQKAEEL-KAALERRTGLPVILWDERLTTVAADRVLMESGVRREHRK 119

Query: 134 QKVDSIAAALILQEVLDRISF 154
           + VD IAAA+ILQ  LD +SF
Sbjct: 120 ESVDQIAAAMILQGYLDNLSF 140


>gi|311031560|ref|ZP_07709650.1| Holliday junction resolvase-like protein [Bacillus sp. m3-13]
          Length = 138

 Score =  141 bits (355), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 50/137 (36%), Positives = 77/137 (56%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISD     A     +   +  +      L   I        ++G
Sbjct: 1   MRILGLDVGSKTVGVAISDEMGWTAQGLETIKIDEAIKNLGFKRLKQIIAEYKPEKVVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNGS GPR  +++ +    +  K  +P ++WDERL+TV+A++IL+  +VSRKKR Q
Sbjct: 61  LPKNMNGSIGPRGEASKHYGEM-LTAKTGLPVIYWDERLSTVAAERILLSADVSRKKRKQ 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LD 
Sbjct: 120 VIDKMAAVVILQGYLDS 136


>gi|251798321|ref|YP_003013052.1| Holliday junction resolvase YqgF [Paenibacillus sp. JDR-2]
 gi|247545947|gb|ACT02966.1| Holliday junction resolvase YqgF [Paenibacillus sp. JDR-2]
          Length = 138

 Score =  141 bits (355), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 46/135 (34%), Positives = 72/135 (53%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
                +D G + IG+A+SD     A     + +++       +   +    +   ++GLP
Sbjct: 1   MRTMGLDYGDRNIGVAVSDAFGWTAQGLETVHKRRDGGEMDRIAELVKEHEVTEIVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMN + GPR   + AF    + + + +P   WDERLTTVSA++ L++ +VSRKKR   +
Sbjct: 61  KNMNNTIGPRGEISMAFAEQ-LQQTLNLPVHLWDERLTTVSAERTLLEADVSRKKRKLVI 119

Query: 137 DSIAAALILQEVLDR 151
           D +AA LILQ  LD 
Sbjct: 120 DKMAATLILQNYLDS 134


>gi|196233674|ref|ZP_03132515.1| Holliday junction resolvase YqgF [Chthoniobacter flavus Ellin428]
 gi|196222344|gb|EDY16873.1| Holliday junction resolvase YqgF [Chthoniobacter flavus Ellin428]
          Length = 140

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 49/140 (35%), Positives = 72/140 (51%), Gaps = 1/140 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            +    ID G  RIG+A+SD     AHP   +  K+V      + + +T++++   I+GL
Sbjct: 1   MKRALGIDHGDARIGVAVSDDLGMLAHPLETIHVKEVADPVARIATLVTSKDVGHIILGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NM+GS GP     RAF    +          WDERLT+V+AQ+ L +     K   + 
Sbjct: 61  PRNMDGSYGPAAEKVRAFAE-KLRAACGCEVKLWDERLTSVAAQRSLHEAGRKVKDSREV 119

Query: 136 VDSIAAALILQEVLDRISFL 155
           +D +AA LILQ  LD  + L
Sbjct: 120 IDQVAAQLILQGWLDSQALL 139


>gi|40889964|pdb|1VHX|A Chain A, Crystal Structure Of Putative Holliday Junction Resolvase
 gi|40889965|pdb|1VHX|B Chain B, Crystal Structure Of Putative Holliday Junction Resolvase
          Length = 150

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 50/142 (35%), Positives = 74/142 (52%), Gaps = 3/142 (2%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGL 75
            I  +DLGTK +G+A+SD     A     +   +         L   I    I   ++G 
Sbjct: 4   RILGLDLGTKTLGVALSDEXGWTAQGIETIKINEAEGDYGLSRLSELIKDYTIDKIVLGF 63

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P N NG+ GPR  +++ F   +++    VP V WDERLTT +A++ LI  +VSR+KR + 
Sbjct: 64  PKNXNGTVGPRGEASQTFAK-VLETTYNVPVVLWDERLTTXAAEKXLIAADVSRQKRKKV 122

Query: 136 VDSIAAALILQEVLDRISFLES 157
           +D  AA  ILQ  LD ++   S
Sbjct: 123 IDKXAAVXILQGYLDSLNEGGS 144


>gi|229918437|ref|YP_002887083.1| Holliday junction resolvase YqgF [Exiguobacterium sp. AT1b]
 gi|229469866|gb|ACQ71638.1| Holliday junction resolvase YqgF [Exiguobacterium sp. AT1b]
          Length = 140

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 49/138 (35%), Positives = 75/138 (54%), Gaps = 3/138 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPF--LVRKKVTQTALELLSFITTENIAAFII 73
            + +  +D+G+K IG+A+SD     A              +    L  FI   ++   ++
Sbjct: 1   MKRVMGLDVGSKTIGVAVSDLMGWTAQGVETVYWTEPDFDEAVRLLRPFIEQYDVKEVVV 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMNG+ GPR  ++ AF     ++   +P V  DERLTT+ A+++LI  +VSRKKR 
Sbjct: 61  GHPKNMNGTVGPRGEASEAFAEAFTEQT-GLPCVLVDERLTTMQAERMLISADVSRKKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
             +D +AA +ILQ  LDR
Sbjct: 120 AVIDKMAAVMILQNYLDR 137


>gi|312898887|ref|ZP_07758275.1| conserved hypothetical protein TIGR00250 [Megasphaera
           micronuciformis F0359]
 gi|310620049|gb|EFQ03621.1| conserved hypothetical protein TIGR00250 [Megasphaera
           micronuciformis F0359]
          Length = 138

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 47/134 (35%), Positives = 66/134 (49%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G+K IG+A SD     A     L R+   +  L L      + +   ++G P
Sbjct: 1   MRILGLDVGSKTIGVACSDALLLTAQAVGTLKRQSRRKDCLALADICKEKEVHRIVVGKP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            +MNG +         FV  +         V+WDERLTTV AQ+ L++  V R+KR   V
Sbjct: 61  SHMNGDKSANTEKIEQFVEKLKKTVPQTEIVWWDERLTTVMAQRQLMEAGVRREKRKAVV 120

Query: 137 DSIAAALILQEVLD 150
           D+IAA  ILQ  LD
Sbjct: 121 DTIAAVFILQNYLD 134


>gi|320529130|ref|ZP_08030222.1| conserved hypothetical protein TIGR00250 [Selenomonas artemidis
           F0399]
 gi|320138760|gb|EFW30650.1| conserved hypothetical protein TIGR00250 [Selenomonas artemidis
           F0399]
          Length = 138

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 50/136 (36%), Positives = 72/136 (52%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            S+D+G   IG+A+SD     A     + R  +      L + +    + A + GLP +M
Sbjct: 1   MSLDIGDVTIGIAVSDLLGLTAQGVETIRRTTLAADFERLSTLMRDYEVDALVAGLPKHM 60

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           NG EG R    RAF+         V   +WDERL+TV+A + L++ +VSRKKR + +D +
Sbjct: 61  NGDEGTRCEMVRAFMAEAAQCFPGVKIHYWDERLSTVAATRTLLEGDVSRKKRRKVIDKM 120

Query: 140 AAALILQEVLDRISFL 155
           AA  ILQ  LDR   L
Sbjct: 121 AAVYILQGFLDRQRNL 136


>gi|16079793|ref|NP_390617.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221310675|ref|ZP_03592522.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221314998|ref|ZP_03596803.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221319919|ref|ZP_03601213.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221324200|ref|ZP_03605494.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321312264|ref|YP_004204551.1| Holliday junction resolvase-like protein [Bacillus subtilis BSn5]
 gi|6226496|sp|O34634|RUVX_BACSU RecName: Full=Putative Holliday junction resolvase
 gi|2635185|emb|CAB14681.1| putative Holliday junction resolvase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|291485144|dbj|BAI86219.1| Holliday junction resolvase-like protein [Bacillus subtilis subsp.
           natto BEST195]
 gi|320018538|gb|ADV93524.1| Holliday junction resolvase-like protein [Bacillus subtilis BSn5]
          Length = 138

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 50/139 (35%), Positives = 78/139 (56%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             I  +DLGTK +G+A+SD     A     +   +         L   I    I   ++G
Sbjct: 1   MRILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLSRLSELIKDYTIDKIVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P NMNG+ GPR  +++ F   +++    VP V WDERLTT++A+++LI  +VSR+KR +
Sbjct: 61  FPKNMNGTVGPRGEASQTFAK-VLETTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKK 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LD ++
Sbjct: 120 VIDKMAAVMILQGYLDSLN 138


>gi|297544525|ref|YP_003676827.1| Holliday junction resolvase YqgF [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296842300|gb|ADH60816.1| Holliday junction resolvase YqgF [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 139

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 50/136 (36%), Positives = 74/136 (54%), Gaps = 2/136 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G K IG+AISD     A     + R    +    +   I    +   I+GLP
Sbjct: 1   MRIMGLDVGDKTIGIAISDLSGTIAQGLTTIKRSSNKKDFERIKQIINEYEVGMIIVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQK 135
            NMNG+ GP+      FV + + +   +P + WDERLTTV A+++LI+  ++SR KR + 
Sbjct: 61  KNMNGTLGPQGQKVVRFVEH-LKKAFSIPIILWDERLTTVEAERVLIEKADISRAKRKEV 119

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA LILQ  LD 
Sbjct: 120 IDKLAAILILQNYLDS 135


>gi|239932416|ref|ZP_04689369.1| hypothetical protein SghaA1_29605 [Streptomyces ghanaensis ATCC
           14672]
 gi|291440782|ref|ZP_06580172.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
 gi|291343677|gb|EFE70633.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
          Length = 154

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 46/146 (31%), Positives = 63/146 (43%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 +ID+G  RIG+A  DPG   A P   +  + V      L   I        ++G
Sbjct: 2   RQGRRLAIDVGDARIGVASCDPGGILATPVETVPGRDVPAAHRRLKQLIEEYEPIEVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EGP     R F   +    + VP    DER+TTV+A Q L    V  KK   
Sbjct: 62  LPRSLKGGEGPAAAKVRGFARELARMIMPVPVRLVDERMTTVTASQGLRASGVKSKKGRS 121

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            +D  AA +ILQ+ L+         G
Sbjct: 122 VIDQAAAVIILQQALESERVSGEPPG 147


>gi|238924257|ref|YP_002937773.1| hypothetical protein EUBREC_1895 [Eubacterium rectale ATCC 33656]
 gi|259495705|sp|C4ZAY4|RUVX_EUBR3 RecName: Full=Putative Holliday junction resolvase
 gi|238875932|gb|ACR75639.1| hypothetical protein EUBREC_1895 [Eubacterium rectale ATCC 33656]
          Length = 143

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 49/144 (34%), Positives = 76/144 (52%), Gaps = 4/144 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+K +G+A+SD     A     + RK   K+ QT   +   I    +   ++
Sbjct: 1   MRILGLDFGSKTVGVAVSDELLITAQGVEIVRRKSPSKLRQTLARIEEIIAEYKVDRIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN +EG R   T+ F    + R+  +  ++WDERLTTV+A + +++  + R+ R 
Sbjct: 61  GYPKNMNNTEGERCEKTKEFGDM-LARRTGLEVIYWDERLTTVAADRSMMETGIRRENRK 119

Query: 134 QKVDSIAAALILQEVLDRISFLES 157
           + VD IAA  ILQ  LD +S   S
Sbjct: 120 EFVDEIAAIFILQGYLDYLSNSRS 143


>gi|20807699|ref|NP_622870.1| endonuclease [Thermoanaerobacter tengcongensis MB4]
 gi|32130041|sp|Q8R5S9|RUVX_THETN RecName: Full=Putative Holliday junction resolvase
 gi|20516249|gb|AAM24474.1| predicted endonuclease involved in recombination
           [Thermoanaerobacter tengcongensis MB4]
          Length = 139

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 48/136 (35%), Positives = 74/136 (54%), Gaps = 2/136 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             +  +D+G K IG+AISD     A     + RK   +    +   +   ++   ++GLP
Sbjct: 1   MRVLGLDVGDKTIGVAISDVSSTIAQGITTIRRKSFVEDVKAIEEIVKKYSVEKVVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRIQK 135
            NMNGS GP+      F    +   + +P VFWDERLTT+ A++ LI+  ++SR KR + 
Sbjct: 61  KNMNGSIGPQGEKVIKFGE-KLREVLRIPVVFWDERLTTLQAERFLIEGVDMSRGKRKKV 119

Query: 136 VDSIAAALILQEVLDR 151
           +D +AA +ILQ  LD 
Sbjct: 120 IDKLAATIILQSYLDS 135


>gi|225375409|ref|ZP_03752630.1| hypothetical protein ROSEINA2194_01034 [Roseburia inulinivorans DSM
           16841]
 gi|225212745|gb|EEG95099.1| hypothetical protein ROSEINA2194_01034 [Roseburia inulinivorans DSM
           16841]
          Length = 145

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 48/146 (32%), Positives = 76/146 (52%), Gaps = 4/146 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVR---KKVTQTALELLSFITTENIAAFII 73
             I  +D G+K +G+A+SD     A     + R    K+ Q+   +   I   N+   ++
Sbjct: 1   MRILGLDYGSKTVGVAVSDELLFTAQGLEIVRRQSPNKLRQSLARIEEIIKEYNVERIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN +EG R   T+ F    ++R+  +  + WDERLTTVSA + +++  + R+ R 
Sbjct: 61  GYPKNMNNTEGERCEKTKEFKEM-LERRTGLNVILWDERLTTVSADKHMMESGIRREDRK 119

Query: 134 QKVDSIAAALILQEVLDRISFLESSK 159
           + VD IAA  ILQ  LD ++     K
Sbjct: 120 KFVDEIAAVFILQGYLDYLAMHPEEK 145


>gi|225181970|ref|ZP_03735403.1| Holliday junction resolvase YqgF [Dethiobacter alkaliphilus AHT 1]
 gi|225167332|gb|EEG76150.1| Holliday junction resolvase YqgF [Dethiobacter alkaliphilus AHT 1]
          Length = 138

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 41/133 (30%), Positives = 67/133 (50%), Gaps = 1/133 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G + IG+A SD     A     + R         +   +    ++  ++G P
Sbjct: 1   MRILGLDVGDRTIGVAASDALGWTAQGLEVIRRTTWENDLKRIRELVAEYEVSLIVVGYP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMN + GPR   +  F    +  ++ +P   WDERLTT+ A++ L+  ++SR KR + +
Sbjct: 61  KNMNNTVGPRAKLSEEFAD-KLSAELNLPVKLWDERLTTMEAERTLLSADMSRAKRKKVI 119

Query: 137 DSIAAALILQEVL 149
           D +AA LILQ  L
Sbjct: 120 DKMAAVLILQNYL 132


>gi|297616549|ref|YP_003701708.1| Holliday junction resolvase YqgF [Syntrophothermus lipocalidus DSM
           12680]
 gi|297144386|gb|ADI01143.1| Holliday junction resolvase YqgF [Syntrophothermus lipocalidus DSM
           12680]
          Length = 144

 Score =  140 bits (353), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 48/136 (35%), Positives = 71/136 (52%), Gaps = 1/136 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D G KRIG+AISD     A P   + R  +      +     T  +   ++GLP
Sbjct: 1   MRILGLDPGEKRIGVAISDALGITAQPLTSIQRSSLKADIEAIRQICETYQVEHIVLGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LN+NGS G +   +       +   + +    WDERL+T + Q +L++ + SR+KR + V
Sbjct: 61  LNLNGSRGEKAAQSAKLAQ-ELKEHLSLEVTLWDERLSTKAVQGVLLEADTSRRKRKRVV 119

Query: 137 DSIAAALILQEVLDRI 152
           D +AAA ILQ  LDRI
Sbjct: 120 DKLAAAYILQGYLDRI 135


>gi|91776452|ref|YP_546208.1| Holliday junction resolvase-like protein [Methylobacillus
           flagellatus KT]
 gi|124107442|sp|Q1GZH0|RUVX_METFK RecName: Full=Putative Holliday junction resolvase
 gi|91710439|gb|ABE50367.1| Holliday junction resolvase YqgF [Methylobacillus flagellatus KT]
          Length = 146

 Score =  140 bits (353), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 37/140 (26%), Positives = 60/140 (42%), Gaps = 1/140 (0%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
                +   D G KRIG+AI +     AHP   +  +   +    +   I        ++
Sbjct: 7   SSRGCVLGFDFGEKRIGVAIGEHLLGIAHPLVTIDAEANDKRFAAIAGLIEEWQPEMLVV 66

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP  +NG E       R F    ++ +  +P    DERL++  A Q L    +S +K+ 
Sbjct: 67  GLPSYLNGDEHALTQLCRKFAR-RLEGRFNLPVQLVDERLSSAEASQTLKQSGISGRKQK 125

Query: 134 QKVDSIAAALILQEVLDRIS 153
             +D +AA  ILQ   D ++
Sbjct: 126 SVLDQVAAQHILQSYFDGLA 145


>gi|291549894|emb|CBL26156.1| conserved hypothetical protein TIGR00250 [Ruminococcus torques
           L2-14]
          Length = 145

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 52/139 (37%), Positives = 74/139 (53%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             +  +D GTK +G+AISDP    A     + RK   K+ +T   +   I    +   ++
Sbjct: 1   MRVMGLDYGTKTVGVAISDPLGLTAQGIETIQRKEENKLRRTCARIEELIKEYQVEKIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P +MN   G R   +  F  +M+ R+  +  + WDERLTTV+A+Q LI+  V R+ R 
Sbjct: 61  GFPKHMNNDIGERAQKSLEF-RDMLVRRTGLEVIMWDERLTTVAAEQTLIESGVRRENRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           Q VD IAA  ILQ  LD I
Sbjct: 120 QYVDKIAAVFILQGYLDSI 138


>gi|291519256|emb|CBK74477.1| conserved hypothetical protein TIGR00250 [Butyrivibrio fibrisolvens
           16/4]
          Length = 142

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 50/139 (35%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK---VTQTALELLSFITTENIAAFI 72
              I  +D GTK +G+AISDP    A     + R++   +  T + +        +   I
Sbjct: 1   MSRILGLDYGTKTVGVAISDPLLLTAQEFETITRERASALRHTLVRIKEICEEYQVEKII 60

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +G P NM+ SEG R   T  F   +++++V +P    DERLTTV A +IL +  V++K R
Sbjct: 61  LGYPRNMDDSEGFRCEDTLEF-KKLLEKRVDIPIELVDERLTTVYADEILEESGVAKKDR 119

Query: 133 IQKVDSIAAALILQEVLDR 151
            + +D IAAA+ILQ+ LD 
Sbjct: 120 KKVIDQIAAAIILQDYLDN 138


>gi|225568728|ref|ZP_03777753.1| hypothetical protein CLOHYLEM_04807 [Clostridium hylemonae DSM
           15053]
 gi|225162227|gb|EEG74846.1| hypothetical protein CLOHYLEM_04807 [Clostridium hylemonae DSM
           15053]
          Length = 145

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 50/140 (35%), Positives = 72/140 (51%), Gaps = 4/140 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFI 72
           +  I  +D G K +G+A+SDP    A     + RK   K+ QT   +   I    +   +
Sbjct: 2   SMRIMGLDYGEKTVGVAVSDPLGLTAQGIETIFRKEENKLRQTCARIEELIREYEVERIV 61

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLP +MN   G R   +  F    + R+  +  V WDERLTTV A++ LI+  V R+ R
Sbjct: 62  LGLPKHMNNDIGDRAEQSLEFGEM-LKRRTGLEVVMWDERLTTVEAERTLIENKVRREDR 120

Query: 133 IQKVDSIAAALILQEVLDRI 152
            + +D IAA  ILQ  LD I
Sbjct: 121 KKYIDKIAAVFILQGYLDSI 140


>gi|325290060|ref|YP_004266241.1| Holliday junction resolvase [Syntrophobotulus glycolicus DSM 8271]
 gi|324965461|gb|ADY56240.1| Holliday junction resolvase [Syntrophobotulus glycolicus DSM 8271]
          Length = 134

 Score =  140 bits (352), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 52/135 (38%), Positives = 72/135 (53%), Gaps = 3/135 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             +  +DLG K IG+A+SD     A P   + R +  Q   EL   I    +   ++G P
Sbjct: 1   MRVMGLDLGEKTIGVAVSDLLMLTAQPLLVIKRSEKEQ--EELAGIIKEYEVDTIVVGYP 58

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ G R  +T AF    +     +P   WDERL+TV+AQ+ LI  +VSR KR + +
Sbjct: 59  KNMNGTIGERALATEAFAQ-ELQAAFRLPIKLWDERLSTVAAQKSLIQADVSRAKRKKVI 117

Query: 137 DSIAAALILQEVLDR 151
           D +AA  ILQ  LD 
Sbjct: 118 DKMAAVFILQGFLDS 132


>gi|150390226|ref|YP_001320275.1| Holliday junction resolvase YqgF [Alkaliphilus metalliredigens
           QYMF]
 gi|149950088|gb|ABR48616.1| Holliday junction resolvase YqgF [Alkaliphilus metalliredigens
           QYMF]
          Length = 138

 Score =  140 bits (352), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 76/138 (55%), Gaps = 1/138 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I  +D+G + IG+AISD     A     + R  + +    L   I    +   ++GL
Sbjct: 1   MNRIIGLDVGDRTIGIAISDLMGWTAQGVETIQRISIKKDLQRLEELIAQYEVKKILVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMNG+ GP+      FV   ++++  +  V WDERL+TV+A++ LI  +VSRKKR Q 
Sbjct: 61  PKNMNGTIGPQGEKVLLFVE-RLEKRFKLEVVTWDERLSTVAAEKFLIGADVSRKKRKQV 119

Query: 136 VDSIAAALILQEVLDRIS 153
           +D +AA  ILQ  LD IS
Sbjct: 120 IDKLAAVHILQGYLDSIS 137


>gi|188586393|ref|YP_001917938.1| Holliday junction resolvase YqgF [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|226731632|sp|B2A5J5|RUVX_NATTJ RecName: Full=Putative Holliday junction resolvase
 gi|179351080|gb|ACB85350.1| Holliday junction resolvase YqgF [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 141

 Score =  140 bits (352), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 49/135 (36%), Positives = 75/135 (55%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I   DLG   IG+A+SD  +  A  +  + R+ + +   ++   I    ++  I+GLP
Sbjct: 1   MRIMGFDLGEATIGVAVSDALQLTAQGKTVIKRQSLEKDIEQVTKLIEDYQVSKLIVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNGS G        F+   ++++V +P    DERLT+  A+Q L++ +VSRKKR Q +
Sbjct: 61  KNMNGSLGQMADQIMDFIK-SLEQEVDIPIETVDERLTSRMAEQTLLEADVSRKKRKQVI 119

Query: 137 DSIAAALILQEVLDR 151
           D +AA  ILQ  LDR
Sbjct: 120 DKLAAVNILQTYLDR 134


>gi|295396921|ref|ZP_06807045.1| crossover junction endodeoxyribonuclease [Aerococcus viridans ATCC
           11563]
 gi|294974855|gb|EFG50558.1| crossover junction endodeoxyribonuclease [Aerococcus viridans ATCC
           11563]
          Length = 139

 Score =  140 bits (352), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 51/136 (37%), Positives = 76/136 (55%), Gaps = 3/136 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV--TQTALELLSFITTENIAAFIIG 74
                +D+G+K +G+A+SDP    A     +   +         L   I    + A ++G
Sbjct: 1   MRYMGLDVGSKTVGVAVSDPFGWTAQGVEIIPIDEELEEFGLDRLGELIAEYKVEALVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN S GPR  +++ +   +IDR   +P  + DERLTTV A+++LI  +VSRKKR +
Sbjct: 61  LPKNMNNSIGPRAEASQKYGQLVIDRF-DLPVFYQDERLTTVQAERMLIANDVSRKKRKK 119

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA LILQ  LD
Sbjct: 120 VIDKLAAVLILQNYLD 135


>gi|288870608|ref|ZP_06114688.2| putative holliday junction resolvase [Clostridium hathewayi DSM
           13479]
 gi|288866578|gb|EFC98876.1| putative holliday junction resolvase [Clostridium hathewayi DSM
           13479]
          Length = 161

 Score =  140 bits (352), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 50/141 (35%), Positives = 76/141 (53%), Gaps = 4/141 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFI 72
              I  +D G+K +G+A+SD     A     + R+   K+ +T   +   I    I   +
Sbjct: 15  RMRIMGLDYGSKTVGVAVSDSLGLTAQALETITREDENKLRKTCARIEELIREYEIETIV 74

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +G P NMN + G RV  T +F   M++R+  +P V WDERLTTV +++IL +  V R+ R
Sbjct: 75  LGYPKNMNNTLGDRVEKTESF-KAMLERRTGLPVVLWDERLTTVQSERILQESGVRRENR 133

Query: 133 IQKVDSIAAALILQEVLDRIS 153
              +D +AA LILQ  LD + 
Sbjct: 134 KAVIDKVAAGLILQGYLDSLP 154


>gi|52081220|ref|YP_080011.1| Holliday junction resolvase-like protein [Bacillus licheniformis
           ATCC 14580]
 gi|52786601|ref|YP_092430.1| Holliday junction resolvase-like protein [Bacillus licheniformis
           ATCC 14580]
 gi|319644812|ref|ZP_07999045.1| Holliday junction resolvase [Bacillus sp. BT1B_CT2]
 gi|62900959|sp|Q65GS7|RUVX_BACLD RecName: Full=Putative Holliday junction resolvase
 gi|52004431|gb|AAU24373.1| conserved protein YrrK [Bacillus licheniformis ATCC 14580]
 gi|52349103|gb|AAU41737.1| YrrK [Bacillus licheniformis ATCC 14580]
 gi|317392621|gb|EFV73415.1| Holliday junction resolvase [Bacillus sp. BT1B_CT2]
          Length = 139

 Score =  140 bits (352), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 47/139 (33%), Positives = 77/139 (55%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             I  +DLG+K +G+A+SD     A     +   +         L        I   ++G
Sbjct: 1   MRILGLDLGSKTLGVALSDEMGWTAQGIETIKIDEAGGDYGLNRLAELTKDYVIDKIVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P NMNG+ GPR  +++ F   +++    VP V WDERL+T++A+++LI  +VSR+KR +
Sbjct: 61  FPKNMNGTVGPRGEASQKFAE-VLEETFQVPVVLWDERLSTMAAERMLISADVSRQKRKK 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LD ++
Sbjct: 120 VIDKMAAVMILQGYLDSLN 138


>gi|325662158|ref|ZP_08150776.1| Holliday junction resolvase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325471607|gb|EGC74827.1| Holliday junction resolvase [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 148

 Score =  140 bits (352), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 51/142 (35%), Positives = 77/142 (54%), Gaps = 4/142 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIGLP 76
             +D G+K +G+AISDP    A     + RK   K+ +T   + + +    +   ++G P
Sbjct: 1   MGLDYGSKTVGVAISDPLGLTAQGIETICRKEENKLRKTLARIEALVQEYQVEEIVLGFP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMN + G R   +  F    ++R+  +P   WDERLTTV A++ LI+ NV R+ R + V
Sbjct: 61  KNMNNTVGDRAEKSLEFKEM-LERRTALPVTMWDERLTTVEAERTLIENNVRREDRKKYV 119

Query: 137 DSIAAALILQEVLDRISFLESS 158
           D IAA  ILQ  LD + F + S
Sbjct: 120 DKIAAVFILQGYLDSVYFRQKS 141


>gi|329766971|ref|ZP_08258499.1| Holliday junction resolvase [Gemella haemolysans M341]
 gi|328837696|gb|EGF87321.1| Holliday junction resolvase [Gemella haemolysans M341]
          Length = 142

 Score =  140 bits (352), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 47/139 (33%), Positives = 75/139 (53%), Gaps = 2/139 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV--TQTALELLSFITTENIAAFIIG 74
           + I  +D G+K IG+A+SD     A     +   +         +   +   N+   ++G
Sbjct: 4   KRIMGLDYGSKTIGVAVSDLLGLTAQGIETININEQIKDFKIKRIKELVQEHNVGKIVVG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NM+ S G R  +T  FV  +  +   V  +  DERLTT+ A+++L++ NVSRKKR  
Sbjct: 64  LPKNMDNSVGFRGEATLFFVEVLKKKIKNVEIILQDERLTTMGAERVLLEANVSRKKRKD 123

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA LILQ  LD+++
Sbjct: 124 VIDKMAAVLILQTYLDKLN 142


>gi|296115811|ref|ZP_06834437.1| putative Holliday junction resolvase [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295977788|gb|EFG84540.1| putative Holliday junction resolvase [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 153

 Score =  140 bits (352), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 54/151 (35%), Positives = 91/151 (60%), Gaps = 2/151 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +  I +L  +L+P Q +  ID G K IG+A+SD     A P   + R+K++  A E+ 
Sbjct: 1   MPLFNIPELRLALRPGQRLMGIDPGQKTIGIALSDVSLMLASPCTTVRRRKLSLVAAEIG 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                 ++ A + GLPL+++GS GP   + R ++   + ++V +P   WDERL++ +  +
Sbjct: 61  ELARRHDVGALVGGLPLSLDGSFGPAAQAARDWM-MNLSQQVGLPAAMWDERLSSSAVNR 119

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLD 150
           +LI D++++R++R Q VD +AAA ILQ  LD
Sbjct: 120 MLIQDVDMTRQRREQVVDKVAAAYILQAALD 150


>gi|255282413|ref|ZP_05346968.1| putative holliday junction resolvase [Bryantella formatexigens DSM
           14469]
 gi|255266997|gb|EET60202.1| putative holliday junction resolvase [Bryantella formatexigens DSM
           14469]
          Length = 161

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 50/140 (35%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFIIG 74
            I  +D G+K +G+AISD     A     + R    K+ QT   + + I   ++   ++G
Sbjct: 8   RIMGLDFGSKTVGVAISDELLITAQGIEIIRRTSENKLRQTCARIETLIGEYHVGRIVLG 67

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P NMN + G R   + AF    ++R+  +P V WDERLTTV A + L++  V R+KR  
Sbjct: 68  FPKNMNNTIGERAEKSLAFKEM-LERRTSLPVVMWDERLTTVEADRTLMEGGVRREKRKD 126

Query: 135 KVDSIAAALILQEVLDRISF 154
            VD +AA  ILQ  LD ++ 
Sbjct: 127 YVDKLAAVYILQGYLDYLAM 146


>gi|223935593|ref|ZP_03627509.1| Holliday junction resolvase YqgF [bacterium Ellin514]
 gi|223895601|gb|EEF62046.1| Holliday junction resolvase YqgF [bacterium Ellin514]
          Length = 138

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 75/136 (55%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID GTKRIGLAISD     A P  F++ +      + L   I  + +   ++G+
Sbjct: 1   MPRILAIDHGTKRIGLAISDELGVIAQPLEFVLAEPFANFLVRLKQLIQEKQVEMLLVGM 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NM+GS GP     + FV  ++   V +P   WDERLT+  A + LI  +V R KR +K
Sbjct: 61  PRNMDGSYGPAALKVQEFV-TVLKDSVAIPIKTWDERLTSAQANRFLIQADVRRDKRKEK 119

Query: 136 VDSIAAALILQEVLDR 151
           VD  AAA++LQ  LD 
Sbjct: 120 VDKTAAAILLQSYLDS 135


>gi|311069221|ref|YP_003974144.1| Holliday junction resolvase-like protein [Bacillus atrophaeus 1942]
 gi|310869738|gb|ADP33213.1| Holliday junction resolvase-like protein [Bacillus atrophaeus 1942]
          Length = 138

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 49/139 (35%), Positives = 77/139 (55%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             I  +DLGTK +G+A+SD     A     +   +         L        I   ++G
Sbjct: 1   MRILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLPRLSELTKDHTIDKIVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P NMNG+ GPR  +++ F   +++    VP V WDERLTT++A+++LI  +VSR+KR +
Sbjct: 61  FPKNMNGTVGPRGEASQTFAK-LLETTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKK 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LD ++
Sbjct: 120 VIDKMAAVMILQGYLDSLN 138


>gi|296133403|ref|YP_003640650.1| Holliday junction resolvase YqgF [Thermincola sp. JR]
 gi|296031981|gb|ADG82749.1| Holliday junction resolvase YqgF [Thermincola potens JR]
          Length = 133

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 52/137 (37%), Positives = 76/137 (55%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             +  +D+GTKRIG+A+SDP R  A     +   K  +   EL   I    ++  ++GLP
Sbjct: 1   MRVLGLDVGTKRIGVAVSDPLRLTAQGLTVI---KKGEELTELPRIIEQMEVSEIVVGLP 57

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NM+GS GP+           +   + +P   +DERLTTV+A++IL++ ++SR KR Q V
Sbjct: 58  KNMDGSLGPKAQEILELTE-KLRETLQLPVHTYDERLTTVAAERILLEADLSRAKRRQVV 116

Query: 137 DSIAAALILQEVLDRIS 153
           D  AA LILQ  LD   
Sbjct: 117 DKTAAVLILQGYLDSTR 133


>gi|170742466|ref|YP_001771121.1| Holliday junction resolvase YqgF [Methylobacterium sp. 4-46]
 gi|168196740|gb|ACA18687.1| Holliday junction resolvase YqgF [Methylobacterium sp. 4-46]
          Length = 168

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 62/157 (39%), Positives = 92/157 (58%), Gaps = 2/157 (1%)

Query: 1   MSILLIEDLVKSLKP-NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALEL 59
           M+   +    +S +   + +  +DLGTK IGLA+SD GRR A P   + R K T  A  L
Sbjct: 1   MNRESVAAFAESSREAGRRLLGLDLGTKTIGLALSDVGRRIASPLETIRRVKFTPDARRL 60

Query: 60  LSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQ 119
            +      +   ++G PLNM+GSEGPR  STRAFV   +   + +P + +DERL+T +  
Sbjct: 61  AAIAAEHGVGGLVVGHPLNMDGSEGPRAQSTRAFVR-NLAPILPLPVLLFDERLSTAAVT 119

Query: 120 QILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLE 156
           + L++ + SR +R + VD +AAA ILQ  LD ++ LE
Sbjct: 120 RTLLEADASRARRGKLVDKLAAAYILQGCLDVLAGLE 156


>gi|148543770|ref|YP_001271140.1| Holliday junction resolvase-like protein [Lactobacillus reuteri DSM
           20016]
 gi|184153176|ref|YP_001841517.1| hypothetical protein LAR_0521 [Lactobacillus reuteri JCM 1112]
 gi|194468335|ref|ZP_03074321.1| Holliday junction resolvase YqgF [Lactobacillus reuteri 100-23]
 gi|227363250|ref|ZP_03847382.1| crossover junction endodeoxyribonuclease [Lactobacillus reuteri
           MM2-3]
 gi|227544202|ref|ZP_03974251.1| crossover junction endodeoxyribonuclease [Lactobacillus reuteri
           CF48-3A]
 gi|300908197|ref|ZP_07125663.1| crossover junction endodeoxyribonuclease [Lactobacillus reuteri
           SD2112]
 gi|325682142|ref|ZP_08161660.1| crossover junction endodeoxyribonuclease [Lactobacillus reuteri
           MM4-1A]
 gi|167012733|sp|A5VIX9|RUVX_LACRD RecName: Full=Putative Holliday junction resolvase
 gi|226731626|sp|B2G6F5|RUVX_LACRJ RecName: Full=Putative Holliday junction resolvase
 gi|148530804|gb|ABQ82803.1| Holliday junction resolvase YqgF [Lactobacillus reuteri DSM 20016]
 gi|154705538|gb|ABS84195.1| holliday junction resolvase-like protein [Lactobacillus reuteri]
 gi|183224520|dbj|BAG25037.1| conserved hypothetical protein [Lactobacillus reuteri JCM 1112]
 gi|194453188|gb|EDX42086.1| Holliday junction resolvase YqgF [Lactobacillus reuteri 100-23]
 gi|227071706|gb|EEI09997.1| crossover junction endodeoxyribonuclease [Lactobacillus reuteri
           MM2-3]
 gi|227185838|gb|EEI65909.1| crossover junction endodeoxyribonuclease [Lactobacillus reuteri
           CF48-3A]
 gi|300894624|gb|EFK87980.1| crossover junction endodeoxyribonuclease [Lactobacillus reuteri
           SD2112]
 gi|324978786|gb|EGC15735.1| crossover junction endodeoxyribonuclease [Lactobacillus reuteri
           MM4-1A]
          Length = 147

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 47/138 (34%), Positives = 78/138 (56%), Gaps = 3/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+++SDP    A     +    +        +   +  E +A F+IG
Sbjct: 1   MRLMGLDVGSKTVGISVSDPLGWTAQAVEIIPIDEENEIFGIDRVAELVKKEQVAGFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRI 133
           LP NMN +EGPRV +++ +   +  R   +P  F DERLTTV A ++L+ + ++SR K+ 
Sbjct: 61  LPKNMNNTEGPRVEASQHYGKLLQQRFPDIPIDFQDERLTTVEAHRMLVEEADISRAKQK 120

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA  ILQ  LDR
Sbjct: 121 KVIDEVAATFILQSYLDR 138


>gi|160880429|ref|YP_001559397.1| Holliday junction resolvase YqgF [Clostridium phytofermentans ISDg]
 gi|189046094|sp|A9KKS6|RUVX_CLOPH RecName: Full=Putative Holliday junction resolvase
 gi|160429095|gb|ABX42658.1| Holliday junction resolvase YqgF [Clostridium phytofermentans ISDg]
          Length = 150

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 51/143 (35%), Positives = 76/143 (53%), Gaps = 4/143 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+  +G+AISD  +  A     + RK   K+ QT   +   I    +   ++
Sbjct: 1   MRIMGLDYGSVTVGVAISDSLKLTAQGIEVIRRKSETKLRQTLARIEELIKEYEVEEIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN + G R   +  F  + + R+  +P V WDERLTTV+A Q+L    VS KK++
Sbjct: 61  GYPKNMNNTIGERAEKSEEFAEH-LRRRTGLPVVLWDERLTTVAAHQVLNAGEVSLKKKM 119

Query: 134 QKVDSIAAALILQEVLDRISFLE 156
           + VD +AA  ILQ  LD +S  +
Sbjct: 120 EVVDKLAAVFILQGYLDYLSNKK 142


>gi|187933084|ref|YP_001885374.1| Holliday junction resolvase-like protein [Clostridium botulinum B
           str. Eklund 17B]
 gi|226725503|sp|B2THN2|RUVX_CLOBB RecName: Full=Putative Holliday junction resolvase
 gi|187721237|gb|ACD22458.1| conserved hypothetical protein [Clostridium botulinum B str. Eklund
           17B]
          Length = 137

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 50/137 (36%), Positives = 72/137 (52%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +DLG K IG+A+SDP    A     + R    +   EL        +   +IGLP
Sbjct: 1   MRILGLDLGKKTIGVAVSDPLGFTAQGITTIRRANKEKDMEELRKICDEYKVETIVIGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP           + +  + +   FWDERLTTV+A + +++ ++SR KR + V
Sbjct: 61  KNMNGTIGPSGEIAMEMGKLV-EEALNIKVEFWDERLTTVAAHKAMLEADLSRSKRKKIV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D +A+  ILQ  LDRIS
Sbjct: 120 DKVASTYILQGYLDRIS 136


>gi|167767372|ref|ZP_02439425.1| hypothetical protein CLOSS21_01891 [Clostridium sp. SS2/1]
 gi|167711347|gb|EDS21926.1| hypothetical protein CLOSS21_01891 [Clostridium sp. SS2/1]
          Length = 139

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 48/140 (34%), Positives = 81/140 (57%), Gaps = 4/140 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFI 72
            + I  +D GTK +G+A+SD     A P   + RK   K+ +T   +   +   N+   +
Sbjct: 1   MRRILGLDYGTKTVGVALSDELHITAQPLETITRKDANKLRKTYARIEELVKEYNVEKIV 60

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLP NMN + G R   T +F  + + R+  +  + WDERLTTV+++++L++  V R+ R
Sbjct: 61  LGLPKNMNNTVGERGEDTLSF-RDALVRRTGLEVILWDERLTTVASEKVLMESGVRRENR 119

Query: 133 IQKVDSIAAALILQEVLDRI 152
            + +D IAA++ILQ  LD +
Sbjct: 120 KKVIDQIAASMILQGYLDSL 139


>gi|295115537|emb|CBL36384.1| conserved hypothetical protein TIGR00250 [butyrate-producing
           bacterium SM4/1]
          Length = 140

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 52/140 (37%), Positives = 76/140 (54%), Gaps = 4/140 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I   D G+K  G+A+SDP    A     +VRK   K+ QT   +   I    I A ++
Sbjct: 1   MRIMGQDFGSKTTGVAVSDPLGLTAQGLETIVRKDENKLRQTCARIEELIEEYQIEAIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN + G R   T +F    ++R+   P + WDERLTT++A+++L++  V R+ R 
Sbjct: 61  GYPKNMNNTAGERAEKTESFKEM-LERRTGKPVILWDERLTTIAAERMLMESGVRRENRK 119

Query: 134 QKVDSIAAALILQEVLDRIS 153
             +D +AAALILQ  LD   
Sbjct: 120 AVIDKVAAALILQGYLDSQR 139


>gi|115350792|ref|YP_772631.1| Holliday junction resolvase-like protein [Burkholderia ambifaria
           AMMD]
 gi|172059815|ref|YP_001807467.1| Holliday junction resolvase-like protein [Burkholderia ambifaria
           MC40-6]
 gi|122323878|sp|Q0BHS6|RUVX_BURCM RecName: Full=Putative Holliday junction resolvase
 gi|226725493|sp|B1YU28|RUVX_BURA4 RecName: Full=Putative Holliday junction resolvase
 gi|115280780|gb|ABI86297.1| Holliday junction resolvase YqgF [Burkholderia ambifaria AMMD]
 gi|171992332|gb|ACB63251.1| Holliday junction resolvase YqgF [Burkholderia ambifaria MC40-6]
          Length = 149

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 36/144 (25%), Positives = 68/144 (47%), Gaps = 1/144 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            +  +   D G KRIG+AI +   R A     +           +   +      A ++G
Sbjct: 7   RDATLLGFDYGEKRIGVAIGNALTRSARALVVIPNLNREHRFKAVGDLLAEWRPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+        + F +  ++ +  +P  + DER ++V A+  L + NV  + R +
Sbjct: 67  LPMHPDGTPHEMTQQAKRFGN-QLNGRFGLPVTWVDERYSSVEAEAGLRERNVRGRARAE 125

Query: 135 KVDSIAAALILQEVLDRISFLESS 158
            +D+ AA +ILQ+ LD++S  E  
Sbjct: 126 MLDAEAARVILQQYLDQLSDHEHH 149


>gi|317497454|ref|ZP_07955774.1| hypothetical protein HMPREF0996_00754 [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|316895240|gb|EFV17402.1| hypothetical protein HMPREF0996_00754 [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 139

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 47/140 (33%), Positives = 81/140 (57%), Gaps = 4/140 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFI 72
            + I  +D GTK +G+A+SD     A P   + RK   K+ +T   +   +   ++   +
Sbjct: 1   MRRILGLDYGTKTVGVALSDELHITAQPLETITRKDANKLRKTYARIEELVKEYDVEKIV 60

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLP NMN + G R   T +F  + + R+  +  + WDERLTTV+++++L++  V R+ R
Sbjct: 61  LGLPKNMNNTVGERGEDTLSF-RDTLVRRTGLEVILWDERLTTVASEKVLMESGVRRENR 119

Query: 133 IQKVDSIAAALILQEVLDRI 152
            + +D IAA++ILQ  LD +
Sbjct: 120 KKVIDQIAASMILQGYLDSL 139


>gi|299822852|ref|ZP_07054738.1| crossover junction endodeoxyribonuclease [Listeria grayi DSM 20601]
 gi|299816381|gb|EFI83619.1| crossover junction endodeoxyribonuclease [Listeria grayi DSM 20601]
          Length = 138

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 43/139 (30%), Positives = 79/139 (56%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             +  +D+G+K +G+AISD     A     +   +  +      +        ++  ++G
Sbjct: 1   MRVMGLDVGSKTVGVAISDALGWTAQGIETIAINEAAKQFGYDRVKELAQEYEVSKIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN + GPR  S++ +   +++++V +P V WDER+TT +A++ L++ +VSR KR +
Sbjct: 61  LPKNMNNTLGPRAESSKKYAE-VLEKRVQLPVVLWDERMTTQAAERTLLEADVSRGKRKK 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LD  +
Sbjct: 120 VIDKLAAVMILQSYLDTNN 138


>gi|288555385|ref|YP_003427320.1| hypothetical protein BpOF4_11875 [Bacillus pseudofirmus OF4]
 gi|288546545|gb|ADC50428.1| hypothetical protein BpOF4_11875 [Bacillus pseudofirmus OF4]
          Length = 139

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 74/137 (54%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVR--KKVTQTALELLSFITTENIAAFIIG 74
                +D+GTK +G+A+SD     A     L R  +      L++       ++   +IG
Sbjct: 1   MRALGLDVGTKTVGIALSDELGWTAQGIETLRRNEEDPESDFLKIAELAKQNDVETIVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ GP       F    +   V   FV WDERLTTV+A+++L+  +VSRKKR +
Sbjct: 61  LPKNMNGTIGPSGERCMEFAD-SLKEHVDCEFVMWDERLTTVAAERMLVSADVSRKKRKK 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LDR
Sbjct: 120 VIDKMAAVMILQGYLDR 136


>gi|296284265|ref|ZP_06862263.1| Holliday junction resolvase-like protein [Citromicrobium
           bathyomarinum JL354]
          Length = 162

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 57/142 (40%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 9   LVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENI 68
           L ++L     +  +DLGTK IG+A+ D G RFA     L R K  +   EL   I   +I
Sbjct: 14  LAETLPDGGALIGLDLGTKTIGIAVCDAGWRFASALKTLPRGKFGRDRDELRKLIEARSI 73

Query: 69  AAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVS 128
              +IGLP NM+GSEGPR  ++RA+    +     +P + WDER +T SA+  +I ++VS
Sbjct: 74  RGIVIGLPRNMDGSEGPRAQASRAYAR-NLAEAFGLPVLLWDERWSTKSAEDAMIGLDVS 132

Query: 129 RKKRIQKVDSIAAALILQEVLD 150
           R+KR +++D+ AA +ILQ  +D
Sbjct: 133 RRKRAERIDAEAATIILQGAID 154


>gi|329113628|ref|ZP_08242406.1| Putative Holliday junction resolvase [Acetobacter pomorum DM001]
 gi|326697035|gb|EGE48698.1| Putative Holliday junction resolvase [Acetobacter pomorum DM001]
          Length = 154

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 53/154 (34%), Positives = 89/154 (57%), Gaps = 2/154 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L + DLV +L  +  +  ID G K++GLA+SD  R  A P   + R K+ Q A  + 
Sbjct: 1   MTLLSLTDLVATLPRHARLLGIDPGKKQVGLALSDVSRMVASPFQTVKRGKLGQMASFIR 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
              T   I   ++G+PL+++GS GP   ++R +    +  +  +P   WDERL++ +  +
Sbjct: 61  DLATEHEIGGMVVGIPLSLDGSFGPAAQASRDWA-LALSEQTGLPVCQWDERLSSSAVNR 119

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
           +LI + ++SR +R + VD +AAA ILQ  LD + 
Sbjct: 120 MLIDEADLSRARRAEMVDRLAAAYILQAALDSLP 153


>gi|307243223|ref|ZP_07525394.1| RNAse H domain protein, YqgF family [Peptostreptococcus stomatis
           DSM 17678]
 gi|306493351|gb|EFM65333.1| RNAse H domain protein, YqgF family [Peptostreptococcus stomatis
           DSM 17678]
          Length = 138

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 50/137 (36%), Positives = 72/137 (52%), Gaps = 1/137 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  I  +D+G   IG+A+SD     A     + R         L   I    +   + GL
Sbjct: 3   SGRIMGLDIGDNTIGVAVSDLMGMTAQGITTIKRSSKKNDIEALKKIIEERQVNLIVSGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMNG+ GP+      F   +I  ++ +   FWDERLTTVSA+++LI+ +V RK R + 
Sbjct: 63  PKNMNGTIGPQAEKVIKFCD-LIKEELGMEIKFWDERLTTVSAEKMLIEGDVRRKNRKKV 121

Query: 136 VDSIAAALILQEVLDRI 152
           +D +AA LILQ  LD I
Sbjct: 122 IDKLAAVLILQGYLDSI 138


>gi|240145916|ref|ZP_04744517.1| putative holliday junction resolvase [Roseburia intestinalis L1-82]
 gi|257201981|gb|EEV00266.1| putative holliday junction resolvase [Roseburia intestinalis L1-82]
 gi|291535170|emb|CBL08282.1| conserved hypothetical protein TIGR00250 [Roseburia intestinalis
           M50/1]
          Length = 144

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 48/141 (34%), Positives = 74/141 (52%), Gaps = 4/141 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVR---KKVTQTALELLSFITTENIAAFII 73
             I  +D G+K +G+A+SD     A     + R    K+ QT   + + I    +   ++
Sbjct: 1   MRILGLDFGSKTVGVAVSDELLLTAQGLEIIRRQSPNKLRQTLARIEAIIAEYQVECIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN +EG R   T+ F    ++R+  +  + WDERLTTVSA + +++  + R+ R 
Sbjct: 61  GYPKNMNNTEGERCEKTKEFQEM-LERRTGLEVILWDERLTTVSADKHMMESGIRREDRK 119

Query: 134 QKVDSIAAALILQEVLDRISF 154
           + VD IAA  ILQ  LD  S 
Sbjct: 120 KYVDEIAAVFILQGYLDYRSM 140


>gi|188587786|ref|YP_001920521.1| Holliday junction resolvase-like protein [Clostridium botulinum E3
           str. Alaska E43]
 gi|251780381|ref|ZP_04823301.1| conserved hypothetical protein [Clostridium botulinum E1 str. 'BoNT
           E Beluga']
 gi|226725502|sp|B2V3W4|RUVX_CLOBA RecName: Full=Putative Holliday junction resolvase
 gi|188498067|gb|ACD51203.1| conserved hypothetical protein [Clostridium botulinum E3 str.
           Alaska E43]
 gi|243084696|gb|EES50586.1| conserved hypothetical protein [Clostridium botulinum E1 str. 'BoNT
           E Beluga']
          Length = 137

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 72/137 (52%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +DLG K IG+AISDP    A     + R    +   EL        +   +IGLP
Sbjct: 1   MRILGLDLGKKTIGVAISDPLGFTAQGITTIRRANKEKDMEELRKICDEYKVETIVIGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP           + +  + +   FWDERLTTV+A + +++ ++SR KR + V
Sbjct: 61  KNMNGTIGPSGEIAMEMGKLV-EEALNIKVEFWDERLTTVAAHKAMLEADLSRSKRKKIV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D +A+  ILQ  LDRIS
Sbjct: 120 DKVASTYILQGYLDRIS 136


>gi|258543587|ref|YP_003189020.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634665|dbj|BAI00641.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-01]
 gi|256637721|dbj|BAI03690.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-03]
 gi|256640775|dbj|BAI06737.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-07]
 gi|256643830|dbj|BAI09785.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646885|dbj|BAI12833.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649938|dbj|BAI15879.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652928|dbj|BAI18862.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655982|dbj|BAI21909.1| Holliday junction resolvase YqgF [Acetobacter pasteurianus IFO
           3283-12]
          Length = 154

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 52/154 (33%), Positives = 88/154 (57%), Gaps = 2/154 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L + DLV +L  +  +  ID G K++GLA+SD  R  A P   + R K+ Q A  + 
Sbjct: 1   MTLLSLTDLVATLPRHARLLGIDPGKKQVGLALSDVSRMVASPFQTVKRGKLGQMASFIR 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                  I   ++G+PL+++GS GP   ++R +    +  +  +P   WDERL++ +  +
Sbjct: 61  DLAKEHEIGGMVVGIPLSLDGSFGPAAQASRDWA-LALSEQTGLPVCQWDERLSSSAVNR 119

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
           +LI + ++SR +R + VD +AAA ILQ  LD + 
Sbjct: 120 MLIDEADLSRARRAEMVDRLAAAYILQAALDSLP 153


>gi|251783469|ref|YP_002997774.1| Holliday junction resolvase-like protein [Streptococcus
           dysgalactiae subsp. equisimilis GGS_124]
 gi|242392101|dbj|BAH82560.1| Holliday junction resolvase-like protein [Streptococcus
           dysgalactiae subsp. equisimilis GGS_124]
 gi|322412847|gb|EFY03755.1| Holliday junction resolvase-like protein [Streptococcus
           dysgalactiae subsp. dysgalactiae ATCC 27957]
 gi|323128215|gb|ADX25512.1| Holliday junction resolvase-like protein [Streptococcus
           dysgalactiae subsp. equisimilis ATCC 12394]
          Length = 139

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 79/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +    +K       L   +    +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIKIDEEKEEFGFERLGELVKQYQVDQFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I+    +P  + DERLTTV A+++LI+  +VSR KR 
Sbjct: 61  LPKNMNNTSGPRVEASKAYGE-KIESLFSLPVHYQDERLTTVEAERMLIEQADVSRGKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|154686879|ref|YP_001422040.1| Holliday junction resolvase-like protein [Bacillus
           amyloliquefaciens FZB42]
 gi|308174438|ref|YP_003921143.1| Holliday junction resolvase [Bacillus amyloliquefaciens DSM 7]
 gi|167012691|sp|A7Z733|RUVX_BACA2 RecName: Full=Putative Holliday junction resolvase
 gi|154352730|gb|ABS74809.1| YrrK [Bacillus amyloliquefaciens FZB42]
 gi|307607302|emb|CBI43673.1| putative Holliday junction resolvase [Bacillus amyloliquefaciens
           DSM 7]
          Length = 138

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 49/139 (35%), Positives = 79/139 (56%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             I  +DLGTK +G+A+SD     A     +   +         L   +   N+   ++G
Sbjct: 1   MRILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLDRLSELMKDYNVEKIVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P NMNG+ GPR  +++ F   +++    VP V WDERLTT++A+++LI  +VSR+KR +
Sbjct: 61  FPKNMNGTIGPRGEASQTFAK-LLETAYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKK 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LD ++
Sbjct: 120 VIDKMAAVMILQGYLDSLN 138


>gi|30022462|ref|NP_834093.1| Holliday junction resolvase-like protein [Bacillus cereus ATCC
           14579]
 gi|218232910|ref|YP_002369196.1| Holliday junction resolvase-like protein [Bacillus cereus B4264]
 gi|228923138|ref|ZP_04086429.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|229071895|ref|ZP_04205106.1| Holliday junction resolvase [Bacillus cereus F65185]
 gi|229111859|ref|ZP_04241405.1| Holliday junction resolvase [Bacillus cereus Rock1-15]
 gi|229129667|ref|ZP_04258635.1| Holliday junction resolvase [Bacillus cereus BDRD-Cer4]
 gi|229146957|ref|ZP_04275321.1| Holliday junction resolvase [Bacillus cereus BDRD-ST24]
 gi|229152590|ref|ZP_04280779.1| Holliday junction resolvase [Bacillus cereus m1550]
 gi|33301594|sp|Q812R9|RUVX_BACCR RecName: Full=Putative Holliday junction resolvase
 gi|226725486|sp|B7HE21|RUVX_BACC4 RecName: Full=Putative Holliday junction resolvase
 gi|29898020|gb|AAP11294.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579]
 gi|218160867|gb|ACK60859.1| conserved hypothetical protein TIGR00250 [Bacillus cereus B4264]
 gi|228630851|gb|EEK87491.1| Holliday junction resolvase [Bacillus cereus m1550]
 gi|228636556|gb|EEK93022.1| Holliday junction resolvase [Bacillus cereus BDRD-ST24]
 gi|228653784|gb|EEL09654.1| Holliday junction resolvase [Bacillus cereus BDRD-Cer4]
 gi|228671615|gb|EEL26913.1| Holliday junction resolvase [Bacillus cereus Rock1-15]
 gi|228711191|gb|EEL63155.1| Holliday junction resolvase [Bacillus cereus F65185]
 gi|228836517|gb|EEM81867.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 137

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 77/137 (56%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+GTK +G+AISD     A     +    ++       +   +   N+   ++G
Sbjct: 1   MRILGLDVGTKTVGVAISDEMGWTAQGLETIKINEERGHFGFDRISELVKQYNVDKIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ GPR  + + F    +   + +  V WDERL+T++A+++LI  +VSRKKR Q
Sbjct: 61  LPKNMNGTIGPRGEACQQFAE-NLRELLQLDVVMWDERLSTMAAERLLISADVSRKKRKQ 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LDR
Sbjct: 120 VIDKMAAVVILQGFLDR 136


>gi|160895347|ref|ZP_02076118.1| hypothetical protein CLOL250_02906 [Clostridium sp. L2-50]
 gi|156863040|gb|EDO56471.1| hypothetical protein CLOL250_02906 [Clostridium sp. L2-50]
          Length = 165

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 54/144 (37%), Positives = 78/144 (54%), Gaps = 4/144 (2%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAA 70
             N  I  +D GTK +G+A+SD     A P   + RK   K+ QT   + S I       
Sbjct: 18  DKNMRIIGLDYGTKTVGVAVSDALMITAQPLETIERKSANKLRQTLARIESIIEEYQAER 77

Query: 71  FIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRK 130
            ++G P NMN + G R  +T  F    ++R+  +  + WDERL+TV A++IL+D  V R+
Sbjct: 78  IVLGYPKNMNNTIGERAEATEQF-KEDLERRTGLEVILWDERLSTVEAERILMDTGVRRE 136

Query: 131 KRIQKVDSIAAALILQEVLDRISF 154
            R Q VD +AAA+ILQ  LD  + 
Sbjct: 137 NRKQYVDKMAAAVILQNYLDSQAH 160


>gi|218680912|ref|ZP_03528809.1| Holliday junction resolvase YqgF [Rhizobium etli CIAT 894]
          Length = 144

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 82/145 (56%), Positives = 110/145 (75%), Gaps = 1/145 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++L IE++  +L P Q IA +DLGTK IGL++SD GRRFA PRP + R K T  A  LL
Sbjct: 1   MTVLTIEEMAGTLAPRQAIAGLDLGTKTIGLSMSDLGRRFATPRPVIRRVKFTIDAQALL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
            F   E +A FIIGLP+NM+GS GPRV +TRAFV NM ++K  +PFV+WDERL+TV+A++
Sbjct: 61  DFAAAEKVAGFIIGLPMNMDGSAGPRVQATRAFVRNM-EQKTALPFVYWDERLSTVAAER 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALIL 145
            L++M+VSR KR +++DS AA+ IL
Sbjct: 120 TLLEMDVSRAKRAERIDSAAASFIL 144


>gi|210610063|ref|ZP_03288242.1| hypothetical protein CLONEX_00428 [Clostridium nexile DSM 1787]
 gi|210152674|gb|EEA83680.1| hypothetical protein CLONEX_00428 [Clostridium nexile DSM 1787]
          Length = 143

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 48/144 (33%), Positives = 74/144 (51%), Gaps = 4/144 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             +  +D G+K +G+AISDP    A     + RK   K+ QT   +   +    +   ++
Sbjct: 1   MRVMGLDYGSKTVGVAISDPLGITAQGIETIHRKAENKLRQTLARIEELVKEYEVDKLVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P +MN + G R   +      M++R+  +P + WDERLTT+ A++ LI+  V R+ R 
Sbjct: 61  GFPKHMNNTIGDRAEKSLEL-KAMLERRTGLPVIMWDERLTTLEAERTLIESKVRREDRK 119

Query: 134 QKVDSIAAALILQEVLDRISFLES 157
           + VD IAA  ILQ  LD I     
Sbjct: 120 KYVDKIAAVFILQGYLDSIRMNHE 143


>gi|327467925|gb|EGF13415.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK330]
          Length = 139

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 79/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +    +K       L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEEKGEFGLERLGELVKEYKVDKFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I     +P  + DERLTTV+A+++L++  +VSR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGQ-RIAELFGLPVDYQDERLTTVAAERMLVEQADVSRSKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|329938947|ref|ZP_08288321.1| Holliday junction resolvase subunit [Streptomyces griseoaurantiacus
           M045]
 gi|329301832|gb|EGG45725.1| Holliday junction resolvase subunit [Streptomyces griseoaurantiacus
           M045]
          Length = 154

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/146 (31%), Positives = 63/146 (43%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 +ID+G  RIG+A  DP    A P   +  + V      L   +        ++G
Sbjct: 2   RRGRRLAIDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLKQLVEEYEPIEVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EGP     R F   +      VP    DER+TTV+A Q L    V  KK   
Sbjct: 62  LPRSLKGGEGPAAVKVRGFAQELAGLIAPVPVRLLDERMTTVTASQGLRASGVKSKKGRS 121

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            +D  AA +ILQ+ L+      SS G
Sbjct: 122 VIDQAAAVIILQQALESERVSGSSPG 147


>gi|291559331|emb|CBL38131.1| conserved hypothetical protein TIGR00250 [butyrate-producing
           bacterium SSC/2]
          Length = 139

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 47/140 (33%), Positives = 81/140 (57%), Gaps = 4/140 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFI 72
            + I  +D GTK +G+A+SD     A P   + RK   K+ +T   +   +   ++   +
Sbjct: 1   MRRILGLDYGTKTVGVALSDELHITAQPLETITRKDANKLRKTYARIEELVKEYDVEKIV 60

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLP NMN + G R   T +F  + + R+  +  + WDERLTTV+++++L++  V R+ R
Sbjct: 61  LGLPKNMNNTVGERGEDTLSF-RDALVRRTGLEVILWDERLTTVASEKVLMESGVRRENR 119

Query: 133 IQKVDSIAAALILQEVLDRI 152
            + +D IAA++ILQ  LD +
Sbjct: 120 KKVIDQIAASMILQGYLDSL 139


>gi|148259884|ref|YP_001234011.1| Holliday junction resolvase YqgF [Acidiphilium cryptum JF-5]
 gi|167012685|sp|A5FWW0|RUVX_ACICJ RecName: Full=Putative Holliday junction resolvase
 gi|146401565|gb|ABQ30092.1| Holliday junction resolvase YqgF [Acidiphilium cryptum JF-5]
          Length = 158

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 58/154 (37%), Positives = 91/154 (59%), Gaps = 1/154 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++  + DL  +L  N  +  +D G+K IG+A+SD GRR A P   + R K+ + A  +L
Sbjct: 1   MTLFNLTDLASTLPRNARLIGLDPGSKIIGIALSDVGRRLATPYGAMKRGKLAEAAATIL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                E  AA IIGLPL+M+GS GP   + R +  + I R+  +P    DERL++ +  +
Sbjct: 61  DIARKEGAAALIIGLPLSMDGSIGPAAQAARDWA-HAIARETGLPVAMMDERLSSAAVNR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISF 154
            LI+ +V+R KR  +VD+ AA+ +LQ  LD ++ 
Sbjct: 120 ALIEADVTRAKRAGRVDAAAASYMLQGALDLLNE 153


>gi|291522741|emb|CBK81034.1| conserved hypothetical protein TIGR00250 [Coprococcus catus GD/7]
          Length = 155

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 49/147 (33%), Positives = 78/147 (53%), Gaps = 4/147 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSF---ITTENIAAFI 72
            + I  +D G+K +G+A+SDP    A     + RK   +           I        +
Sbjct: 2   KKRIIGLDYGSKTVGVAVSDPLGFTAQGLETITRKDENKLRKTYARIEALIREYEAEQIV 61

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +G P NMN +EG RV  T AF    ++R+  +  + WDER++TV+++++L++ NV R+ R
Sbjct: 62  LGYPKNMNDTEGERVEKTLAF-KEALERRTGLEVILWDERMSTVASERVLMEGNVRREDR 120

Query: 133 IQKVDSIAAALILQEVLDRISFLESSK 159
              +D +AAA ILQ  LD  SF E+  
Sbjct: 121 KTYIDKMAAAFILQGYLDYQSFSENQA 147


>gi|307292653|ref|ZP_07572499.1| Holliday junction resolvase YqgF [Sphingobium chlorophenolicum L-1]
 gi|306880719|gb|EFN11935.1| Holliday junction resolvase YqgF [Sphingobium chlorophenolicum L-1]
          Length = 156

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 55/154 (35%), Positives = 92/154 (59%), Gaps = 4/154 (2%)

Query: 1   MSILLIED--LVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE 58
           MS+L  +     ++L     +  +D+GTK IGLA+ D G   A P   + R K ++  + 
Sbjct: 1   MSLLTADRALFREALPHGGRLIGLDVGTKTIGLALCDAGWSIASPAHTVSRGKFSKDKIA 60

Query: 59  LLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSA 118
           L +F+  + +   +IGLPLN++GSE PR  ++RAF  N+ D  + +P +FWDER +T + 
Sbjct: 61  LAAFMEQQQVKGVVIGLPLNLDGSESPRSQASRAFGRNIAD--LGLPILFWDERWSTQAV 118

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRI 152
            + L++ + SR +R + VD +AA+ ILQ  +D +
Sbjct: 119 TRTLLEADASRARREELVDKLAASYILQGAIDGL 152


>gi|327439564|dbj|BAK15929.1| predicted endonuclease [Solibacillus silvestris StLB046]
          Length = 138

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 45/139 (32%), Positives = 77/139 (55%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISD     A     +   +         +   +   N+  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDALGWTAQGIETIKIDEAAGEFGIERINELVKEHNVTEFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P NMN + GPR  ++ ++   +++     P   WDER+TT++A+++LI+ +VSRKKR Q
Sbjct: 61  YPKNMNNTIGPRGEASESY-KKLLEDTFGFPVKLWDERMTTMAAERMLIEADVSRKKRKQ 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LD  +
Sbjct: 120 VIDKMAAVMILQGYLDSKN 138


>gi|325262832|ref|ZP_08129568.1| putative Holliday junction resolvase [Clostridium sp. D5]
 gi|324031926|gb|EGB93205.1| putative Holliday junction resolvase [Clostridium sp. D5]
          Length = 148

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 50/147 (34%), Positives = 78/147 (53%), Gaps = 5/147 (3%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D GTK +G+AISD     A     + RK   K+ +T   +   ++   +   ++
Sbjct: 1   MRIMGLDYGTKTVGVAISDALGFTAQGIETIQRKEENKLRRTLARIEELVSEYEVEKIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P +MN   G R   +  F  +M+ R+  +  + WDERLTTV A++ LI+ NV R+ R 
Sbjct: 61  GFPKHMNNDIGERAEKSLEF-RDMLVRRTGLEVIMWDERLTTVEAERTLIESNVRRENRK 119

Query: 134 QKVDSIAAALILQEVLDRISFLESSKG 160
           + +D IAA  ILQ  LD + +L+   G
Sbjct: 120 KYIDKIAAIFILQGYLDSV-YLQRQAG 145


>gi|320109161|ref|YP_004184751.1| Holliday junction resolvase YqgF [Terriglobus saanensis SP1PR4]
 gi|319927682|gb|ADV84757.1| Holliday junction resolvase YqgF [Terriglobus saanensis SP1PR4]
          Length = 157

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 45/133 (33%), Positives = 66/133 (49%), Gaps = 1/133 (0%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPL 77
            I  +D+G +RIG+AISD     A P   L R    +    +          A + GLPL
Sbjct: 13  RIMGLDIGDRRIGVAISDGLGLTAQPVFTLHRSNPREDIRSIARLTRKHEATAIVAGLPL 72

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           +M+G   P+   ++AF    + ++  +P  FWDERLT+ +A +IL         R   +D
Sbjct: 73  HMSGDLSPQAQKSQAFAQ-ELAKRTGLPLYFWDERLTSHAAHEILDVSGFGTTGRKAVID 131

Query: 138 SIAAALILQEVLD 150
            +AA LILQ  LD
Sbjct: 132 QVAAVLILQGFLD 144


>gi|88607507|ref|YP_504940.1| hypothetical protein APH_0332 [Anaplasma phagocytophilum HZ]
 gi|146325550|sp|Q2GL11|RUVX_ANAPZ RecName: Full=Putative Holliday junction resolvase
 gi|88598570|gb|ABD44040.1| conserved hypothetical protein TIGR00250 [Anaplasma phagocytophilum
           HZ]
          Length = 166

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 53/150 (35%), Positives = 79/150 (52%), Gaps = 1/150 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    I +L  +L+P + I  ID G ++IGLA+SDP    A P     R+ + Q   EL 
Sbjct: 1   MLCESIRELFSALEPGRRILGIDFGERKIGLALSDPTYLIAIPHSVYHRRNMRQDLGELS 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + + +E+ A  ++G PL  +G EG      RAF   +I +   V     DER TT  A +
Sbjct: 61  AVLRSEDAAVVVMGNPLQSDGLEGEMCQIVRAFAQKLIKK-SGVSIYLHDERYTTAMASR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLD 150
              +  + RK+  +  D I+AAL+LQ+VLD
Sbjct: 120 ATREAGLRRKESQKIDDKISAALVLQQVLD 149


>gi|47566574|ref|ZP_00237396.1| conserved hypothetical protein protein TIGR00250 [Bacillus cereus
           G9241]
 gi|206969800|ref|ZP_03230754.1| conserved hypothetical protein TIGR00250 [Bacillus cereus AH1134]
 gi|228941554|ref|ZP_04104103.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228954671|ref|ZP_04116694.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228960658|ref|ZP_04122303.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228974484|ref|ZP_04135051.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228981078|ref|ZP_04141379.1| Holliday junction resolvase [Bacillus thuringiensis Bt407]
 gi|228987638|ref|ZP_04147752.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229048094|ref|ZP_04193667.1| Holliday junction resolvase [Bacillus cereus AH676]
 gi|229081651|ref|ZP_04214146.1| Holliday junction resolvase [Bacillus cereus Rock4-2]
 gi|229180662|ref|ZP_04308002.1| Holliday junction resolvase [Bacillus cereus 172560W]
 gi|229192598|ref|ZP_04319559.1| Holliday junction resolvase [Bacillus cereus ATCC 10876]
 gi|296504877|ref|YP_003666577.1| Holliday junction resolvase-like protein [Bacillus thuringiensis
           BMB171]
 gi|47556604|gb|EAL14936.1| conserved hypothetical protein protein TIGR00250 [Bacillus cereus
           G9241]
 gi|206735488|gb|EDZ52656.1| conserved hypothetical protein TIGR00250 [Bacillus cereus AH1134]
 gi|228590905|gb|EEK48763.1| Holliday junction resolvase [Bacillus cereus ATCC 10876]
 gi|228602807|gb|EEK60288.1| Holliday junction resolvase [Bacillus cereus 172560W]
 gi|228701655|gb|EEL54146.1| Holliday junction resolvase [Bacillus cereus Rock4-2]
 gi|228723249|gb|EEL74621.1| Holliday junction resolvase [Bacillus cereus AH676]
 gi|228772098|gb|EEM20550.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228778619|gb|EEM26885.1| Holliday junction resolvase [Bacillus thuringiensis Bt407]
 gi|228785201|gb|EEM33213.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228799022|gb|EEM45994.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228804998|gb|EEM51594.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228818110|gb|EEM64186.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|296325929|gb|ADH08857.1| Holliday junction resolvase-like protein [Bacillus thuringiensis
           BMB171]
 gi|326942168|gb|AEA18064.1| Holliday junction resolvase-like protein [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 137

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 76/137 (55%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+GTK +G+AISD     A     +    ++       +   +   N+   ++G
Sbjct: 1   MRILGLDVGTKTVGVAISDEMGWTAQGLETIKINEERGHFGFDRISELVKQYNVDKIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ GPR  + + F    +   + +  V WDERL+T++A+++LI  +VSRKKR Q
Sbjct: 61  LPKNMNGTIGPRGEACQQFAE-NLRELLQLDVVMWDERLSTMAAERLLISADVSRKKRKQ 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LD 
Sbjct: 120 VIDKMAAVVILQGFLDS 136


>gi|294628345|ref|ZP_06706905.1| conserved hypothetical protein [Streptomyces sp. e14]
 gi|292831678|gb|EFF90027.1| conserved hypothetical protein [Streptomyces sp. e14]
          Length = 154

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 45/146 (30%), Positives = 62/146 (42%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 +ID+G  RIG+A  DP    A P   +  + V      L   +        ++G
Sbjct: 2   RRGRRLAIDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLRQLVEEYEPIEVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EGP     RAF   +      VP    DER+TTV+A Q L    V  KK   
Sbjct: 62  LPRSLKGGEGPAAVKVRAFAGELAKGVAPVPVRLVDERMTTVTASQGLRASGVKSKKGRS 121

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            +D  AA +ILQ+ L+         G
Sbjct: 122 VIDQAAAVIILQQALESERVSGEPPG 147


>gi|326403186|ref|YP_004283267.1| putative Holliday junction resolvase [Acidiphilium multivorum
           AIU301]
 gi|325050047|dbj|BAJ80385.1| putative Holliday junction resolvase [Acidiphilium multivorum
           AIU301]
          Length = 158

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 58/154 (37%), Positives = 91/154 (59%), Gaps = 1/154 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M++  + DL  +L  N  +  +D G+K IG+A+SD GRR A P   + R K+  +A  +L
Sbjct: 1   MTLFNLTDLASTLPRNARLIGLDPGSKIIGIALSDVGRRLATPYGAMKRGKLADSAATIL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                E  AA IIGLPL+M+GS GP   + R +  + I R+  +P    DERL++ +  +
Sbjct: 61  DIARKEGAAALIIGLPLSMDGSIGPAAQAARDWA-HAIARETGLPVAMMDERLSSAAVNR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISF 154
            LI+ +V+R KR  +VD+ AA+ +LQ  LD ++ 
Sbjct: 120 ALIEADVTRAKRAGRVDAAAASYMLQGALDLLNE 153


>gi|256847958|ref|ZP_05553402.1| Holliday junction resolvase YqgF [Lactobacillus coleohominis
           101-4-CHN]
 gi|256715018|gb|EEU29995.1| Holliday junction resolvase YqgF [Lactobacillus coleohominis
           101-4-CHN]
          Length = 146

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 49/138 (35%), Positives = 79/138 (57%), Gaps = 3/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+A SDP    A     +    +        +   +    +A F++G
Sbjct: 1   MRLLGLDVGSKTVGVAESDPLGWTAQAVEIIPIDEENEIFGIDRIAELVQARQVAGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRI 133
           LP NMN +EGPRV ++R +   +  R   +P  F DERLTTV A ++L+ + +VSR+K+ 
Sbjct: 61  LPKNMNNTEGPRVEASRHYGELLRQRFPKLPIDFQDERLTTVQAHRMLVEEADVSRRKQK 120

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA+LILQ  LDR
Sbjct: 121 KVIDELAASLILQNYLDR 138


>gi|170698781|ref|ZP_02889845.1| Holliday junction resolvase YqgF [Burkholderia ambifaria IOP40-10]
 gi|170136338|gb|EDT04602.1| Holliday junction resolvase YqgF [Burkholderia ambifaria IOP40-10]
          Length = 149

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 36/144 (25%), Positives = 69/144 (47%), Gaps = 1/144 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            +  + + D G KRIG+AI +   R A     +           +   +      A ++G
Sbjct: 7   RDATLLAFDYGEKRIGVAIGNALTRSARALVVIPNLNREHRFKAVGDLLAEWRPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+        + F +  ++ +  +P  + DER ++V A+  L + NV  + R +
Sbjct: 67  LPMHPDGTPHEMTQQAKRFGN-QLNGRFGLPVTWVDERYSSVEAEAGLRERNVRGRARAE 125

Query: 135 KVDSIAAALILQEVLDRISFLESS 158
            +D+ AA +ILQ+ LD++S  E  
Sbjct: 126 MLDAEAARVILQQYLDQLSDHEHH 149


>gi|295399319|ref|ZP_06809301.1| Holliday junction resolvase YqgF [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312110120|ref|YP_003988436.1| Holliday junction resolvase YqgF [Geobacillus sp. Y4.1MC1]
 gi|294978785|gb|EFG54381.1| Holliday junction resolvase YqgF [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311215221|gb|ADP73825.1| Holliday junction resolvase YqgF [Geobacillus sp. Y4.1MC1]
          Length = 138

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/137 (33%), Positives = 77/137 (56%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFL--VRKKVTQTALELLSFITTENIAAFIIG 74
                +DLGTK +G+A+SD     A     +    ++       L   I    +   ++G
Sbjct: 1   MRALGLDLGTKTLGVAVSDELGWTAQGIETISIDEEQGEYGLKRLREIIDEYKVDTIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P NMNG+ GPR  +++ F    ++++  +P + WDERL+T++A+++LI  +VSRKKR +
Sbjct: 61  FPKNMNGTVGPRAEASQRFAKI-LEQEFALPVILWDERLSTMAAERMLIAADVSRKKRRK 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LD 
Sbjct: 120 VIDKMAAVVILQSYLDS 136


>gi|56421089|ref|YP_148407.1| hypothetical protein GK2554 [Geobacillus kaustophilus HTA426]
 gi|261418430|ref|YP_003252112.1| Holliday junction resolvase YqgF [Geobacillus sp. Y412MC61]
 gi|297529282|ref|YP_003670557.1| Holliday junction resolvase YqgF [Geobacillus sp. C56-T3]
 gi|319767610|ref|YP_004133111.1| Holliday junction resolvase YqgF [Geobacillus sp. Y412MC52]
 gi|62900906|sp|Q5KWU7|RUVX_GEOKA RecName: Full=Putative Holliday junction resolvase
 gi|56380931|dbj|BAD76839.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
 gi|261374887|gb|ACX77630.1| Holliday junction resolvase YqgF [Geobacillus sp. Y412MC61]
 gi|297252534|gb|ADI25980.1| Holliday junction resolvase YqgF [Geobacillus sp. C56-T3]
 gi|317112476|gb|ADU94968.1| Holliday junction resolvase YqgF [Geobacillus sp. Y412MC52]
          Length = 138

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 48/139 (34%), Positives = 76/139 (54%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFL--VRKKVTQTALELLSFITTENIAAFIIG 74
                +DLGTK +G+A+SD     A     +    ++       L + I    +   ++G
Sbjct: 1   MRTLGLDLGTKTLGVAVSDELGLTAQGLETIAIDTERGDYGLKRLRAIIDEYGVDTIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P NMNG+ GPR  ++  F    +  +  +P V WDERL+T++A+++LI  +VSRKKR +
Sbjct: 61  WPKNMNGTLGPRAEASERFAA-KLREEFSLPVVLWDERLSTMAAERMLIAADVSRKKRRK 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AAA+ILQ  LD   
Sbjct: 120 VIDKMAAAVILQSYLDSKR 138


>gi|229086950|ref|ZP_04219107.1| Holliday junction resolvase [Bacillus cereus Rock3-44]
 gi|228696326|gb|EEL49154.1| Holliday junction resolvase [Bacillus cereus Rock3-44]
          Length = 137

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 46/137 (33%), Positives = 76/137 (55%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+GTK +G+AISD     A     +    ++       +   +   N+   ++G
Sbjct: 1   MRILGLDVGTKTVGVAISDEMGWTAQGLETIKINEERGIFGFDRVSELVKQYNVDKIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ GPR  + + +    +   + +  + WDERL+T++A+++LI  +VSRKKR Q
Sbjct: 61  LPKNMNGTIGPRGEACQQYAE-SLRELLQLEVILWDERLSTMAAERLLISADVSRKKRKQ 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LD 
Sbjct: 120 VIDKMAAVVILQGYLDS 136


>gi|206975936|ref|ZP_03236846.1| conserved hypothetical protein TIGR00250 [Bacillus cereus H3081.97]
 gi|217961876|ref|YP_002340446.1| Holliday junction resolvase-like protein [Bacillus cereus AH187]
 gi|222097829|ref|YP_002531886.1| holliday junction resolvase-like protein [Bacillus cereus Q1]
 gi|229141123|ref|ZP_04269665.1| Holliday junction resolvase [Bacillus cereus BDRD-ST26]
 gi|226725487|sp|B7HQE4|RUVX_BACC7 RecName: Full=Putative Holliday junction resolvase
 gi|254767497|sp|B9IYF1|RUVX_BACCQ RecName: Full=Putative Holliday junction resolvase
 gi|206745688|gb|EDZ57085.1| conserved hypothetical protein TIGR00250 [Bacillus cereus H3081.97]
 gi|217063507|gb|ACJ77757.1| conserved hypothetical protein TIGR00250 [Bacillus cereus AH187]
 gi|221241887|gb|ACM14597.1| conserved hypothetical protein [Bacillus cereus Q1]
 gi|228642401|gb|EEK98690.1| Holliday junction resolvase [Bacillus cereus BDRD-ST26]
          Length = 137

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 77/137 (56%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+GTK +G+AISD     A     +    ++       +   +   ++   ++G
Sbjct: 1   MRILGLDVGTKTVGVAISDEMGWTAQGLETIKINEERGQFGFDRISELVKQYDVDKIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ GPR  + + F    +   + +  V WDERL+T++A+++LI  +VSRKKR Q
Sbjct: 61  LPKNMNGTIGPRGEACQQFAE-NLRELLQLDVVMWDERLSTMAAERLLISADVSRKKRKQ 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LDR
Sbjct: 120 VIDKMAAVVILQGFLDR 136


>gi|294012198|ref|YP_003545658.1| putative Holliday junction resolvase [Sphingobium japonicum UT26S]
 gi|292675528|dbj|BAI97046.1| putative Holliday junction resolvase [Sphingobium japonicum UT26S]
          Length = 156

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 55/154 (35%), Positives = 92/154 (59%), Gaps = 4/154 (2%)

Query: 1   MSILLIED--LVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE 58
           MSIL  +     ++L     +  +D+GTK IG+A+ D G   A P   + R K ++  + 
Sbjct: 1   MSILTADRAAFREALPHGGRLIGLDVGTKTIGIALCDAGWSIASPAHTVSRGKFSKDKIA 60

Query: 59  LLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSA 118
           L +F+  + +   +IGLPLN++GSE PR  ++RAF  N+ D  + +P +FWDER +T + 
Sbjct: 61  LAAFMEQQQVKGVVIGLPLNLDGSESPRSQASRAFGRNIAD--LGLPILFWDERWSTQAV 118

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRI 152
            + L++ + SR +R + VD +AA+ ILQ  +D +
Sbjct: 119 TRTLLEADASRARRGELVDKLAASYILQGAIDGL 152


>gi|258515480|ref|YP_003191702.1| Holliday junction resolvase YqgF [Desulfotomaculum acetoxidans DSM
           771]
 gi|257779185|gb|ACV63079.1| Holliday junction resolvase YqgF [Desulfotomaculum acetoxidans DSM
           771]
          Length = 139

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 77/138 (55%), Gaps = 2/138 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV-TQTALELLSFITTENIAAFIIGL 75
             I  +DLG K IG+A+SDP    A     + RK    Q    L   I    +   ++GL
Sbjct: 1   MRIMCLDLGEKTIGIALSDPFGWTAQGLEIINRKGQPKQELNRLREIIKQYEVEKVVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMNG+ GP+      F+   + RK+ +    WDERL+TV+A++IL+  ++SR KR + 
Sbjct: 61  PKNMNGTTGPQAEKALDFIEY-LKRKLGLVVEAWDERLSTVAAERILLSADISRGKRKKV 119

Query: 136 VDSIAAALILQEVLDRIS 153
           +D +AAA+ILQ  LD  S
Sbjct: 120 IDKMAAAVILQGYLDAHS 137


>gi|222153870|ref|YP_002563047.1| Holliday junction resolvase [Streptococcus uberis 0140J]
 gi|254767528|sp|B9DW62|RUVX_STRU0 RecName: Full=Putative Holliday junction resolvase
 gi|222114683|emb|CAR43762.1| putative Holliday junction resolvase [Streptococcus uberis 0140J]
          Length = 139

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 82/138 (59%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +    +K +     L   +    +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIPIDEEKNSFGFERLSELVKQYQVDKFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I+   ++P V+ DERLTTV A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGK-KIEDLFHIPVVYQDERLTTVQAERMLIEQADISRGKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|148553525|ref|YP_001261107.1| Holliday junction resolvase YqgF [Sphingomonas wittichii RW1]
 gi|167016511|sp|A5V3V3|RUVX_SPHWW RecName: Full=Putative Holliday junction resolvase
 gi|148498715|gb|ABQ66969.1| Holliday junction resolvase YqgF [Sphingomonas wittichii RW1]
          Length = 151

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 53/152 (34%), Positives = 85/152 (55%), Gaps = 2/152 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M      D   +L     +A +D+GT+ IG+A+ D G   A P   ++R K +  A +L 
Sbjct: 1   MISASTLDFRDALPDRGRLAGLDVGTRTIGVALCDAGWTIASPAETILRAKFSVDAAKLR 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  + +   +IGLPLN++GS+ PR  S RAF  N+      +P + WDER +T +  +
Sbjct: 61  ALVAAQLVKGLVIGLPLNLDGSDSPRTQSVRAFARNV--EPFGLPILLWDERWSTQAVTR 118

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRI 152
            L+D + SR +R + VD +AAA ILQ  +D +
Sbjct: 119 TLLDADASRARRAELVDKLAAAYILQGAIDAM 150


>gi|319946059|ref|ZP_08020308.1| crossover junction endodeoxyribonuclease [Streptococcus australis
           ATCC 700641]
 gi|319747867|gb|EFW00112.1| crossover junction endodeoxyribonuclease [Streptococcus australis
           ATCC 700641]
          Length = 139

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 50/138 (36%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +    +K       L   +    +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIQIDEEKGEFGLDRLSELVKEYRVDRFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    ++    +P  + DERLTTV+A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGK-RLEELFNLPVEYQDERLTTVAAERMLIEQADISRNKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|163816752|ref|ZP_02208115.1| hypothetical protein COPEUT_02942 [Coprococcus eutactus ATCC 27759]
 gi|158448009|gb|EDP25004.1| hypothetical protein COPEUT_02942 [Coprococcus eutactus ATCC 27759]
          Length = 149

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 56/148 (37%), Positives = 81/148 (54%), Gaps = 11/148 (7%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAF-- 71
             +  +D GTK +G+A+SDP    A P   + RK   K+ QT   + + I     A    
Sbjct: 1   MRVLGLDYGTKTVGVAVSDPLEITAQPLETIERKSAGKLRQTLARIEAIIEEYGAAGQQE 60

Query: 72  -----IIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMN 126
                ++G P NMN +EG R  +T +F  N ++R+  +  V WDERLTTV A++IL+D  
Sbjct: 61  KIEKIVLGYPKNMNNTEGDRCEATVSF-KNDLERRTGLEVVLWDERLTTVEAERILMDSG 119

Query: 127 VSRKKRIQKVDSIAAALILQEVLDRISF 154
           V R+ R   +D +AAA+ILQ  LD  S 
Sbjct: 120 VRRENRKTYIDKMAAAVILQNYLDSKSN 147


>gi|332360144|gb|EGJ37958.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK1056]
          Length = 139

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 51/138 (36%), Positives = 79/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +    +K       L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEEKGEFGLERLSELVKEYKVDKFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I     +P  + DERLTTV+A+++L++  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGQ-RIAELFGLPVDYQDERLTTVAAERMLVEQADISRSKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|197303729|ref|ZP_03168766.1| hypothetical protein RUMLAC_02458 [Ruminococcus lactaris ATCC
           29176]
 gi|197297249|gb|EDY31812.1| hypothetical protein RUMLAC_02458 [Ruminococcus lactaris ATCC
           29176]
          Length = 148

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 53/147 (36%), Positives = 78/147 (53%), Gaps = 4/147 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D GTK +G+AISD  +  A     + RK   K+ +T   +   I    +   ++
Sbjct: 1   MRIMGLDYGTKTVGVAISDALKITAQGIETIQRKEENKLRKTCARIEQLIKEYEVEKIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P +MN   G R   +  F   M++R+  +  V WDERLTTV+A++ LI+ +V R+ R 
Sbjct: 61  GFPKHMNNDVGERAEKSLEF-KAMLERRTGLEVVMWDERLTTVAAERTLIESSVRRENRK 119

Query: 134 QKVDSIAAALILQEVLDRISFLESSKG 160
           Q VD IAA  ILQ  LD +S    + G
Sbjct: 120 QYVDKIAAVFILQGYLDLLSMRNGADG 146


>gi|326791231|ref|YP_004309052.1| Holliday junction resolvase [Clostridium lentocellum DSM 5427]
 gi|326541995|gb|ADZ83854.1| Holliday junction resolvase [Clostridium lentocellum DSM 5427]
          Length = 139

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 50/137 (36%), Positives = 75/137 (54%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQ---TALELLSFITTENIAAFII 73
             I  +D GTK  G+AISDP    A     + R++      T   +    T   +   ++
Sbjct: 1   MRILGLDFGTKTTGVAISDPMGWTAQGLEIIRRQEDEHLKATMKRIEEICTAYKVEKIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NMN + G R   T  F    ++ K+ +P   WDERL+TV+A+Q+L++ ++SRKKR 
Sbjct: 61  GLPKNMNNTLGERGEKTLLF-KEKLENKLKIPVETWDERLSTVAAEQVLLEADMSRKKRK 119

Query: 134 QKVDSIAAALILQEVLD 150
             +D +AA +ILQ  LD
Sbjct: 120 NVIDKLAATIILQNYLD 136


>gi|94497357|ref|ZP_01303928.1| endonuclease [Sphingomonas sp. SKA58]
 gi|94423220|gb|EAT08250.1| endonuclease [Sphingomonas sp. SKA58]
          Length = 169

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 53/154 (34%), Positives = 90/154 (58%), Gaps = 4/154 (2%)

Query: 1   MSILLIED--LVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE 58
           M+++ I+     ++L     +  +D+GTK IGLA+ D     A P   + R K  +  + 
Sbjct: 13  MTLVTIDRVAFRQALPHGGRLIGMDVGTKTIGLALCDAAWTIASPAYTVTRGKFGKDKIG 72

Query: 59  LLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSA 118
           L +FI  + +   +IGLPLN++GS  PR  ++RAF HN+ D  + +P + WDER +T + 
Sbjct: 73  LAAFIDQQQVKGVVIGLPLNLDGSFSPRAQASRAFAHNIAD--LGLPILLWDERWSTQAV 130

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRI 152
            + L++ + SR +R + VD +AA+ ILQ  +D +
Sbjct: 131 TRTLLEADASRARRDELVDKLAASYILQGAIDGL 164


>gi|229198513|ref|ZP_04325217.1| Holliday junction resolvase [Bacillus cereus m1293]
 gi|228585016|gb|EEK43130.1| Holliday junction resolvase [Bacillus cereus m1293]
          Length = 137

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 76/137 (55%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+GTK +G+AISD     A     +    ++       +   +   ++   ++G
Sbjct: 1   MRILGLDVGTKTVGVAISDEMGWTAQGLETIKINEERGHFGFDRISELVKQYDVDKIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ GPR  + + F    +   + +  V WDERL+T++A+++LI  +VSRKKR Q
Sbjct: 61  LPKNMNGTIGPRGEACQQFAE-NLRELLQLDVVMWDERLSTMAAERLLISADVSRKKRKQ 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LD 
Sbjct: 120 VIDKMAAVVILQGFLDS 136


>gi|332186801|ref|ZP_08388543.1| uncharacterized family protein [Sphingomonas sp. S17]
 gi|332013134|gb|EGI55197.1| uncharacterized family protein [Sphingomonas sp. S17]
          Length = 154

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 58/154 (37%), Positives = 91/154 (59%), Gaps = 5/154 (3%)

Query: 1   MSILLIED--LVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALE 58
           MS++  +      +L     +  +D+GTK IG A+ D G  FA P   + R K T+    
Sbjct: 1   MSLITTDRSAFRDALPSGGRLIGLDVGTKTIGTALCDAGWSFASPATLVRRTKFTKDKEA 60

Query: 59  LLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSA 118
           L++ I  + +   +IGLPLN++GSE PR  STRAF  N  D     P + WDER +TV+ 
Sbjct: 61  LIAMIAQQGVKGLVIGLPLNLDGSESPRSQSTRAFARNCADL---GPILLWDERWSTVAV 117

Query: 119 QQILIDMNVSRKKRIQKVDSIAAALILQEVLDRI 152
           ++ +I+ ++SR KR +++D++AAA ILQ  +D +
Sbjct: 118 ERTMIEQDMSRAKRAERIDNLAAAHILQAAIDAL 151


>gi|323350688|ref|ZP_08086349.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           VMC66]
 gi|322123108|gb|EFX94799.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           VMC66]
 gi|325686737|gb|EGD28763.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK72]
 gi|332363719|gb|EGJ41499.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK49]
 gi|332365296|gb|EGJ43059.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK1059]
          Length = 139

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 50/138 (36%), Positives = 79/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +    +K       L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEEKGEFGLERLGELVKEYKVDKFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+   +      +P  + DERLTTV+A+++L++  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGQRV-SELFGLPVDYQDERLTTVAAERMLVEQADISRSKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|30264456|ref|NP_846833.1| Holliday junction resolvase-like protein [Bacillus anthracis str.
           Ames]
 gi|42783515|ref|NP_980762.1| Holliday junction resolvase-like protein [Bacillus cereus ATCC
           10987]
 gi|47529912|ref|YP_021261.1| Holliday junction resolvase-like protein [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49187278|ref|YP_030530.1| Holliday junction resolvase-like protein [Bacillus anthracis str.
           Sterne]
 gi|49478623|ref|YP_038437.1| Holliday junction resolvase-like protein [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|52141120|ref|YP_085709.1| Holliday junction resolvase-like protein [Bacillus cereus E33L]
 gi|65321754|ref|ZP_00394713.1| COG0816: Predicted endonuclease involved in recombination (possible
           Holliday junction resolvase in Mycoplasmas and B.
           subtilis) [Bacillus anthracis str. A2012]
 gi|118479548|ref|YP_896699.1| Holliday junction resolvase-like protein [Bacillus thuringiensis
           str. Al Hakam]
 gi|165872754|ref|ZP_02217382.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           A0488]
 gi|167638500|ref|ZP_02396776.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           A0193]
 gi|177653215|ref|ZP_02935467.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           A0174]
 gi|190566960|ref|ZP_03019876.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis
           Tsiankovskii-I]
 gi|196034479|ref|ZP_03101888.1| conserved hypothetical protein TIGR00250 [Bacillus cereus W]
 gi|196039375|ref|ZP_03106681.1| conserved hypothetical protein TIGR00250 [Bacillus cereus
           NVH0597-99]
 gi|196044968|ref|ZP_03112202.1| conserved hypothetical protein TIGR00250 [Bacillus cereus 03BB108]
 gi|218905581|ref|YP_002453415.1| conserved hypothetical protein TIGR00250 [Bacillus cereus AH820]
 gi|225866368|ref|YP_002751746.1| conserved hypothetical protein TIGR00250 [Bacillus cereus 03BB102]
 gi|227817165|ref|YP_002817174.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           CDC 684]
 gi|228917020|ref|ZP_04080580.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228929431|ref|ZP_04092452.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228935707|ref|ZP_04098520.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228948100|ref|ZP_04110384.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229093457|ref|ZP_04224560.1| Holliday junction resolvase [Bacillus cereus Rock3-42]
 gi|229123927|ref|ZP_04253119.1| Holliday junction resolvase [Bacillus cereus 95/8201]
 gi|229158002|ref|ZP_04286073.1| Holliday junction resolvase [Bacillus cereus ATCC 4342]
 gi|229186626|ref|ZP_04313787.1| Holliday junction resolvase [Bacillus cereus BGSC 6E1]
 gi|229603692|ref|YP_002868674.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           A0248]
 gi|254684142|ref|ZP_05148002.1| Holliday junction resolvase-like protein [Bacillus anthracis str.
           CNEVA-9066]
 gi|254724687|ref|ZP_05186470.1| Holliday junction resolvase-like protein [Bacillus anthracis str.
           A1055]
 gi|254736489|ref|ZP_05194195.1| Holliday junction resolvase-like protein [Bacillus anthracis str.
           Western North America USA6153]
 gi|254741527|ref|ZP_05199214.1| Holliday junction resolvase-like protein [Bacillus anthracis str.
           Kruger B]
 gi|254757706|ref|ZP_05209733.1| Holliday junction resolvase-like protein [Bacillus anthracis str.
           Australia 94]
 gi|300119207|ref|ZP_07056904.1| Holliday junction resolvase-like protein [Bacillus cereus SJ1]
 gi|301055895|ref|YP_003794106.1| holliday junction resolvase-like protein [Bacillus anthracis CI]
 gi|33301603|sp|Q81LK2|RUVX_BACAN RecName: Full=Putative Holliday junction resolvase
 gi|62900956|sp|Q634F8|RUVX_BACCZ RecName: Full=Putative Holliday junction resolvase
 gi|62900978|sp|Q6HDD9|RUVX_BACHK RecName: Full=Putative Holliday junction resolvase
 gi|62900993|sp|Q730E7|RUVX_BACC1 RecName: Full=Putative Holliday junction resolvase
 gi|167012692|sp|A0RIZ9|RUVX_BACAH RecName: Full=Putative Holliday junction resolvase
 gi|226725484|sp|B7JPX2|RUVX_BACC0 RecName: Full=Putative Holliday junction resolvase
 gi|254767494|sp|C3P975|RUVX_BACAA RecName: Full=Putative Holliday junction resolvase
 gi|254767495|sp|C3L5Z2|RUVX_BACAC RecName: Full=Putative Holliday junction resolvase
 gi|254767496|sp|C1EST1|RUVX_BACC3 RecName: Full=Putative Holliday junction resolvase
 gi|30259114|gb|AAP28319.1| RNAse H-fold protein YqgF [Bacillus anthracis str. Ames]
 gi|42739444|gb|AAS43370.1| conserved hypothetical protein TIGR00250 [Bacillus cereus ATCC
           10987]
 gi|47505060|gb|AAT33736.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49181205|gb|AAT56581.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           Sterne]
 gi|49330179|gb|AAT60825.1| conserved hypothetical protein, possible Holliday junction
           resolvase [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|51974589|gb|AAU16139.1| conserved hypothetical protein; possible Holliday junction
           resolvase [Bacillus cereus E33L]
 gi|118418773|gb|ABK87192.1| conserved hypothetical protein [Bacillus thuringiensis str. Al
           Hakam]
 gi|164711530|gb|EDR17079.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           A0488]
 gi|167513348|gb|EDR88718.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           A0193]
 gi|172081497|gb|EDT66569.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           A0174]
 gi|190561951|gb|EDV15920.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis
           Tsiankovskii-I]
 gi|195993021|gb|EDX56980.1| conserved hypothetical protein TIGR00250 [Bacillus cereus W]
 gi|196024456|gb|EDX63129.1| conserved hypothetical protein TIGR00250 [Bacillus cereus 03BB108]
 gi|196030002|gb|EDX68603.1| conserved hypothetical protein TIGR00250 [Bacillus cereus
           NVH0597-99]
 gi|218535867|gb|ACK88265.1| conserved hypothetical protein TIGR00250 [Bacillus cereus AH820]
 gi|225789273|gb|ACO29490.1| conserved hypothetical protein TIGR00250 [Bacillus cereus 03BB102]
 gi|227007492|gb|ACP17235.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           CDC 684]
 gi|228596885|gb|EEK54544.1| Holliday junction resolvase [Bacillus cereus BGSC 6E1]
 gi|228625455|gb|EEK82211.1| Holliday junction resolvase [Bacillus cereus ATCC 4342]
 gi|228659229|gb|EEL14877.1| Holliday junction resolvase [Bacillus cereus 95/8201]
 gi|228689928|gb|EEL43732.1| Holliday junction resolvase [Bacillus cereus Rock3-42]
 gi|228811458|gb|EEM57795.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228823945|gb|EEM69764.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228830219|gb|EEM75835.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228842627|gb|EEM87715.1| Holliday junction resolvase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|229268100|gb|ACQ49737.1| conserved hypothetical protein TIGR00250 [Bacillus anthracis str.
           A0248]
 gi|298723427|gb|EFI64172.1| Holliday junction resolvase-like protein [Bacillus cereus SJ1]
 gi|300378064|gb|ADK06968.1| holliday junction resolvase-like protein [Bacillus cereus biovar
           anthracis str. CI]
 gi|324328290|gb|ADY23550.1| Holliday junction resolvase-like protein [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 137

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 76/137 (55%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+GTK +G+AISD     A     +    ++       +   +   ++   ++G
Sbjct: 1   MRILGLDVGTKTVGVAISDEMGWTAQGLETIKINEERGQFGFDRISELVKQYDVDKIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ GPR  + + F    +   + +  V WDERL+T++A+++LI  +VSRKKR Q
Sbjct: 61  LPKNMNGTIGPRGEACQQFAE-NLRELLQLDVVMWDERLSTMAAERLLISADVSRKKRKQ 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LD 
Sbjct: 120 VIDKMAAVVILQGFLDS 136


>gi|153812697|ref|ZP_01965365.1| hypothetical protein RUMOBE_03104 [Ruminococcus obeum ATCC 29174]
 gi|149831213|gb|EDM86302.1| hypothetical protein RUMOBE_03104 [Ruminococcus obeum ATCC 29174]
          Length = 140

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 46/139 (33%), Positives = 72/139 (51%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+K +G+A+SDP    A     + RK   K+ +T  ++   +    I   ++
Sbjct: 1   MRILGLDYGSKTVGVAVSDPLGVTAQRLETIWRKQENKLRRTLAQVEELVKEYEIEKIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN + G R      F    + ++  +  + WDERLTTVSA + L++  V R+ R 
Sbjct: 61  GYPKNMNNTVGERAEKALEFGEM-LKKRTGLEVIMWDERLTTVSADRALMEAGVRRENRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D IAA  ILQ  LD +
Sbjct: 120 EYLDGIAAVFILQGYLDSL 138


>gi|328554357|gb|AEB24849.1| Holliday junction resolvase-like protein [Bacillus
           amyloliquefaciens TA208]
 gi|328912761|gb|AEB64357.1| Putative Holliday junction resolvase [Bacillus amyloliquefaciens
           LL3]
          Length = 138

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 49/139 (35%), Positives = 79/139 (56%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             I  +DLGTK +G+A+SD     A     +   +         L   +   N+   ++G
Sbjct: 1   MRILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLDRLSELMKDYNVEKIVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P NMNG+ GPR  +++ F   +++    VP V WDERLTT++A+++LI  +VSR+KR +
Sbjct: 61  FPKNMNGTIGPRGEASQTFAK-LLETAYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKK 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LD ++
Sbjct: 120 VIDKMAAVMILQGFLDSLN 138


>gi|125719019|ref|YP_001036152.1| Holliday junction resolvase-like protein [Streptococcus sanguinis
           SK36]
 gi|167016514|sp|A3CQZ7|RUVX_STRSV RecName: Full=Putative Holliday junction resolvase
 gi|125498936|gb|ABN45602.1| Holliday junction resolvase, putative [Streptococcus sanguinis
           SK36]
          Length = 139

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 51/138 (36%), Positives = 79/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +    +K       L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEEKGEFGLERLGELVKEYKVDKFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I     +P  + DERLTTV+A+++L++  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGQ-RIAELFGLPVDYQDERLTTVAAERMLVEQADISRSKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|323142335|ref|ZP_08077167.1| RNAse H domain protein, YqgF family [Phascolarctobacterium sp. YIT
           12067]
 gi|322413219|gb|EFY04106.1| RNAse H domain protein, YqgF family [Phascolarctobacterium sp. YIT
           12067]
          Length = 140

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 47/138 (34%), Positives = 74/138 (53%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
               S+D+GT+ IG+A+SD     A+    + R    +    +   I    +   ++G P
Sbjct: 1   MRKMSLDVGTRTIGIAVSDLLGMIANGVETIHRTTEERDYARIAELIAEHEVDTLVVGYP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ G R  +  A    +      V  V WDERL+TV+A+++L+D ++ RKKR + +
Sbjct: 61  KNMNGTIGERAQACEAMAEKLRTMFPKVQVVLWDERLSTVAAEKVLVDADLRRKKRKKVI 120

Query: 137 DSIAAALILQEVLDRISF 154
           D +AA +ILQ  LD  SF
Sbjct: 121 DMMAAVVILQNYLDSKSF 138


>gi|291539698|emb|CBL12809.1| conserved hypothetical protein TIGR00250 [Roseburia intestinalis
           XB6B4]
          Length = 144

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 49/141 (34%), Positives = 74/141 (52%), Gaps = 4/141 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVR---KKVTQTALELLSFITTENIAAFII 73
             I  +D G+K +GLA+SD     A     + R    K+ QT   + + I    +   ++
Sbjct: 1   MRILGLDFGSKTVGLAVSDELLLTAQGLEIIRRQSPNKLRQTLARIEAIIAEYQVECIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN +EG R   T+ F    ++R+  +  + WDERLTTVSA + +++  + R+ R 
Sbjct: 61  GYPKNMNNTEGERCEKTKEFKEM-LERRTGLEVILWDERLTTVSADKHMMESGIRREDRK 119

Query: 134 QKVDSIAAALILQEVLDRISF 154
           + VD IAA  ILQ  LD  S 
Sbjct: 120 KYVDEIAAVFILQGYLDYRSM 140


>gi|228993125|ref|ZP_04153047.1| Holliday junction resolvase [Bacillus pseudomycoides DSM 12442]
 gi|228999173|ref|ZP_04158755.1| Holliday junction resolvase [Bacillus mycoides Rock3-17]
 gi|229006721|ref|ZP_04164355.1| Holliday junction resolvase [Bacillus mycoides Rock1-4]
 gi|228754582|gb|EEM03993.1| Holliday junction resolvase [Bacillus mycoides Rock1-4]
 gi|228760790|gb|EEM09754.1| Holliday junction resolvase [Bacillus mycoides Rock3-17]
 gi|228766584|gb|EEM15225.1| Holliday junction resolvase [Bacillus pseudomycoides DSM 12442]
          Length = 137

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 76/137 (55%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+GTK +G+AISD     A     +    ++       +   +   N+   I+G
Sbjct: 1   MRILGLDVGTKTVGVAISDEMGWTAQGLETIKINEERGQFGFDRISELVKQYNVDKIIVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ GPR  + + F    +   + +  + WDERL+T++A+++LI  +VSRKKR Q
Sbjct: 61  LPKNMNGTIGPRGEACQQFAQ-SLRELLQLDVMMWDERLSTMAAERLLISADVSRKKRKQ 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LD 
Sbjct: 120 VIDKMAAVVILQGYLDS 136


>gi|332981265|ref|YP_004462706.1| Holliday junction resolvase YqgF [Mahella australiensis 50-1 BON]
 gi|332698943|gb|AEE95884.1| Holliday junction resolvase YqgF [Mahella australiensis 50-1 BON]
          Length = 144

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 51/143 (35%), Positives = 73/143 (51%), Gaps = 1/143 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G   IG+AISD     A       RK+       ++       +   +IGLP
Sbjct: 1   MRILGLDVGDNTIGIAISDELGWTAQGLETWRRKQPEADMQHIVDICQKSGVQCIVIGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRK-VYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
            NMNGS GP+     AF   + D     +  V WDERL+TV+AQ+ LI+ +VSR KR + 
Sbjct: 61  KNMNGSIGPQGKKVIAFKQRLADYMADDIDIVLWDERLSTVAAQRSLIEADVSRAKRKKV 120

Query: 136 VDSIAAALILQEVLDRISFLESS 158
           +D +AA  ILQ  LD +   ++ 
Sbjct: 121 IDKMAAVYILQGYLDSLRITKNK 143


>gi|170746909|ref|YP_001753169.1| Holliday junction resolvase YqgF [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653431|gb|ACB22486.1| Holliday junction resolvase YqgF [Methylobacterium radiotolerans
           JCM 2831]
          Length = 170

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 66/155 (42%), Positives = 89/155 (57%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+   I       +    +  IDLGTK IGLA+SD GR+ A P   + R K T  A  L 
Sbjct: 1   MNFDAIRAFAAESRGGARLIGIDLGTKTIGLALSDLGRQIATPLETIRRVKFTPDAQRLA 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +      +   ++GLPLNM+GSEGPRV STRAF+   +   + +P VF+DERL+T    +
Sbjct: 61  ALCRQHAVGGLVVGLPLNMDGSEGPRVQSTRAFMR-NLAPILPLPHVFFDERLSTAVVTR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            LI+ + SR +R Q VD +AAA ILQ  LD +  L
Sbjct: 120 ALIEADASRARRGQLVDKLAAAYILQGCLDVMRNL 154


>gi|241896590|ref|ZP_04783886.1| crossover junction endodeoxyribonuclease [Weissella
           paramesenteroides ATCC 33313]
 gi|241870182|gb|EER73933.1| crossover junction endodeoxyribonuclease [Weissella
           paramesenteroides ATCC 33313]
          Length = 144

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 49/143 (34%), Positives = 78/143 (54%), Gaps = 4/143 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFII 73
              I  +D+G++ +G+A+SD     A     +   +  +      +   +       F++
Sbjct: 1   MGRILGLDVGSRTVGVAVSDQLGWTAQGVEIIPINEDEKEFGIDRMKELVAKYEPIGFVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKR 132
           GLP NMN + GPRV ++RA+   ++     +P  F DERLTTV A+++LI+  + SRKKR
Sbjct: 61  GLPKNMNNTSGPRVDASRAYGE-LLKETFGLPIDFQDERLTTVEAERMLIEEADTSRKKR 119

Query: 133 IQKVDSIAAALILQEVLDRISFL 155
            + +D +AA LILQ  LDR   L
Sbjct: 120 KKVIDKLAAGLILQNYLDRKGSL 142


>gi|167757700|ref|ZP_02429827.1| hypothetical protein CLOSCI_00030 [Clostridium scindens ATCC 35704]
 gi|167664582|gb|EDS08712.1| hypothetical protein CLOSCI_00030 [Clostridium scindens ATCC 35704]
          Length = 141

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 50/139 (35%), Positives = 73/139 (52%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+K +G+AISDP    A     + RK   K+ +T   + + I    +   ++
Sbjct: 1   MRIMGLDYGSKTVGVAISDPLGITAQAIETICRKDENKLRKTCARIETLIEEYKVERIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP +MN   G R   +  F    + R+  +  V WDERLTTV A++ LI+  V R+ R 
Sbjct: 61  GLPKHMNNDIGDRAERSLEFGKM-LSRRTGLEVVMWDERLTTVEAERTLIENKVRREDRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D IAA  ILQ  LD I
Sbjct: 120 KYIDKIAAVFILQGYLDSI 138


>gi|19746980|ref|NP_608116.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS8232]
 gi|28896707|ref|NP_803057.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           SSI-1]
 gi|50915141|ref|YP_061113.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS10394]
 gi|71904442|ref|YP_281245.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS6180]
 gi|94989437|ref|YP_597538.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS9429]
 gi|94993326|ref|YP_601425.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS2096]
 gi|94995284|ref|YP_603382.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS10750]
 gi|139474553|ref|YP_001129269.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           str. Manfredo]
 gi|306826480|ref|ZP_07459791.1| crossover junction endodeoxyribonuclease [Streptococcus pyogenes
           ATCC 10782]
 gi|54039589|sp|P67495|RUVX_STRP8 RecName: Full=Putative Holliday junction resolvase
 gi|54042293|sp|P67494|RUVX_STRP3 RecName: Full=Putative Holliday junction resolvase
 gi|62900945|sp|Q5X9I3|RUVX_STRP6 RecName: Full=Putative Holliday junction resolvase
 gi|118597224|sp|Q1J498|RUVX_STRPF RecName: Full=Putative Holliday junction resolvase
 gi|146325612|sp|Q1J9D0|RUVX_STRPB RecName: Full=Putative Holliday junction resolvase
 gi|146325613|sp|Q1JJH9|RUVX_STRPC RecName: Full=Putative Holliday junction resolvase
 gi|146325614|sp|Q48QX0|RUVX_STRPM RecName: Full=Putative Holliday junction resolvase
 gi|167016512|sp|A2RGU5|RUVX_STRPG RecName: Full=Putative Holliday junction resolvase
 gi|19749234|gb|AAL98615.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232]
 gi|28811961|dbj|BAC64890.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1]
 gi|50904215|gb|AAT87930.1| Endonuclease involved in recombination [Streptococcus pyogenes
           MGAS10394]
 gi|71803537|gb|AAX72890.1| hypothetical protein M28_Spy1780 [Streptococcus pyogenes MGAS6180]
 gi|94542945|gb|ABF32994.1| endonuclease involved in recombination [Streptococcus pyogenes
           MGAS9429]
 gi|94546834|gb|ABF36881.1| Endonuclease involved in recombination [Streptococcus pyogenes
           MGAS2096]
 gi|94548792|gb|ABF38838.1| Endonuclease involved in recombination [Streptococcus pyogenes
           MGAS10750]
 gi|134272800|emb|CAM31077.1| putative Holliday junction resolvase [Streptococcus pyogenes str.
           Manfredo]
 gi|304431339|gb|EFM34337.1| crossover junction endodeoxyribonuclease [Streptococcus pyogenes
           ATCC 10782]
          Length = 139

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 50/138 (36%), Positives = 79/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +    +K       L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIKIDEEKAEFGFTRLEELVKQYQVEQFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV ++  + ++ I+    +P  + DERLTTV A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTNGPRVDASITYGNH-IEHLFGLPVHYQDERLTTVEAERMLIEQADISRGKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  L+R
Sbjct: 120 KVIDKLAAQLILQNYLNR 137


>gi|116626054|ref|YP_828210.1| Holliday junction resolvase YqgF [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229216|gb|ABJ87925.1| Holliday junction resolvase YqgF [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 140

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 50/139 (35%), Positives = 76/139 (54%), Gaps = 1/139 (0%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
                I ++DLG +RIGLAISDP R  A   P LVR ++      L   +    +   ++
Sbjct: 3   PDLSRILALDLGKRRIGLAISDPLRITAQGLPNLVRTRIRDDLDALEQLVKEREVGLVLL 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P+NM G+EG +    R F    ++++  VP   WDERLT+V A ++L    +S +KR 
Sbjct: 63  GNPINMKGTEGRQSGWVREFA-TAMEKRTGVPVKLWDERLTSVEAGRVLRSSGISIEKRA 121

Query: 134 QKVDSIAAALILQEVLDRI 152
             VD ++A ++LQ  LD +
Sbjct: 122 AAVDKLSAVILLQSYLDSL 140


>gi|290581344|ref|YP_003485736.1| hypothetical protein SmuNN2025_1818 [Streptococcus mutans NN2025]
 gi|254998243|dbj|BAH88844.1| hypothetical protein [Streptococcus mutans NN2025]
          Length = 139

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 50/139 (35%), Positives = 78/139 (56%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK--KVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+A+SDP    A     +     K       L   +    +  F++G
Sbjct: 1   MRIIGLDVGSKTVGVAVSDPLGFTAQGLEIIPINEAKGEFGFERLADLVKDYKVEKFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I     +P  + DERLTTV A+++L++  +VSR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGK-KIKELFDLPVEYQDERLTTVQAERMLVEQADVSRGKRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA LILQ  LDR+
Sbjct: 120 KVIDKLAAQLILQNYLDRM 138


>gi|167586351|ref|ZP_02378739.1| Holliday junction resolvase-like protein [Burkholderia ubonensis
           Bu]
          Length = 149

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 35/144 (24%), Positives = 68/144 (47%), Gaps = 1/144 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            +  + + D G KRIG+AI +   R A     +           +   +      A ++G
Sbjct: 7   RDATLMAFDYGEKRIGVAIGNALTRSARALVVIPNLNREHRFKAVGDLLAEWRPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+        + F +  ++ +  +P  + DER ++V A+  L + +V  + R  
Sbjct: 67  LPMHPDGTPHDMTQQAKRFGN-QLNGRFGLPVTWVDERYSSVEAEAALRERDVRGRARAG 125

Query: 135 KVDSIAAALILQEVLDRISFLESS 158
            +D+ AA +ILQ+ LD++S  E  
Sbjct: 126 MLDAEAARVILQQYLDQLSDHEHH 149


>gi|329770531|ref|ZP_08261909.1| Holliday junction resolvase [Gemella sanguinis M325]
 gi|328836280|gb|EGF85949.1| Holliday junction resolvase [Gemella sanguinis M325]
          Length = 142

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 48/139 (34%), Positives = 75/139 (53%), Gaps = 2/139 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV--TQTALELLSFITTENIAAFIIG 74
           + I  +D G+K IG+A+SD     A     +   +         +   +   N+   I+G
Sbjct: 4   KRIMGLDYGSKTIGVAVSDLLGLTAQGIETININEQIKDFKIKRIKELVNEHNVGKIIVG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NM+ S G R  +T  FV  +  +   V  +  DERLTT+ A+++L++ NVSRKKR  
Sbjct: 64  LPKNMDNSIGFRGEATLYFVEVLKKKIKSVEIILQDERLTTMGAERVLLEANVSRKKRKN 123

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA LILQ  LD+++
Sbjct: 124 VIDKMAAVLILQTYLDKLN 142


>gi|297198337|ref|ZP_06915734.1| Holliday junction resolvase YqgF [Streptomyces sviceus ATCC 29083]
 gi|297147063|gb|EDY58423.2| Holliday junction resolvase YqgF [Streptomyces sviceus ATCC 29083]
          Length = 154

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 45/146 (30%), Positives = 63/146 (43%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 +ID+G  RIG+A  DP    A P   +  + V      L   +        ++G
Sbjct: 2   RRGRRLAIDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLKQLVEEYEPIEVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EGP     R FV  +      VP    DER+TTV+A Q L    V  KK   
Sbjct: 62  LPRSLKGGEGPAAVKVRGFVQELARGIAPVPVRLVDERMTTVTASQGLRASGVKSKKGRS 121

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            +D  AA +ILQ+ L+       + G
Sbjct: 122 VIDQAAAVIILQQALESERVSGKAPG 147


>gi|152976801|ref|YP_001376318.1| Holliday junction resolvase-like protein [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|189046085|sp|A7GT65|RUVX_BACCN RecName: Full=Putative Holliday junction resolvase
 gi|152025553|gb|ABS23323.1| Holliday junction resolvase YqgF [Bacillus cytotoxicus NVH 391-98]
          Length = 137

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 76/137 (55%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             I  +D+GTK +G+AISD     A     +   +  +      +   +   N+   ++G
Sbjct: 1   MRILGLDVGTKTVGVAISDEMGWTAQGLETIKINEEREIFGFDRVSELVKQYNVDKIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ GPR  + + +    +   + +  + WDERL+T++A+++LI  +VSRKKR Q
Sbjct: 61  LPKNMNGTIGPRGEACQRYAE-SLRELLQLEVILWDERLSTMAAERLLISADVSRKKRKQ 119

Query: 135 KVDSIAAALILQEVLDR 151
            VD +AA +ILQ  LD 
Sbjct: 120 VVDKMAAVVILQGYLDS 136


>gi|328944731|gb|EGG38892.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK1087]
          Length = 139

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 51/138 (36%), Positives = 79/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +    +K       L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEEKGGFGLERLGELVKEYKVDKFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I     +P  + DERLTTV+A+++L++  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGQ-RIAELFGLPVDYQDERLTTVAAERMLVEQADISRSKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|225574862|ref|ZP_03783472.1| hypothetical protein RUMHYD_02940 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037936|gb|EEG48182.1| hypothetical protein RUMHYD_02940 [Blautia hydrogenotrophica DSM
           10507]
          Length = 152

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 51/144 (35%), Positives = 75/144 (52%), Gaps = 4/144 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+K +G+A+SDP    A     + RK   K+ QT   + + I    +   ++
Sbjct: 1   MRILGLDFGSKTVGVAVSDPLGLTAQGVEIIRRKSENKLRQTLARIEALIQEYEVETLVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NMN + G R   +  F  +M+ R+  +P V WDERLTTV A + L++  V R+ R 
Sbjct: 61  GLPKNMNNTMGDRAQKSLEF-RDMLVRRTGLPVVMWDERLTTVEANRTLMESGVRRENRK 119

Query: 134 QKVDSIAAALILQEVLDRISFLES 157
             VD +AA  ILQ  LD     + 
Sbjct: 120 DYVDELAAIFILQGYLDAQRIRKE 143


>gi|326803430|ref|YP_004321248.1| RNAse H domain protein, YqgF family [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326651353|gb|AEA01536.1| RNAse H domain protein, YqgF family [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 140

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 51/141 (36%), Positives = 75/141 (53%), Gaps = 4/141 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +         L   I    +   +IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPFGWTAQGIETIKIDEEAGKFGFSRLRQLIEDYQVEKIVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM-NVSRKKRI 133
           LP NMN +EGPR  ++R +    I+    +P  + DERLTT  +++ LI+  +VSRKKR 
Sbjct: 61  LPKNMNNTEGPRAEASRHYGDMAIE-LFDLPVFYQDERLTTQQSERFLIEAADVSRKKRK 119

Query: 134 QKVDSIAAALILQEVLDRISF 154
           + +D +AA LILQ  LD  S 
Sbjct: 120 KVIDKLAAVLILQNYLDSHSH 140


>gi|94967587|ref|YP_589635.1| Holliday junction resolvase YqgF [Candidatus Koribacter versatilis
           Ellin345]
 gi|124107438|sp|Q1IU89|RUVX_ACIBL RecName: Full=Putative Holliday junction resolvase
 gi|94549637|gb|ABF39561.1| Holliday junction resolvase YqgF [Candidatus Koribacter versatilis
           Ellin345]
          Length = 153

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 75/137 (54%), Gaps = 1/137 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  I ++D GT+RIGLA+SDP    A     L+RK        L S I    I   ++GL
Sbjct: 8   HGRILALDFGTRRIGLAVSDPLGITAQGLQTLLRKNKRTDLAALRSVIEQNEIREIVVGL 67

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PL ++G++       R F    ++++  +P   WDER T+V A ++L +  +S KKR + 
Sbjct: 68  PLRLSGADSSSTEKAREFAAW-LEKEFALPVHMWDERFTSVEANRVLRESEMSIKKRGEA 126

Query: 136 VDSIAAALILQEVLDRI 152
           VD ++A LILQ  L+R 
Sbjct: 127 VDRLSAVLILQAFLERR 143


>gi|209560223|ref|YP_002286695.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           NZ131]
 gi|226695308|sp|B5XJ01|RUVX_STRPZ RecName: Full=Putative Holliday junction resolvase
 gi|209541424|gb|ACI62000.1| Putative Holliday junction resolvase [Streptococcus pyogenes NZ131]
          Length = 139

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 50/138 (36%), Positives = 78/138 (56%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +    +K       L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIKIDEEKAEFGFTRLEELVKQYQVEQFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV ++  +  + I+    +P  + DERLTTV A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTNGPRVDASITYGSH-IEHLFGLPVHYQDERLTTVEAERMLIEQADISRGKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  L+R
Sbjct: 120 KVIDKLAAQLILQNYLNR 137


>gi|163942136|ref|YP_001647020.1| Holliday junction resolvase-like protein [Bacillus
           weihenstephanensis KBAB4]
 gi|229013604|ref|ZP_04170735.1| Holliday junction resolvase [Bacillus mycoides DSM 2048]
 gi|229032036|ref|ZP_04188019.1| Holliday junction resolvase [Bacillus cereus AH1271]
 gi|229062082|ref|ZP_04199407.1| Holliday junction resolvase [Bacillus cereus AH603]
 gi|229135209|ref|ZP_04264008.1| Holliday junction resolvase [Bacillus cereus BDRD-ST196]
 gi|229169130|ref|ZP_04296845.1| Holliday junction resolvase [Bacillus cereus AH621]
 gi|229175060|ref|ZP_04302578.1| Holliday junction resolvase [Bacillus cereus MM3]
 gi|226725488|sp|A9VI07|RUVX_BACWK RecName: Full=Putative Holliday junction resolvase
 gi|163864333|gb|ABY45392.1| Holliday junction resolvase YqgF [Bacillus weihenstephanensis
           KBAB4]
 gi|228608428|gb|EEK65732.1| Holliday junction resolvase [Bacillus cereus MM3]
 gi|228614358|gb|EEK71468.1| Holliday junction resolvase [Bacillus cereus AH621]
 gi|228648251|gb|EEL04287.1| Holliday junction resolvase [Bacillus cereus BDRD-ST196]
 gi|228717234|gb|EEL68909.1| Holliday junction resolvase [Bacillus cereus AH603]
 gi|228729281|gb|EEL80275.1| Holliday junction resolvase [Bacillus cereus AH1271]
 gi|228747663|gb|EEL97535.1| Holliday junction resolvase [Bacillus mycoides DSM 2048]
          Length = 137

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 76/137 (55%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+GTK +G+A+SD     A     +    ++       +   +   N+   ++G
Sbjct: 1   MRILGLDVGTKTVGVAMSDEMGWTAQGLETIRINEERGHFGFDRISELVKQYNVDKIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ GPR  + + F    +   + +  V WDERL+T++A+++LI  +VSRKKR Q
Sbjct: 61  LPKNMNGTIGPRGEACQQFAE-NLRNLLQLEVVMWDERLSTMAAERLLISADVSRKKRKQ 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LD 
Sbjct: 120 VIDKMAAVVILQGFLDS 136


>gi|297155786|gb|ADI05498.1| Holliday junction resolvase-like protein [Streptomyces
           bingchenggensis BCW-1]
          Length = 154

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 45/146 (30%), Positives = 64/146 (43%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 +ID+G  RIG+A  DP    A P   +  + +      L + +        ++G
Sbjct: 2   RRGRRIAIDVGDARIGVASCDPDGILATPVETVPGRDIPAAHKRLAAVVEEYEPIEVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP +++G EGP     R F      R   VP    DER+TTV+A Q L    V+ KK   
Sbjct: 62  LPRSLSGREGPAAAKVRTFAREFARRVAPVPVRLVDERMTTVTAAQGLRASGVTSKKGRS 121

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            VD  AA +ILQ  L+       + G
Sbjct: 122 VVDQAAAVVILQSALETERVSGRAPG 147


>gi|320547640|ref|ZP_08041925.1| crossover junction endodeoxyribonuclease [Streptococcus equinus
           ATCC 9812]
 gi|320447715|gb|EFW88473.1| crossover junction endodeoxyribonuclease [Streptococcus equinus
           ATCC 9812]
          Length = 139

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 52/139 (37%), Positives = 80/139 (57%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +         L   +   N+  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGVEIIQIDEEAGEFGFERLGELVKQYNVDKFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN +EGPRV +++A+    I     +P  + DERLTTV A+++L++  +VSR KR 
Sbjct: 61  LPKNMNNTEGPRVEASKAYGDQ-IKELFNIPVDYQDERLTTVQAERMLVEQADVSRGKRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA LILQ  LDR+
Sbjct: 120 KVIDKLAAQLILQNYLDRM 138


>gi|24380413|ref|NP_722368.1| Holliday junction resolvase-like protein [Streptococcus mutans
           UA159]
 gi|32130029|sp|Q8DRX8|RUVX_STRMU RecName: Full=Putative Holliday junction resolvase
 gi|24378438|gb|AAN59674.1|AE015030_4 conserved hypothetical protein [Streptococcus mutans UA159]
          Length = 139

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 50/139 (35%), Positives = 78/139 (56%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK--KVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+A+SDP    A     +     K       L   +    +  F++G
Sbjct: 1   MRIIGLDVGSKTVGVAVSDPLGFTAQGLEIIPINEAKGEFGFDRLADLVKDYKVEKFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I     +P  + DERLTTV A+++L++  +VSR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGK-KIKELFDLPVEYQDERLTTVQAERMLVEQADVSRGKRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA LILQ  LDR+
Sbjct: 120 KVIDKLAAQLILQNYLDRM 138


>gi|324992637|gb|EGC24558.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK405]
 gi|324995834|gb|EGC27745.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK678]
 gi|325695338|gb|EGD37238.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK150]
 gi|327460040|gb|EGF06379.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK1]
 gi|327463467|gb|EGF09786.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK1057]
 gi|327472186|gb|EGF17623.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK408]
 gi|327488630|gb|EGF20430.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK1058]
          Length = 139

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 50/138 (36%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +    +K       L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEEKGEFGLERLGELVKEYKVDKFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+   + +    +P  + DERLTTV+A+++L++  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGQRVAE-LFGLPVDYQDERLTTVAAERMLVEQADISRSKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|324989653|gb|EGC21597.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK353]
          Length = 139

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 51/138 (36%), Positives = 78/138 (56%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +     K       L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEDKGEFGLERLGELVKEYKVDKFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I     +P  + DERLTTV+A+++L++  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGQ-RIAELFGLPVDYQDERLTTVAAERMLVEQADISRSKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|189466359|ref|ZP_03015144.1| hypothetical protein BACINT_02734 [Bacteroides intestinalis DSM
           17393]
 gi|189434623|gb|EDV03608.1| hypothetical protein BACINT_02734 [Bacteroides intestinalis DSM
           17393]
          Length = 140

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 38/142 (26%), Positives = 67/142 (47%), Gaps = 5/142 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++    L+   ++  E +   ++GL
Sbjct: 1   MSRILAIDYGKKRTGIAVSDTLQMIANGLTTVPTHELLAFILD---YVGKEPVERILVGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      +     FV  +  +   +P  + DER T+V A + + +  + +K R   
Sbjct: 58  PKQMNNEASENMKRIEPFVRLLKKKLPEMPVEYVDERFTSVLAHRTMREAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISFL 155
             VD I+A +ILQ  L+   F+
Sbjct: 118 ALVDEISATIILQSYLENKRFI 139


>gi|882478|gb|AAA69116.1| ORF_o180; was also ORF_o62p before splice [Escherichia coli str.
           K-12 substr. MG1655]
          Length = 180

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 44  SGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGL 103

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     K
Sbjct: 104 PLNMDGTEQPLTARARKFAN-RIHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGK 162

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 163 VDSASAVIILESYFEQ 178


>gi|138896124|ref|YP_001126577.1| hypothetical protein GTNG_2487 [Geobacillus thermodenitrificans
           NG80-2]
 gi|196250077|ref|ZP_03148771.1| Holliday junction resolvase YqgF [Geobacillus sp. G11MC16]
 gi|167012727|sp|A4IR78|RUVX_GEOTN RecName: Full=Putative Holliday junction resolvase
 gi|134267637|gb|ABO67832.1| Conserved hypothetical protein [Geobacillus thermodenitrificans
           NG80-2]
 gi|196210261|gb|EDY05026.1| Holliday junction resolvase YqgF [Geobacillus sp. G11MC16]
          Length = 138

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 48/139 (34%), Positives = 76/139 (54%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFL--VRKKVTQTALELLSFITTENIAAFIIG 74
                +DLGTK +G+A+SD     A     +    ++       L + I    +   ++G
Sbjct: 1   MRTLGLDLGTKTLGVAVSDEFGWTAQGLETIAIDEERGHYGFERLRAIIDEYGVDTIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P NMNG+ GPR  ++  F    +  +  +P V WDERL+T++A+++LI  +VSRKKR +
Sbjct: 61  WPKNMNGTLGPRAEASERFAA-KLREEFSLPVVLWDERLSTMAAERMLIAADVSRKKRRK 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AAA+ILQ  LD   
Sbjct: 120 VIDKMAAAVILQSYLDSKR 138


>gi|23099462|ref|NP_692928.1| hypothetical protein OB2007 [Oceanobacillus iheyensis HTE831]
 gi|32130032|sp|Q8EPT1|RUVX_OCEIH RecName: Full=Putative Holliday junction resolvase
 gi|22777691|dbj|BAC13963.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831]
          Length = 137

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPF--LVRKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K IG+A+SD     A            ++    EL   I+   I   IIG
Sbjct: 1   MKIIGLDVGSKTIGVAVSDALGWTAQGVKTIRWDENDLSSADEELEKIISEHEIGKAIIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ G R  +++ + ++ I++   +P   WDERLTT++A+++L++ ++SR KR +
Sbjct: 61  LPKNMNGTIGERGEASQRYANH-IEKVFQIPVDLWDERLTTMAAERVLLEADMSRSKRKK 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LD+
Sbjct: 120 VIDKMAAVMILQGYLDQ 136


>gi|325529367|gb|EGD06294.1| Holliday junction resolvase-like protein [Burkholderia sp. TJI49]
          Length = 149

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 36/144 (25%), Positives = 69/144 (47%), Gaps = 1/144 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            +  + + D G KRIG+AI +   R A     +           +   +      A ++G
Sbjct: 7   RDATLLAFDYGEKRIGVAIGNALTRSARALVVIPNLNREHRFKAVGELLAEWRPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+        + F +  ++ +  +P  + DER ++V A+  L + NV  + R+ 
Sbjct: 67  LPMHPDGTPHDMTQQAKRFGN-QLNGRFGLPVSWVDERYSSVEAEAGLRERNVRGRARVD 125

Query: 135 KVDSIAAALILQEVLDRISFLESS 158
            +D+ AA +ILQ+ LD++S  E  
Sbjct: 126 MLDAEAARVILQQYLDQLSDHEHH 149


>gi|307326783|ref|ZP_07605975.1| Holliday junction resolvase YqgF [Streptomyces violaceusniger Tu
           4113]
 gi|306887546|gb|EFN18540.1| Holliday junction resolvase YqgF [Streptomyces violaceusniger Tu
           4113]
          Length = 154

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 45/146 (30%), Positives = 65/146 (44%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 +ID+G  RIG+A  DP    A P   +  + +      L + +        ++G
Sbjct: 2   RRGRRIAIDVGDARIGVASCDPDGILATPVETVPGRDIPAAHKRLAALVEEYEPLEVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP +++G EGP     R F   +  R   VP    DER+TTV+A Q L    V+ KK   
Sbjct: 62  LPRSLSGREGPAAAKVRTFARELARRVAPVPVRLVDERMTTVTASQGLRASGVTSKKGRS 121

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            VD  AA +ILQ  L+       + G
Sbjct: 122 VVDQAAAVVILQSALETERVSGRAPG 147


>gi|221201078|ref|ZP_03574118.1| conserved hypothetical protein TIGR00250 [Burkholderia multivorans
           CGD2M]
 gi|221206470|ref|ZP_03579483.1| conserved hypothetical protein TIGR00250 [Burkholderia multivorans
           CGD2]
 gi|221213802|ref|ZP_03586776.1| conserved hypothetical protein TIGR00250 [Burkholderia multivorans
           CGD1]
 gi|221166591|gb|EED99063.1| conserved hypothetical protein TIGR00250 [Burkholderia multivorans
           CGD1]
 gi|221173779|gb|EEE06213.1| conserved hypothetical protein TIGR00250 [Burkholderia multivorans
           CGD2]
 gi|221178928|gb|EEE11335.1| conserved hypothetical protein TIGR00250 [Burkholderia multivorans
           CGD2M]
          Length = 149

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 35/142 (24%), Positives = 68/142 (47%), Gaps = 1/142 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            +  + + D G KRIG+AI +   R A     +           +   +      A ++G
Sbjct: 7   RDATLLAFDYGEKRIGVAIGNALTRSARALVVIPNLNREHRFKAVGELLAEWRPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+        + F +  ++ +  +P  + DER ++V A+  + + NV  + R  
Sbjct: 67  LPMHPDGTPHDMTQQAKRFGN-QLNGRFGLPVTWVDERYSSVEAEAGMRERNVRGRARAD 125

Query: 135 KVDSIAAALILQEVLDRISFLE 156
            +D+ AA +ILQ+ LD++S  E
Sbjct: 126 MLDAEAARVILQQYLDQLSDHE 147


>gi|146317727|ref|YP_001197439.1| Holliday junction resolvase-like protein [Streptococcus suis
           05ZYH33]
 gi|146319916|ref|YP_001199627.1| Holliday junction resolvase-like protein [Streptococcus suis
           98HAH33]
 gi|223934259|ref|ZP_03626188.1| Holliday junction resolvase YqgF [Streptococcus suis 89/1591]
 gi|253750983|ref|YP_003024124.1| Holliday junction resolvase [Streptococcus suis SC84]
 gi|253752883|ref|YP_003026023.1| Holliday junction resolvase [Streptococcus suis P1/7]
 gi|253754708|ref|YP_003027848.1| Holliday junction resolvase [Streptococcus suis BM407]
 gi|167016513|sp|A4VYN8|RUVX_STRS2 RecName: Full=Putative Holliday junction resolvase
 gi|167016515|sp|A4VSF0|RUVX_STRSY RecName: Full=Putative Holliday junction resolvase
 gi|145688533|gb|ABP89039.1| Unknown protein [Streptococcus suis 05ZYH33]
 gi|145690722|gb|ABP91227.1| unknown protein [Streptococcus suis 98HAH33]
 gi|223897073|gb|EEF63505.1| Holliday junction resolvase YqgF [Streptococcus suis 89/1591]
 gi|251815272|emb|CAZ50837.1| putative Holliday junction resolvase [Streptococcus suis SC84]
 gi|251817172|emb|CAZ54893.1| putative Holliday junction resolvase [Streptococcus suis BM407]
 gi|251819128|emb|CAR44214.1| putative Holliday junction resolvase [Streptococcus suis P1/7]
 gi|292557526|gb|ADE30527.1| Resolvase, holliday junction-type, YqgF-like protein [Streptococcus
           suis GZ1]
          Length = 139

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 50/138 (36%), Positives = 81/138 (58%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +    +K       L   +    +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIPIDEEKGEFGLERLTELVEQYKVDKFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+   ++  +  +P  + DERLTTV+A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGD-LLTERYKLPVDYQDERLTTVAAERMLIEQADISRGKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|94991373|ref|YP_599473.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS10270]
 gi|118597223|sp|Q1JEI0|RUVX_STRPD RecName: Full=Putative Holliday junction resolvase
 gi|94544881|gb|ABF34929.1| Endonuclease involved in recombination [Streptococcus pyogenes
           MGAS10270]
          Length = 139

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 49/138 (35%), Positives = 78/138 (56%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +    +K       L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIKIDEEKAEFGFTRLEELVKQYQVEQFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN +  PRV ++  + ++ I+    +P  + DERLTTV A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTNSPRVDASITYGNH-IEHLFGLPVHYQDERLTTVEAERMLIEQADISRGKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  L+R
Sbjct: 120 KVIDKLAAQLILQNYLNR 137


>gi|85858514|ref|YP_460716.1| 4-amino-4-deoxychorismate lyase [Syntrophus aciditrophicus SB]
 gi|146325615|sp|Q2LR42|RUVX_SYNAS RecName: Full=Putative Holliday junction resolvase
 gi|85721605|gb|ABC76548.1| 4-amino-4-deoxychorismate lyase [Syntrophus aciditrophicus SB]
          Length = 150

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 71/137 (51%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D G KRIG+A+ D     A     ++RK        + S + T ++   +IG P
Sbjct: 1   MRILGLDYGEKRIGVALCDELGLTAQALTTVIRKSWRNDVGIIASLVRTYDVEKIVIGYP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           L ++G+EG +      F    ++  + +P + WDE LTT  A++IL    V  +KR   V
Sbjct: 61  LRLDGTEGIQCEKVVRFAR-RLEAALGIPVIRWDETLTTKEAEEILSRSGVPPRKRRGVV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA+LILQ  LD IS
Sbjct: 120 DRLAASLILQSYLDAIS 136


>gi|15675863|ref|NP_270037.1| Holliday junction resolvase-like protein [Streptococcus pyogenes M1
           GAS]
 gi|71911609|ref|YP_283159.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS5005]
 gi|32130060|sp|Q99XP4|RUVX_STRP1 RecName: Full=Putative Holliday junction resolvase
 gi|13623097|gb|AAK34758.1| conserved hypothetical protein [Streptococcus pyogenes M1 GAS]
 gi|71854391|gb|AAZ52414.1| endonuclease involved in recombination [Streptococcus pyogenes
           MGAS5005]
          Length = 139

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 50/138 (36%), Positives = 79/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +    +K       L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIKIDEEKAEFGFTRLEELVKQYQVEQFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV ++  + ++ I+    +P  + DERLTTV A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTNGPRVDASITYGNH-IEHLFGLPVHYQDERLTTVEAKRMLIEQADISRGKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  L+R
Sbjct: 120 KVIDKLAAQLILQNYLNR 137


>gi|58040808|ref|YP_192772.1| DNA integration/recombination/invertion protein [Gluconobacter
           oxydans 621H]
 gi|62900900|sp|Q5FND1|RUVX_GLUOX RecName: Full=Putative Holliday junction resolvase
 gi|58003222|gb|AAW62116.1| DNA integration/recombination/invertion protein [Gluconobacter
           oxydans 621H]
          Length = 160

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 51/151 (33%), Positives = 87/151 (57%), Gaps = 2/151 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +    DL   L+  Q +  +D G+K IG+A++D     A P   L R+K+ + A EL 
Sbjct: 1   MPLFNPHDLRNLLQSGQRVLGLDPGSKTIGVALTDVSLMLASPLIGLKRRKLGENAQELA 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             + T+++ A ++GLPL+++GS GP   +   +    +  K+ +P   WDERL++ +  +
Sbjct: 61  KIVRTQDVGALVVGLPLSLDGSFGPAARAASDWTQ-ALSEKLGIPAGLWDERLSSSAVNR 119

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLD 150
            LI D +++R +R + VD +AAA +LQ  LD
Sbjct: 120 FLIKDADMTRGRRAEVVDKMAAAYMLQGWLD 150


>gi|322386556|ref|ZP_08060183.1| crossover junction endodeoxyribonuclease [Streptococcus cristatus
           ATCC 51100]
 gi|321269475|gb|EFX52408.1| crossover junction endodeoxyribonuclease [Streptococcus cristatus
           ATCC 51100]
          Length = 139

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +    +K       L   +    +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIQIDEEKEQFGFERLTELVEQYKVDKFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I +   +P  + DERLTTV+A+++LI+  +VSR KR 
Sbjct: 61  LPKNMNNTSGPRVEASKAYGE-KIAQLFQIPVEYQDERLTTVAAERMLIEQADVSRSKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|288906372|ref|YP_003431594.1| hypothetical protein GALLO_2188 [Streptococcus gallolyticus UCN34]
 gi|306832418|ref|ZP_07465571.1| crossover junction endodeoxyribonuclease [Streptococcus
           gallolyticus subsp. gallolyticus TX20005]
 gi|325979385|ref|YP_004289101.1| putative holliday junction resolvase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|288733098|emb|CBI14679.1| Conserved hypothetical protein [Streptococcus gallolyticus UCN34]
 gi|304425458|gb|EFM28577.1| crossover junction endodeoxyribonuclease [Streptococcus
           gallolyticus subsp. gallolyticus TX20005]
 gi|325179313|emb|CBZ49357.1| putative holliday junction resolvase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
          Length = 139

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 51/139 (36%), Positives = 80/139 (57%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +         L   +    +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGVEIIRIDEEAGEFGFERLEELVKQYKVDKFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN +EGPRV +++A+    I+    +P  + DERLTTV A+++L++  +VSR KR 
Sbjct: 61  LPKNMNNTEGPRVEASKAYGD-KINELFNIPVDYQDERLTTVQAERMLVEQADVSRGKRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA LILQ  LDR+
Sbjct: 120 KVIDKLAAQLILQNYLDRM 138


>gi|154504518|ref|ZP_02041256.1| hypothetical protein RUMGNA_02022 [Ruminococcus gnavus ATCC 29149]
 gi|153795000|gb|EDN77420.1| hypothetical protein RUMGNA_02022 [Ruminococcus gnavus ATCC 29149]
          Length = 148

 Score =  136 bits (344), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 49/139 (35%), Positives = 70/139 (50%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D GTK +G+AISD     A     + RK   K+ +T   +   +    +   ++
Sbjct: 1   MRIMGLDYGTKTVGVAISDALGLTAQGIETIQRKEENKLRRTLARIEELVREYEVDTIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P +MN   G R   +  F    + R+  +  V WDERLTTV A++ LI+  V R+ R 
Sbjct: 61  GFPKHMNNDVGERAKKSLEFKEM-LVRRTGLDVVMWDERLTTVEAERTLIESQVRRENRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           Q +D IAA  ILQ  LD I
Sbjct: 120 QYIDKIAAVFILQGYLDSI 138


>gi|294811564|ref|ZP_06770207.1| Putative Holliday junction resolvase [Streptomyces clavuligerus
           ATCC 27064]
 gi|326440051|ref|ZP_08214785.1| Holliday junction resolvase-like protein [Streptomyces clavuligerus
           ATCC 27064]
 gi|294324163|gb|EFG05806.1| Putative Holliday junction resolvase [Streptomyces clavuligerus
           ATCC 27064]
          Length = 157

 Score =  136 bits (344), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 45/146 (30%), Positives = 63/146 (43%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 ++D+G  RIG+A  DP    A P   +  + V      + + +        ++G
Sbjct: 5   RRGRRLALDVGDARIGVASCDPDGVLATPVETVPGRDVPAAHRRIRALVEEYEPIEIVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++NG EGP     R F   +      VP    DER+TTV+A Q L    V  KK   
Sbjct: 65  LPRSLNGREGPAAKKVRTFAGEVARGVAPVPVRLVDERMTTVTATQGLRASGVKAKKGRS 124

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            VD  AA +ILQ  L+      S  G
Sbjct: 125 VVDQAAAVVILQNALESERAAGSPPG 150


>gi|171322539|ref|ZP_02911329.1| Holliday junction resolvase YqgF [Burkholderia ambifaria MEX-5]
 gi|171092132|gb|EDT37543.1| Holliday junction resolvase YqgF [Burkholderia ambifaria MEX-5]
          Length = 149

 Score =  136 bits (344), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 36/144 (25%), Positives = 69/144 (47%), Gaps = 1/144 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            +  + + D G KRIG+AI +   R A     +           +   +      A ++G
Sbjct: 7   RDATLLAFDYGEKRIGVAIGNALTRSARALVVISNLNREHRFKAVGDLLAEWRPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+        + F +  ++ +  +P  + DER ++V A+  L + NV  + R +
Sbjct: 67  LPMHPDGTPHEMTQQAKRFGN-QLNGRFGLPVTWVDERYSSVEAEAGLRERNVRGRARAE 125

Query: 135 KVDSIAAALILQEVLDRISFLESS 158
            +D+ AA +ILQ+ LD++S  E  
Sbjct: 126 MLDAEAARVILQQYLDQLSDHEHH 149


>gi|302380637|ref|ZP_07269102.1| Holliday junction resolvase-like protein [Finegoldia magna
           ACS-171-V-Col3]
 gi|303233893|ref|ZP_07320542.1| RNAse H domain protein, YqgF family [Finegoldia magna BVS033A4]
 gi|302311580|gb|EFK93596.1| Holliday junction resolvase-like protein [Finegoldia magna
           ACS-171-V-Col3]
 gi|302494818|gb|EFL54575.1| RNAse H domain protein, YqgF family [Finegoldia magna BVS033A4]
          Length = 137

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 51/135 (37%), Positives = 75/135 (55%), Gaps = 1/135 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            +    +D+G + IG+AISDP    A     + RK   +    +   I  + ++  I+GL
Sbjct: 1   MERYIGLDVGDRTIGVAISDPFLLTAQSLMTIKRKSKIEDIEIINGIIKEKEVSKIIVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + GP+    + FV   + +   +   + DERLTTVSA ++LI+ NVSRKKR   
Sbjct: 61  PKNMNNTIGPQAKKVKTFVK-ELRKHTDLDIEYVDERLTTVSATRVLIEQNVSRKKRKDV 119

Query: 136 VDSIAAALILQEVLD 150
           +DS+AA  ILQ  LD
Sbjct: 120 IDSVAATYILQTYLD 134


>gi|325688814|gb|EGD30822.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK115]
          Length = 139

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 50/138 (36%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +    +K       L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEEKGEFGLERLGELVKEYKVDKFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+   + +    +P  + DERLTTV+A+++L++  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGQRVAE-LFGLPVDYQDERLTTVAAERMLVEQADISRNKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|323705257|ref|ZP_08116832.1| Holliday junction resolvase YqgF [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535159|gb|EGB24935.1| Holliday junction resolvase YqgF [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 140

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 44/138 (31%), Positives = 72/138 (52%), Gaps = 2/138 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
                +D+G K IG+A+SDP    A     + R+ +     E+   I    +   ++G P
Sbjct: 1   MRTIGLDVGDKTIGIAVSDPSGLIAQGIKTIRRESLDNDVFEIKKIIDAFKVEEIVVGFP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQK 135
            NMNG+ G +      FV   +  ++ +P + WDERLTTV A ++L++  ++ R KR + 
Sbjct: 61  KNMNGTIGAQGQKVINFVEY-LKEEIDLPIMLWDERLTTVEANRMLVENADMRRDKRKKV 119

Query: 136 VDSIAAALILQEVLDRIS 153
           +D +AA +ILQ  LD   
Sbjct: 120 IDKLAATIILQGYLDYKR 137


>gi|166031235|ref|ZP_02234064.1| hypothetical protein DORFOR_00922 [Dorea formicigenerans ATCC
           27755]
 gi|166029082|gb|EDR47839.1| hypothetical protein DORFOR_00922 [Dorea formicigenerans ATCC
           27755]
          Length = 144

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 48/138 (34%), Positives = 72/138 (52%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G++ +G+A+SDP    A     + RK   K+ +T   +   +    +   ++
Sbjct: 1   MRIMGLDYGSRTVGVAVSDPLGITAQAVETICRKDENKLRKTCARIEELVAEYEVEKIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP +MN   G R   +  F    I R+  +  V WDERLTTVSA++ LI+  V R+ R 
Sbjct: 61  GLPKHMNNDIGDRAEKSMQFGEM-IGRRTGLEVVMWDERLTTVSAERTLIENKVRREDRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D IAA  ILQ  LD 
Sbjct: 120 KYIDQIAAVFILQGYLDS 137


>gi|78065437|ref|YP_368206.1| Holliday junction resolvase-like protein [Burkholderia sp. 383]
 gi|146325557|sp|Q39J04|RUVX_BURS3 RecName: Full=Putative Holliday junction resolvase
 gi|77966182|gb|ABB07562.1| Holliday junction resolvase YqgF [Burkholderia sp. 383]
          Length = 149

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 35/144 (24%), Positives = 69/144 (47%), Gaps = 1/144 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            +  + + D G KRIG+A+ +   R A     +           +   +      A ++G
Sbjct: 7   RDATLLAFDYGEKRIGVAVGNALTRSARALVVIQNLNREHRFKAVGDLLAEWRPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+        + F +  ++ +  +P  + DER ++V A+  L + NV  + R +
Sbjct: 67  LPMHPDGTPHDMTQQAKRFGN-QLNGRFGLPVTWVDERYSSVEAEAGLRERNVRGRARAE 125

Query: 135 KVDSIAAALILQEVLDRISFLESS 158
            +D+ AA +ILQ+ LD++S  E  
Sbjct: 126 MLDAEAARVILQQYLDQLSDHEHH 149


>gi|325697277|gb|EGD39163.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK160]
          Length = 139

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 50/138 (36%), Positives = 79/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +     K       L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEDKGEFGLERLGELVKEYKVDKFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+   + +    +P  + DERLTTV+A+++L++  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGQRVAE-LFGLPVDYQDERLTTVAAERMLVEQADISRSKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|317495258|ref|ZP_07953628.1| hypothetical protein HMPREF0432_00230 [Gemella moribillum M424]
 gi|316914680|gb|EFV36156.1| hypothetical protein HMPREF0432_00230 [Gemella moribillum M424]
          Length = 141

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 73/137 (53%), Gaps = 2/137 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV--TQTALELLSFITTENIAAFIIG 74
           + I  +D G+K IG+A+SD     A     +   +         +   +   NI   ++G
Sbjct: 4   KRIMGLDYGSKTIGVAVSDLLGMTAQGVETININEQVKDFKIKRIKELVNEYNIGKIVVG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NM+ S G R  +T  FV  +  +   V  +  DERLTT+ A+++L++ NVSRKKR  
Sbjct: 64  LPKNMDNSIGFRGEATLYFVEVLKKKIKSVEVILQDERLTTMGAERVLLEANVSRKKRKD 123

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA LILQ  LD+
Sbjct: 124 VIDKMAAVLILQTYLDK 140


>gi|317128239|ref|YP_004094521.1| Holliday junction resolvase YqgF [Bacillus cellulosilyticus DSM
           2522]
 gi|315473187|gb|ADU29790.1| Holliday junction resolvase YqgF [Bacillus cellulosilyticus DSM
           2522]
          Length = 142

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 50/139 (35%), Positives = 77/139 (55%), Gaps = 3/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVR--KKVTQTALELLSFITTENIAAFIIG 74
             +  +D+GT  IG+AISD     A     + R  +   Q    L   I  ++++  ++G
Sbjct: 1   MKVLGLDVGTHTIGVAISDAFGWTAQGLETIKRAKEDEEQDFSRLDEIIRNKDVSTIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ GP     +AF    +  +  +    WDERLTTV+A+++L+  +VSRKKR +
Sbjct: 61  LPKNMNGTIGPSGELCQAFAE-KLKERTNLKVELWDERLTTVAAEKMLVSADVSRKKRKK 119

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LDR  
Sbjct: 120 VIDKMAAVMILQGYLDRNP 138


>gi|169824325|ref|YP_001691936.1| putative endonuclease involved in recombination [Finegoldia magna
           ATCC 29328]
 gi|297588302|ref|ZP_06946945.1| crossover junction endodeoxyribonuclease [Finegoldia magna ATCC
           53516]
 gi|167831130|dbj|BAG08046.1| putative endonuclease involved in recombination [Finegoldia magna
           ATCC 29328]
 gi|297573675|gb|EFH92396.1| crossover junction endodeoxyribonuclease [Finegoldia magna ATCC
           53516]
          Length = 137

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 51/135 (37%), Positives = 75/135 (55%), Gaps = 1/135 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            +    +D+G + IG+AISDP    A     + RK   +    +   I  + ++  I+GL
Sbjct: 1   MERYIGLDVGDRTIGVAISDPFLLTAQSLMTIKRKSKIEDIEIINDIIKEKEVSKIIVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + GP+    + FV   + +   +   + DERLTTVSA ++LI+ NVSRKKR   
Sbjct: 61  PKNMNNTIGPQAKKVKTFVK-ELRKHTDLDIEYVDERLTTVSATRVLIEQNVSRKKRKDV 119

Query: 136 VDSIAAALILQEVLD 150
           +DS+AA  ILQ  LD
Sbjct: 120 IDSVAATYILQTYLD 134


>gi|161525692|ref|YP_001580704.1| Holliday junction resolvase-like protein [Burkholderia multivorans
           ATCC 17616]
 gi|189349586|ref|YP_001945214.1| Holliday junction resolvase-like protein [Burkholderia multivorans
           ATCC 17616]
 gi|226725496|sp|A9AFI6|RUVX_BURM1 RecName: Full=Putative Holliday junction resolvase
 gi|160343121|gb|ABX16207.1| Holliday junction resolvase YqgF [Burkholderia multivorans ATCC
           17616]
 gi|189333608|dbj|BAG42678.1| putative holliday junction resolvase [Burkholderia multivorans ATCC
           17616]
          Length = 149

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 35/142 (24%), Positives = 68/142 (47%), Gaps = 1/142 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            +  + + D G KRIG+AI +   R A     +           +   +      A ++G
Sbjct: 7   RDATLLAFDYGEKRIGVAIGNALTRSARALVVIPNLNREHRFKAVGELLAEWRPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+        + F +  ++ +  +P  + DER ++V A+  + + NV  + R  
Sbjct: 67  LPMHPDGTPHDMTQQAKRFGN-QLNGRFGLPVTWVDERYSSVEAEAGMRERNVRGRARTD 125

Query: 135 KVDSIAAALILQEVLDRISFLE 156
            +D+ AA +ILQ+ LD++S  E
Sbjct: 126 MLDAEAARVILQQYLDQLSDHE 147


>gi|289423537|ref|ZP_06425338.1| conserved hypothetical protein [Peptostreptococcus anaerobius
           653-L]
 gi|289156039|gb|EFD04703.1| conserved hypothetical protein [Peptostreptococcus anaerobius
           653-L]
          Length = 140

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 51/138 (36%), Positives = 74/138 (53%), Gaps = 1/138 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +D+G   IG+A+SD     A     + R+   +    +   I  +N+   + GLP
Sbjct: 4   GRIMGLDIGNNTIGVAVSDLMGMTAQGITTIKRESKKKDIEAIKDIIKEQNVNLIVSGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GP+      F   +I  +  +   FWDERLTTVSA+++LI  +VSRK R + +
Sbjct: 64  KNMNGTVGPQAEKVMKFCE-LIKEETKLEVEFWDERLTTVSAEKMLISGDVSRKNRKKVI 122

Query: 137 DSIAAALILQEVLDRISF 154
           D +AA LILQ  LD   F
Sbjct: 123 DKLAAVLILQNYLDFKKF 140


>gi|160947667|ref|ZP_02094834.1| hypothetical protein PEPMIC_01602 [Parvimonas micra ATCC 33270]
 gi|158446801|gb|EDP23796.1| hypothetical protein PEPMIC_01602 [Parvimonas micra ATCC 33270]
          Length = 148

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 53/140 (37%), Positives = 78/140 (55%), Gaps = 4/140 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
                ++D+G + IG+A+SDP    A     + R+ + +    L + I  ENI   ++GL
Sbjct: 8   MNRYMALDVGDRTIGVAVSDPLFIMAEGYSTIFRESIEKDLESLKNIIVKENIIKVVVGL 67

Query: 76  PLNMNGSEGPRVHSTRAFVHNMI----DRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           P NMN + GP+     +FV  +          +  V  DERLTTVSA++ILI+ N+SRKK
Sbjct: 68  PKNMNNTIGPQGEKVLSFVDELKDFLVKNSFDIEIVMQDERLTTVSAERILIEGNMSRKK 127

Query: 132 RIQKVDSIAAALILQEVLDR 151
           R + +D +AA  ILQ  LDR
Sbjct: 128 RKKVIDKVAATYILQSYLDR 147


>gi|238916712|ref|YP_002930229.1| putative Holliday junction resolvase [Eubacterium eligens ATCC
           27750]
 gi|259495704|sp|C4Z578|RUVX_EUBE2 RecName: Full=Putative Holliday junction resolvase
 gi|238872072|gb|ACR71782.1| putative Holliday junction resolvase [Eubacterium eligens ATCC
           27750]
          Length = 140

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 42/138 (30%), Positives = 73/138 (52%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQ---TALELLSFITTENIAAFII 73
             I  +D+GTK +G+A+SDP    A P   + RK+  +   T   +   I+  ++   ++
Sbjct: 1   MRIIGLDVGTKTVGVALSDPLGITAQPFETITRKENNKLRRTYARIEQIISEYDVTEIVV 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NM+ + G R  +   F    ++R+  +P   WDERLTTV A ++L +  + R+ R 
Sbjct: 61  GYPKNMDDTIGERAKACEEFAA-ALERRTGLPVTLWDERLTTVEADEVLEECGMRRENRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
             +D +AA  IL+  ++ 
Sbjct: 120 TVIDQLAAVFILRGYMES 137


>gi|55821927|ref|YP_140369.1| Holliday junction resolvase-like protein [Streptococcus
           thermophilus LMG 18311]
 gi|55823846|ref|YP_142287.1| Holliday junction resolvase-like protein [Streptococcus
           thermophilus CNRZ1066]
 gi|62900908|sp|Q5LXP0|RUVX_STRT1 RecName: Full=Putative Holliday junction resolvase
 gi|62900909|sp|Q5M292|RUVX_STRT2 RecName: Full=Putative Holliday junction resolvase
 gi|55737912|gb|AAV61554.1| DNA recombination protein, putative [Streptococcus thermophilus LMG
           18311]
 gi|55739831|gb|AAV63472.1| DNA recombination protein, putative [Streptococcus thermophilus
           CNRZ1066]
          Length = 139

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 50/139 (35%), Positives = 79/139 (56%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+AISDP    A     +    +        L   +    +  F++G
Sbjct: 1   MRVMGLDVGSKTVGVAISDPLGFTAQGVEIIKINEEAKEFGFDRLGELVKEYQVDKFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN +EGPRV +++A+    I     +P  + DERLTTV A+++L++  +VSR KR 
Sbjct: 61  LPKNMNNTEGPRVEASKAYGD-KIKEIFNLPVDYQDERLTTVQAERMLVEQADVSRGKRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA LILQ  LDR+
Sbjct: 120 KVIDKLAAQLILQNYLDRM 138


>gi|329117501|ref|ZP_08246218.1| RNAse H domain protein, YqgF family [Streptococcus parauberis NCFD
           2020]
 gi|326907906|gb|EGE54820.1| RNAse H domain protein, YqgF family [Streptococcus parauberis NCFD
           2020]
          Length = 139

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 53/139 (38%), Positives = 81/139 (58%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +     K       L   +    +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIKIDEDKKEFGLARLEELVNQYKVDKFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN S GPRV +++A+ + +I  +  +P  + DERLTTV A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNSSGPRVEASQAYGN-LIQEQFNIPVEYQDERLTTVQAERMLIEQADISRGKRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA LILQ  LDRI
Sbjct: 120 KVIDKLAAQLILQNYLDRI 138


>gi|322390444|ref|ZP_08063964.1| crossover junction endodeoxyribonuclease [Streptococcus
           parasanguinis ATCC 903]
 gi|321142843|gb|EFX38301.1| crossover junction endodeoxyribonuclease [Streptococcus
           parasanguinis ATCC 903]
          Length = 139

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 49/138 (35%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+A+SDP    A     +     K       L   +    +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAVSDPLGFTAQGLEIIQIDEDKKEFGLERLAELVAQYKVDRFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+   + ++   +P  + DERLTTV+A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGAMIAEKF-GMPVDYQDERLTTVAAERMLIEQADISRSKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|227514537|ref|ZP_03944586.1| crossover junction endodeoxyribonuclease [Lactobacillus fermentum
           ATCC 14931]
 gi|227087094|gb|EEI22406.1| crossover junction endodeoxyribonuclease [Lactobacillus fermentum
           ATCC 14931]
          Length = 145

 Score =  136 bits (343), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 47/138 (34%), Positives = 81/138 (58%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+A SDP    A     +   +  +      +   + +  +A F++G
Sbjct: 1   MRLLGLDVGSKTVGVAESDPLGWTAQAVEIIPIDEEAEVFGLERVAELVKSRQVAGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN +EGPRV + R +   +++ +  +P  + DERLTTV A ++L++  +VSR+K+ 
Sbjct: 61  LPKNMNNTEGPRVEAARHYGE-LLEERFGLPIDYQDERLTTVQAHRMLVEEADVSRRKQK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDELAATLILQNYLDR 137


>gi|171778528|ref|ZP_02919655.1| hypothetical protein STRINF_00507 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282751|gb|EDT48175.1| hypothetical protein STRINF_00507 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 139

 Score =  136 bits (343), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 49/139 (35%), Positives = 80/139 (57%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +         L   +    +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGVEIIRIDEEAGEFGFERLGELVKQYKVDKFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN +EGPRV +++ +    I++   +P  + DERLTTV A+++L++  ++SR KR 
Sbjct: 61  LPKNMNNTEGPRVEASKVYGD-KINKLFNIPVDYQDERLTTVQAERMLVEQADISRGKRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA LILQ  LDR+
Sbjct: 120 KVIDKLAAQLILQNYLDRM 138


>gi|218899555|ref|YP_002447966.1| hypothetical protein TIGR00250 [Bacillus cereus G9842]
 gi|228902914|ref|ZP_04067055.1| Holliday junction resolvase [Bacillus thuringiensis IBL 4222]
 gi|228910222|ref|ZP_04074040.1| Holliday junction resolvase [Bacillus thuringiensis IBL 200]
 gi|228967461|ref|ZP_04128490.1| Holliday junction resolvase [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|229098858|ref|ZP_04229794.1| Holliday junction resolvase [Bacillus cereus Rock3-29]
 gi|229105020|ref|ZP_04235674.1| Holliday junction resolvase [Bacillus cereus Rock3-28]
 gi|226725485|sp|B7IYP0|RUVX_BACC2 RecName: Full=Putative Holliday junction resolvase
 gi|218541329|gb|ACK93723.1| conserved hypothetical protein TIGR00250 [Bacillus cereus G9842]
 gi|228678397|gb|EEL32620.1| Holliday junction resolvase [Bacillus cereus Rock3-28]
 gi|228684531|gb|EEL38473.1| Holliday junction resolvase [Bacillus cereus Rock3-29]
 gi|228792238|gb|EEM39811.1| Holliday junction resolvase [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228849386|gb|EEM94222.1| Holliday junction resolvase [Bacillus thuringiensis IBL 200]
 gi|228856698|gb|EEN01217.1| Holliday junction resolvase [Bacillus thuringiensis IBL 4222]
          Length = 137

 Score =  136 bits (343), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 76/137 (55%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+GTK +G+A+SD     A     +    ++       +   +   N+   ++G
Sbjct: 1   MRILGLDVGTKTVGVAMSDEMGWTAQGLETIKINEERGHFGFDRISELVKQYNVDKIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ GPR  + + F    +   + +  V WDERL+T++A+++LI  +VSRKKR Q
Sbjct: 61  LPKNMNGTIGPRGEACQQFAE-NLRELLQLDVVMWDERLSTMAAERLLISADVSRKKRKQ 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LD 
Sbjct: 120 VIDKMAAVVILQGFLDS 136


>gi|239787333|emb|CAX83809.1| Resolvase family protein, holliday junction-type, YqgF-like
           [uncultured bacterium]
          Length = 161

 Score =  136 bits (343), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 49/141 (34%), Positives = 77/141 (54%), Gaps = 1/141 (0%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
              Q + +ID G + +G+A+SD     + P  F +  K       L + I        ++
Sbjct: 9   TKGQRLLAIDYGDRFLGVAVSDIMWHISTP-LFPIDSKSCNAFQALGALIDQHACGGIVV 67

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P+NMNGSEGP     R F   +      +P   +DERL+TV+A++ +++ ++SRKKR 
Sbjct: 68  GYPINMNGSEGPACERVREFCQKIKKFFPSIPIGLFDERLSTVAAERNMVEADMSRKKRK 127

Query: 134 QKVDSIAAALILQEVLDRISF 154
           QKVDS+AA+ +LQ  LD +  
Sbjct: 128 QKVDSLAASYVLQGTLDYLRN 148


>gi|260578809|ref|ZP_05846716.1| Holliday junction resolvase [Corynebacterium jeikeium ATCC 43734]
 gi|258603107|gb|EEW16377.1| Holliday junction resolvase [Corynebacterium jeikeium ATCC 43734]
          Length = 155

 Score =  136 bits (343), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 37/140 (26%), Positives = 59/140 (42%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
                   +D+GT RIG+AISDP    A P   +           +        +   ++
Sbjct: 12  PGRGRRLGLDVGTVRIGVAISDPDCILATPVETVQATADDADVQRVAEICRENFVVEIVV 71

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP+ + G+      +   F   + +    +P    DER++T++A Q      V+ KK  
Sbjct: 72  GLPVALRGNHTQSTLNAEEFARLVKEELPDIPLRMVDERMSTMAATQAFHASGVNSKKGR 131

Query: 134 QKVDSIAAALILQEVLDRIS 153
           +K+D  AA  ILQ  LD   
Sbjct: 132 KKIDQAAAVHILQGWLDTRR 151


>gi|323490024|ref|ZP_08095245.1| Holliday junction resolvase-like protein [Planococcus donghaensis
           MPA1U2]
 gi|323396320|gb|EGA89145.1| Holliday junction resolvase-like protein [Planococcus donghaensis
           MPA1U2]
          Length = 138

 Score =  136 bits (343), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 49/136 (36%), Positives = 73/136 (53%), Gaps = 3/136 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             I  +D+G+K IG+AISDP    A     +   +  +      L   I    +   ++G
Sbjct: 1   MRIIGLDVGSKTIGVAISDPMGWTAQGIETIKINEAIEEFGMERLGELIKQYEVTEAVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P NMN S GPR  ++  F   ++     +P V WDERLTT +A+++LI  +VSRK R +
Sbjct: 61  YPKNMNNSIGPRAEASEKFAA-LLKEAYSIPVVLWDERLTTSAAEKMLISADVSRKNRKK 119

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA +ILQ  LD
Sbjct: 120 VIDKMAAVMILQGYLD 135


>gi|227484975|ref|ZP_03915291.1| crossover junction endodeoxyribonuclease [Anaerococcus lactolyticus
           ATCC 51172]
 gi|227237130|gb|EEI87145.1| crossover junction endodeoxyribonuclease [Anaerococcus lactolyticus
           ATCC 51172]
          Length = 139

 Score =  136 bits (343), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 50/139 (35%), Positives = 77/139 (55%), Gaps = 1/139 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I  +D+G K IG+A+SDP    A P   + R K       +       +I+  ++GL
Sbjct: 1   MSRIMGLDVGDKTIGVALSDPLFITAQPYETIKRTKAKFDIDRIEKIFVENDISLIVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + GP+     +FV  +I +++    V+ DERLTT+ ++ +LIDM+V R+ R   
Sbjct: 61  PKNMNNTMGPQSMRIISFVD-LIKKRIDTEIVYQDERLTTIQSESVLIDMSVRRENRKAH 119

Query: 136 VDSIAAALILQEVLDRISF 154
           +D IAA+ ILQ  LDR + 
Sbjct: 120 IDKIAASFILQTYLDRRNN 138


>gi|229163335|ref|ZP_04291287.1| Holliday junction resolvase [Bacillus cereus R309803]
 gi|228620116|gb|EEK76990.1| Holliday junction resolvase [Bacillus cereus R309803]
          Length = 137

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 76/137 (55%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+GTK +G+A+SD     A     +    ++       +   +   N+   ++G
Sbjct: 1   MRILGLDVGTKTVGVAMSDEMGWTAQGLETIRINEERGHFGFDRISELVKQYNVDKIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ GPR  + + F    +   + +  V WDERL+T++A+++LI  +VSRKKR Q
Sbjct: 61  LPKNMNGTIGPRGEACQQFAE-NLRELLQLDVVMWDERLSTMAAERLLISADVSRKKRKQ 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LD 
Sbjct: 120 VIDKMAAVVILQGFLDS 136


>gi|172058081|ref|YP_001814541.1| Holliday junction resolvase YqgF [Exiguobacterium sibiricum 255-15]
 gi|171990602|gb|ACB61524.1| Holliday junction resolvase YqgF [Exiguobacterium sibiricum 255-15]
          Length = 140

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 52/140 (37%), Positives = 77/140 (55%), Gaps = 3/140 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFII 73
            +    +D+G+K IG+A+SD     A     +   +         L + I    +   +I
Sbjct: 1   MKRAIGLDVGSKTIGVAVSDLMGWTAQGVETIKWTEPEYPVAFKRLEAIIKEYGVEIIVI 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMNGS GPR  ++ AF    I+ +  +  V  DERLTT+ A+++LID +VSRKKR 
Sbjct: 61  GHPKNMNGSIGPRAEASEAFAR-EIETQTGLSTVLVDERLTTMQAERMLIDADVSRKKRK 119

Query: 134 QKVDSIAAALILQEVLDRIS 153
           Q +D +AA +ILQ  LDR +
Sbjct: 120 QVIDKMAAVMILQSYLDRAN 139


>gi|328881149|emb|CCA54388.1| putative Holliday junction resolvase [Streptomyces venezuelae ATCC
           10712]
          Length = 156

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 44/136 (32%), Positives = 61/136 (44%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 ++D+G  RIG+A  DP    A P   +  + V      L   +        ++G
Sbjct: 4   RRGRRIAVDVGDARIGVASCDPDGVLATPVETVPGRDVPAAHRRLRQIVEEYEPIEVVVG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP +++G EGP     RAF   M      VP    DER+TTV+A Q L    V  KK   
Sbjct: 64  LPRSLSGREGPAATKVRAFAGEMAKGIAPVPVRLVDERMTTVTATQGLRASGVKAKKGRS 123

Query: 135 KVDSIAAALILQEVLD 150
            +D  AA +ILQ  L+
Sbjct: 124 VIDQAAAVIILQNALE 139


>gi|302561724|ref|ZP_07314066.1| Holliday junction resolvase [Streptomyces griseoflavus Tu4000]
 gi|302479342|gb|EFL42435.1| Holliday junction resolvase [Streptomyces griseoflavus Tu4000]
          Length = 163

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 43/137 (31%), Positives = 60/137 (43%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 +ID+G  RIG+A  DP    A P   +  + V      L   +        ++G
Sbjct: 11  RRGRRLAIDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLGLLVQEYEPIEVVVG 70

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EGP     R F   +      VP    DER+TTV+A Q L    V  KK   
Sbjct: 71  LPRSLKGGEGPAAAKVRGFARELARGIAPVPVRLVDERMTTVTASQGLRASGVKSKKGRS 130

Query: 135 KVDSIAAALILQEVLDR 151
            +D  AA +ILQ+ L+ 
Sbjct: 131 VIDQAAAVIILQQALES 147


>gi|293372829|ref|ZP_06619207.1| RNAse YqgF [Bacteroides ovatus SD CMC 3f]
 gi|292632204|gb|EFF50804.1| RNAse YqgF [Bacteroides ovatus SD CMC 3f]
          Length = 141

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/144 (29%), Positives = 69/144 (47%), Gaps = 5/144 (3%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           + P   I +ID G KR G+A+SD  +  A+    +   ++     E   +I  E +   I
Sbjct: 1   MYPMSRIVAIDYGRKRTGIAVSDTMQLIANGLTTVPTHELLNFIGE---YIAKEPVERII 57

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           IGLP  MN      + +   FV ++      +P  + DER T+V A + +++  + +K R
Sbjct: 58  IGLPKQMNNEVSENMKNIEPFVRSLKKCYPDLPVEYVDERFTSVLAHRTMLEAGLKKKDR 117

Query: 133 --IQKVDSIAAALILQEVLDRISF 154
                VD I+A +ILQ  L+   F
Sbjct: 118 QNKALVDEISATIILQTYLESKRF 141


>gi|226941795|ref|YP_002796869.1| Holliday junction resolvase-like protein [Laribacter hongkongensis
           HLHK9]
 gi|226716722|gb|ACO75860.1| Putative Holliday junction resolvase [Laribacter hongkongensis
           HLHK9]
          Length = 155

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 59/135 (43%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
                 D G  RIG+A+ D     AHP   L           + + I    I+  ++GLP
Sbjct: 5   GSWLGFDFGEARIGIAVGDRLVGIAHPLETLSAPDNDSRFARIAALIGEWQISGLVVGLP 64

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            + +G+        R F    +  +  +P V  DER +++ A+ +L +     +K+   +
Sbjct: 65  THADGTPHEMTRLARRFAQ-RLHGRFGLPVVLVDERHSSLLAEDLLRESGRRGRKQKPVL 123

Query: 137 DSIAAALILQEVLDR 151
           D +AA +ILQ   D+
Sbjct: 124 DQVAAQVILQSFFDQ 138


>gi|326780492|ref|ZP_08239757.1| Holliday junction resolvase YqgF [Streptomyces cf. griseus
           XylebKG-1]
 gi|326660825|gb|EGE45671.1| Holliday junction resolvase YqgF [Streptomyces cf. griseus
           XylebKG-1]
          Length = 154

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/146 (28%), Positives = 60/146 (41%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 ++D+G  RIG+A  DP    A P   +  + V      L   +        ++G
Sbjct: 2   RRGRRLAVDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLRQIVDEYEPIEVVLG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EGP     R F          VP    DER+TTV+A Q +    V  KK   
Sbjct: 62  LPRSLGGGEGPAAAKVREFAQVFARSIAPVPVRLVDERMTTVTAAQGMRASGVKSKKGRS 121

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            +D  AA +ILQ  L+      +  G
Sbjct: 122 VIDQAAAVVILQNALESERASGNPPG 147


>gi|182439828|ref|YP_001827547.1| hypothetical protein SGR_6035 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178468344|dbj|BAG22864.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 161

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/146 (28%), Positives = 60/146 (41%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 ++D+G  RIG+A  DP    A P   +  + V      L   +        ++G
Sbjct: 9   RRGRRLAVDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLRQIVDEYEPIEVVLG 68

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EGP     R F          VP    DER+TTV+A Q +    V  KK   
Sbjct: 69  LPRSLGGGEGPAAAKVREFAQVFARSIAPVPVRLVDERMTTVTAAQGMRASGVKSKKGRS 128

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            +D  AA +ILQ  L+      +  G
Sbjct: 129 VIDQAAAVVILQNALESERASGNPPG 154


>gi|227874508|ref|ZP_03992680.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Oribacterium sinus F0268]
 gi|227839652|gb|EEJ50110.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Oribacterium sinus F0268]
          Length = 141

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 43/136 (31%), Positives = 77/136 (56%), Gaps = 4/136 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I ++D G+K +GLAI+DP      P   + R+   K+ +T  E+        +   ++
Sbjct: 1   MRILALDYGSKTVGLAITDPLGIIVQPLKTIWREREGKLRKTVEEIQETCKEYQVEELVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P +M+GSEG RV    AF    + +K+ +P   +DERL+T+ A++IL +  V + ++ 
Sbjct: 61  GYPCHMDGSEGERVERVLAFQEM-LKKKIELPIHLYDERLSTMEAEEILRENGVPKDRQK 119

Query: 134 QKVDSIAAALILQEVL 149
           + +D +AA +IL++ L
Sbjct: 120 EVLDQVAAQVILEDYL 135


>gi|332637231|ref|ZP_08416094.1| Holliday junction resolvase-like protein [Weissella cibaria KACC
           11862]
          Length = 144

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 48/139 (34%), Positives = 77/139 (55%), Gaps = 4/139 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFII 73
              +  +D+G++ +G+A+SD     A     +   +  +      +   +       F++
Sbjct: 1   MGRVMGLDVGSRTVGVAVSDLLGWTAQGVEIIRINEDEKEFGIARMKELVAQFQPTGFVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKR 132
           GLP NMN + GPRV + RA+   ++     +P  F DERLTTV A+++L++  + SRKKR
Sbjct: 61  GLPKNMNNTSGPRVDAARAYGD-LLTETFGLPIDFQDERLTTVEAERMLVEEADASRKKR 119

Query: 133 IQKVDSIAAALILQEVLDR 151
            Q +D +AAALILQ  LDR
Sbjct: 120 KQVIDKLAAALILQNYLDR 138


>gi|294102018|ref|YP_003553876.1| Holliday junction resolvase YqgF [Aminobacterium colombiense DSM
           12261]
 gi|293616998|gb|ADE57152.1| Holliday junction resolvase YqgF [Aminobacterium colombiense DSM
           12261]
          Length = 138

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 57/135 (42%), Positives = 79/135 (58%), Gaps = 2/135 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I ++D+G KRIG+A+SDP   FA    F+   K  +  L+L   + + N+   +IG 
Sbjct: 1   MGRILALDIGEKRIGMAVSDPLGCFAQGVGFIPMNK--EWLLKLDESLISLNVEMLLIGN 58

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PL  NG+ GP     +     +  R  ++  V WDER TT  AQQ+L++ NVSRKKR +K
Sbjct: 59  PLRTNGTAGPETDKIKNIAAELKIRYPHISIVLWDERFTTSIAQQVLLEGNVSRKKRKEK 118

Query: 136 VDSIAAALILQEVLD 150
           VD +AAALILQ  LD
Sbjct: 119 VDQLAAALILQNYLD 133


>gi|320011911|gb|ADW06761.1| Holliday junction resolvase YqgF [Streptomyces flavogriseus ATCC
           33331]
          Length = 157

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/146 (31%), Positives = 62/146 (42%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 +ID+G  RIG+A  DP    A P   +  + V      L   +        I+G
Sbjct: 5   RRGRRLAIDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLGQIVEEYEPIEVIVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EGP     RAF          +P    DER+TTV+A Q L    V  KK   
Sbjct: 65  LPRSLGGGEGPAAAKVRAFAQVFARAVAPIPVRLLDERMTTVTATQGLRASGVKSKKGRS 124

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            +D  AA +ILQ  L+      S+ G
Sbjct: 125 VIDQAAAVVILQNALESERASGSAPG 150


>gi|229019608|ref|ZP_04176421.1| Holliday junction resolvase [Bacillus cereus AH1273]
 gi|229025846|ref|ZP_04182244.1| Holliday junction resolvase [Bacillus cereus AH1272]
 gi|228735457|gb|EEL86054.1| Holliday junction resolvase [Bacillus cereus AH1272]
 gi|228741688|gb|EEL91875.1| Holliday junction resolvase [Bacillus cereus AH1273]
          Length = 137

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/137 (33%), Positives = 75/137 (54%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+GTK +G+A+SD     A     +    ++       +   +    +   ++G
Sbjct: 1   MRILGLDVGTKTVGVAMSDEMGWTAQGLETIKINEERGHFGFDRISELVKQYGVDKIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ GPR  + + F    +   + +  V WDERL+T++A+++LI  +VSRKKR Q
Sbjct: 61  LPKNMNGTIGPRGEACQQFAE-NLRELLQLDVVMWDERLSTMAAERLLISADVSRKKRKQ 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LD 
Sbjct: 120 VIDKMAAVVILQGFLDS 136


>gi|25012082|ref|NP_736477.1| Holliday junction resolvase-like protein [Streptococcus agalactiae
           NEM316]
 gi|54039588|sp|P67493|RUVX_STRA5 RecName: Full=Putative Holliday junction resolvase
 gi|54042292|sp|P67492|RUVX_STRA3 RecName: Full=Putative Holliday junction resolvase
 gi|118597222|sp|Q3JYN4|RUVX_STRA1 RecName: Full=Putative Holliday junction resolvase
 gi|24413626|emb|CAD47703.1| Unknown [Streptococcus agalactiae NEM316]
          Length = 139

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 49/139 (35%), Positives = 78/139 (56%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +    +        L   +    +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIKIDEESGNFGFDRLAELVKEYKVDKFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I     +P  + DERLTTV A+++L++  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGD-KITELFNLPVEYQDERLTTVQAERMLVEQADISRGKRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA LILQ  LDR+
Sbjct: 120 KVIDKLAAQLILQNYLDRM 138


>gi|319408539|emb|CBI82192.1| putative resolvase [Bartonella schoenbuchensis R1]
          Length = 159

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 83/160 (51%), Positives = 111/160 (69%), Gaps = 1/160 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ I ++   L P Q IA +DLGTK IG+AISD    F++PRP + RKK T  AL L+
Sbjct: 1   MAVINIHEITTHLLPKQTIAGLDLGTKTIGIAISDISLTFSNPRPVIQRKKFTLDALTLV 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                EN+   +IGLP+NM+GS GPRV +TR FV NM      +PFVFWDERL+T++AQ+
Sbjct: 61  QIFNNENVGVAVIGLPVNMDGSNGPRVQATRTFVSNM-GAYTKIPFVFWDERLSTIAAQR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESSKG 160
            L++M+VSR KR  ++DS AAA ILQ VLDRI  L  ++G
Sbjct: 120 SLLEMDVSRAKRAARIDSAAAAFILQGVLDRIQNLNHTEG 159


>gi|312866891|ref|ZP_07727104.1| RNAse H domain protein, YqgF family [Streptococcus parasanguinis
           F0405]
 gi|311097674|gb|EFQ55905.1| RNAse H domain protein, YqgF family [Streptococcus parasanguinis
           F0405]
          Length = 139

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 49/138 (35%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+A+SDP    A     +     K       L   +    +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAVSDPLGFTAQGLEIIQIDEDKREFGLERLAELVAQYKVDRFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+   + ++   +P  + DERLTTV+A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGTMIAEKF-GLPVDYQDERLTTVAAERMLIEQADISRSKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|260642386|ref|ZP_05415682.2| putative Holliday junction resolvase [Bacteroides finegoldii DSM
           17565]
 gi|260622253|gb|EEX45124.1| putative Holliday junction resolvase [Bacteroides finegoldii DSM
           17565]
          Length = 141

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/144 (29%), Positives = 70/144 (48%), Gaps = 5/144 (3%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           + P   I +ID G KR G+A+SD  +  A+    +   ++     +   +I  E +   I
Sbjct: 1   MCPMSRIVAIDYGRKRTGIAVSDTMQLIANGLTTVPTHELLNFIGD---YIAKEPVERII 57

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           IGLP  MN      + +   FV ++  R   +P  + DER T+V A + +++  + +K R
Sbjct: 58  IGLPKQMNNEVSENMKNIEPFVRSLKKRFPELPVEYVDERFTSVLAHRTMLEAGLKKKDR 117

Query: 133 --IQKVDSIAAALILQEVLDRISF 154
                VD I+A +ILQ  L+   F
Sbjct: 118 QNKALVDEISATIILQTYLESKRF 141


>gi|295092925|emb|CBK82016.1| conserved hypothetical protein TIGR00250 [Coprococcus sp. ART55/1]
          Length = 149

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 56/144 (38%), Positives = 81/144 (56%), Gaps = 11/144 (7%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAA--- 70
             I  +D GTK +G+A+SDP +  A P   + RK   K+ QT   + + +     A    
Sbjct: 1   MRILGLDYGTKTVGVAVSDPLKMTAQPLETIERKSANKLRQTLARIEAILEEYGAAGERD 60

Query: 71  ----FIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMN 126
                ++G P NMN SEG R  +T+AF    ++R+  +  V WDERLTTV A++IL+D  
Sbjct: 61  RIELIVLGYPKNMNNSEGDRCEATQAF-KEDLERRTGLEVVLWDERLTTVEAERILMDSG 119

Query: 127 VSRKKRIQKVDSIAAALILQEVLD 150
           V R+ R   +D +AAA+ILQ  LD
Sbjct: 120 VRRENRKTYIDKMAAAVILQNYLD 143


>gi|288574978|ref|ZP_06393335.1| Holliday junction resolvase YqgF [Dethiosulfovibrio peptidovorans
           DSM 11002]
 gi|288570719|gb|EFC92276.1| Holliday junction resolvase YqgF [Dethiosulfovibrio peptidovorans
           DSM 11002]
          Length = 138

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 78/137 (56%), Gaps = 2/137 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + I ++D+GT RIG+A+SDP   FA        +       +L   +T+ +++  ++GLP
Sbjct: 3   RRIVALDMGTVRIGVAMSDPLGSFAQGVAVWDAE--GDWLSDLRDLVTSRDVSTVVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           +  NG++GP   +  A    + +    +  V WDER T+  A ++LI+ +VSRKKR  +V
Sbjct: 61  IRENGTKGPSAENVEAKTEAVREAFPDLEIVMWDERYTSTIANRVLIEGDVSRKKRKGQV 120

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA +ILQ  LD + 
Sbjct: 121 DKVAATVILQGYLDSLR 137


>gi|296170782|ref|ZP_06852354.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295894597|gb|EFG74334.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 169

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/140 (29%), Positives = 57/140 (40%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
                   +D+G+ RIG+A SDP    A P   + R +  +    L            ++
Sbjct: 19  PGRGRRLGVDVGSVRIGVACSDPDGILATPVETVRRDRSGKHVRRLAELAAELGAVEVVV 78

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP  +    GP           +  R    P    DERLTTVSAQ+ L    V  K++ 
Sbjct: 79  GLPRTLADRTGPSALDAMELADTLAQRLAPTPVRLADERLTTVSAQRSLRAAGVRAKEQR 138

Query: 134 QKVDSIAAALILQEVLDRIS 153
             +D  AA  ILQ  LD+  
Sbjct: 139 AVIDQAAAVAILQSWLDQRR 158


>gi|294643795|ref|ZP_06721593.1| RNAse YqgF [Bacteroides ovatus SD CC 2a]
 gi|294808455|ref|ZP_06767208.1| RNAse YqgF [Bacteroides xylanisolvens SD CC 1b]
 gi|292640884|gb|EFF59104.1| RNAse YqgF [Bacteroides ovatus SD CC 2a]
 gi|294444383|gb|EFG13097.1| RNAse YqgF [Bacteroides xylanisolvens SD CC 1b]
          Length = 141

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/144 (29%), Positives = 70/144 (48%), Gaps = 5/144 (3%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           + P   I +ID G KR G+A+SD  +  A+    +   ++     E   ++  E +   I
Sbjct: 1   MYPMSRIVAIDYGRKRTGIAVSDTMQLIANGLTTVPTHELLNFIGE---YMAKEPVERII 57

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           IGLP  MN      + +   FV ++  R   +P  + DER T+V A + +++  + +K R
Sbjct: 58  IGLPKQMNNEVSENMKNIEPFVRSLNKRYPDLPVEYVDERFTSVLAHRTMLEAGLKKKDR 117

Query: 133 --IQKVDSIAAALILQEVLDRISF 154
                VD I+A +ILQ  L+   F
Sbjct: 118 QNKALVDEISATIILQTYLESKRF 141


>gi|239939939|ref|ZP_04691876.1| hypothetical protein SrosN15_02984 [Streptomyces roseosporus NRRL
           15998]
 gi|239986423|ref|ZP_04707087.1| hypothetical protein SrosN1_03861 [Streptomyces roseosporus NRRL
           11379]
 gi|291443370|ref|ZP_06582760.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
 gi|291346317|gb|EFE73221.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
          Length = 157

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 43/146 (29%), Positives = 60/146 (41%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 ++D+G  RIG+A  DP    A P   +  + V      L   +        I+G
Sbjct: 5   RRGRRLAVDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLRQIVEEYEPIEVILG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EGP     R F          VP    DER+TTV+A Q +    V  KK   
Sbjct: 65  LPRSLGGGEGPAAAKVRDFAQVFARSIAPVPVRLVDERMTTVTAAQGMRASGVKSKKGRS 124

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            +D  AA +ILQ  L+      +  G
Sbjct: 125 VIDQAAAVVILQNALESERASGNPPG 150


>gi|324005505|gb|EGB74724.1| hypothetical protein HMPREF9532_04857 [Escherichia coli MS 57-2]
          Length = 138

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           +DS +A +IL+   ++
Sbjct: 121 IDSASAVIILESYFEQ 136


>gi|16130850|ref|NP_417424.1| predicted Holliday junction resolvase [Escherichia coli str. K-12
           substr. MG1655]
 gi|26249370|ref|NP_755410.1| Holliday junction resolvase-like protein [Escherichia coli CFT073]
 gi|89109726|ref|AP_003506.1| predicted Holliday junction resolvase [Escherichia coli str. K-12
           substr. W3110]
 gi|91212331|ref|YP_542317.1| Holliday junction resolvase-like protein [Escherichia coli UTI89]
 gi|110643098|ref|YP_670828.1| Holliday junction resolvase-like protein [Escherichia coli 536]
 gi|117625176|ref|YP_854164.1| Holliday junction resolvase-like protein [Escherichia coli APEC O1]
 gi|157162408|ref|YP_001459726.1| Holliday junction resolvase-like protein [Escherichia coli HS]
 gi|170018810|ref|YP_001723764.1| Holliday junction resolvase-like protein [Escherichia coli ATCC
           8739]
 gi|170082501|ref|YP_001731821.1| Holliday junction resolvase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|188491785|ref|ZP_02999055.1| putative Holliday junction resolvase [Escherichia coli 53638]
 gi|191171877|ref|ZP_03033423.1| putative Holliday junction resolvase [Escherichia coli F11]
 gi|218559940|ref|YP_002392853.1| Holliday junction resolvase-like protein [Escherichia coli S88]
 gi|218691073|ref|YP_002399285.1| Holliday junction resolvase-like protein [Escherichia coli ED1a]
 gi|218696547|ref|YP_002404214.1| Holliday junction resolvase-like protein [Escherichia coli 55989]
 gi|238902071|ref|YP_002927867.1| putative Holliday junction resolvase [Escherichia coli BW2952]
 gi|253772213|ref|YP_003035044.1| Holliday junction resolvase-like protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|256024542|ref|ZP_05438407.1| Holliday junction resolvase-like protein [Escherichia sp. 4_1_40B]
 gi|293412309|ref|ZP_06655032.1| hypothetical protein ECEG_02316 [Escherichia coli B354]
 gi|300824850|ref|ZP_07104953.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           119-7]
 gi|300906487|ref|ZP_07124182.1| hypothetical protein HMPREF9536_04449 [Escherichia coli MS 84-1]
 gi|300921290|ref|ZP_07137659.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           115-1]
 gi|300940769|ref|ZP_07155315.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS 21-1]
 gi|300947679|ref|ZP_07161848.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           116-1]
 gi|300954205|ref|ZP_07166670.1| hypothetical protein HMPREF9547_00152 [Escherichia coli MS 175-1]
 gi|300980101|ref|ZP_07174844.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS 45-1]
 gi|300995470|ref|ZP_07181118.1| hypothetical protein HMPREF9553_04608 [Escherichia coli MS 200-1]
 gi|301027300|ref|ZP_07190646.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS 69-1]
 gi|301027726|ref|ZP_07191036.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           196-1]
 gi|301049256|ref|ZP_07196229.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           185-1]
 gi|301306394|ref|ZP_07212463.1| hypothetical protein HMPREF9347_05007 [Escherichia coli MS 124-1]
 gi|301327365|ref|ZP_07220615.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS 78-1]
 gi|301643698|ref|ZP_07243737.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           146-1]
 gi|306812147|ref|ZP_07446345.1| Holliday junction resolvase-like protein [Escherichia coli NC101]
 gi|307139634|ref|ZP_07498990.1| Holliday junction resolvase-like protein [Escherichia coli H736]
 gi|312972810|ref|ZP_07786983.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|331643642|ref|ZP_08344773.1| putative Holliday junction resolvase [Escherichia coli H736]
 gi|331648704|ref|ZP_08349792.1| putative Holliday junction resolvase [Escherichia coli M605]
 gi|331659084|ref|ZP_08360026.1| putative Holliday junction resolvase [Escherichia coli TA206]
 gi|331669692|ref|ZP_08370538.1| putative Holliday junction resolvase [Escherichia coli TA271]
 gi|331678941|ref|ZP_08379615.1| putative Holliday junction resolvase [Escherichia coli H591]
 gi|67472397|sp|P0A8I1|RUVX_ECOLI RecName: Full=Putative Holliday junction resolvase
 gi|67472398|sp|P0A8I2|RUVX_ECOL6 RecName: Full=Putative Holliday junction resolvase
 gi|118597209|sp|Q0TDQ2|RUVX_ECOL5 RecName: Full=Putative Holliday junction resolvase
 gi|146325571|sp|Q1R778|RUVX_ECOUT RecName: Full=Putative Holliday junction resolvase
 gi|167012719|sp|A8A489|RUVX_ECOHS RecName: Full=Putative Holliday junction resolvase
 gi|167012720|sp|A1AFD5|RUVX_ECOK1 RecName: Full=Putative Holliday junction resolvase
 gi|189046095|sp|B1IT58|RUVX_ECOLC RecName: Full=Putative Holliday junction resolvase
 gi|226725515|sp|B7MMD7|RUVX_ECO45 RecName: Full=Putative Holliday junction resolvase
 gi|226725519|sp|B1XFA9|RUVX_ECODH RecName: Full=Putative Holliday junction resolvase
 gi|254767515|sp|B7LFL2|RUVX_ECO55 RecName: Full=Putative Holliday junction resolvase
 gi|254767516|sp|B7MZP8|RUVX_ECO81 RecName: Full=Putative Holliday junction resolvase
 gi|259495702|sp|C5A0L8|RUVX_ECOBW RecName: Full=Putative Holliday junction resolvase
 gi|46014935|pdb|1NMN|A Chain A, Structure Of Yqgf From Escherichia Coli, A Hypothetical
           Protein
 gi|46014936|pdb|1NMN|B Chain B, Structure Of Yqgf From Escherichia Coli, A Hypothetical
           Protein
 gi|26109778|gb|AAN81983.1|AE016766_71 Hypothetical protein yqgF [Escherichia coli CFT073]
 gi|1789318|gb|AAC75986.1| predicted Holliday junction resolvase [Escherichia coli str. K-12
           substr. MG1655]
 gi|85675759|dbj|BAE77012.1| predicted Holliday junction resolvase [Escherichia coli str. K12
           substr. W3110]
 gi|91073905|gb|ABE08786.1| hypothetical protein UTI89_C3338 [Escherichia coli UTI89]
 gi|110344690|gb|ABG70927.1| hypothetical protein YqgF [Escherichia coli 536]
 gi|115514300|gb|ABJ02375.1| Holliday junction resolvase-like protein [Escherichia coli APEC O1]
 gi|157068088|gb|ABV07343.1| conserved hypothetical protein TIGR00250 [Escherichia coli HS]
 gi|169753738|gb|ACA76437.1| Holliday junction resolvase YqgF [Escherichia coli ATCC 8739]
 gi|169890336|gb|ACB04043.1| predicted Holliday junction resolvase [Escherichia coli str. K-12
           substr. DH10B]
 gi|188486984|gb|EDU62087.1| putative Holliday junction resolvase [Escherichia coli 53638]
 gi|190907912|gb|EDV67505.1| putative Holliday junction resolvase [Escherichia coli F11]
 gi|218353279|emb|CAU99238.1| Holliday junction resolvase [Escherichia coli 55989]
 gi|218366709|emb|CAR04466.1| Holliday junction resolvase [Escherichia coli S88]
 gi|218428637|emb|CAR09566.2| Holliday junction resolvase [Escherichia coli ED1a]
 gi|222034644|emb|CAP77386.1| Holliday junction resolvase [Escherichia coli LF82]
 gi|238862456|gb|ACR64454.1| predicted Holliday junction resolvase [Escherichia coli BW2952]
 gi|253323257|gb|ACT27859.1| Holliday junction resolvase YqgF [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|260448008|gb|ACX38430.1| Holliday junction resolvase YqgF [Escherichia coli DH1]
 gi|281179958|dbj|BAI56288.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|284922892|emb|CBG35981.1| putative holliday junction resolvase [Escherichia coli 042]
 gi|291469080|gb|EFF11571.1| hypothetical protein ECEG_02316 [Escherichia coli B354]
 gi|294491308|gb|ADE90064.1| conserved hypothetical protein TIGR00250 [Escherichia coli IHE3034]
 gi|299879162|gb|EFI87373.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           196-1]
 gi|300298952|gb|EFJ55337.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           185-1]
 gi|300304832|gb|EFJ59352.1| hypothetical protein HMPREF9553_04608 [Escherichia coli MS 200-1]
 gi|300318789|gb|EFJ68573.1| hypothetical protein HMPREF9547_00152 [Escherichia coli MS 175-1]
 gi|300395106|gb|EFJ78644.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS 69-1]
 gi|300401730|gb|EFJ85268.1| hypothetical protein HMPREF9536_04449 [Escherichia coli MS 84-1]
 gi|300409358|gb|EFJ92896.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS 45-1]
 gi|300411752|gb|EFJ95062.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           115-1]
 gi|300452725|gb|EFK16345.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           116-1]
 gi|300454469|gb|EFK17962.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS 21-1]
 gi|300522688|gb|EFK43757.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           119-7]
 gi|300838389|gb|EFK66149.1| hypothetical protein HMPREF9347_05007 [Escherichia coli MS 124-1]
 gi|300846049|gb|EFK73809.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS 78-1]
 gi|301077900|gb|EFK92706.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           146-1]
 gi|305854185|gb|EFM54623.1| Holliday junction resolvase-like protein [Escherichia coli NC101]
 gi|307625477|gb|ADN69781.1| Holliday junction resolvase-like protein [Escherichia coli UM146]
 gi|309703304|emb|CBJ02640.1| putative holliday junction resolvase [Escherichia coli ETEC H10407]
 gi|310332752|gb|EFP99965.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|312947480|gb|ADR28307.1| Holliday junction resolvase-like protein [Escherichia coli O83:H1
           str. NRG 857C]
 gi|315137546|dbj|BAJ44705.1| Holliday junction resolvase-like protein [Escherichia coli DH1]
 gi|315256841|gb|EFU36809.1| putative Holliday junction resolvase [Escherichia coli MS 85-1]
 gi|315293937|gb|EFU53289.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           153-1]
 gi|315295638|gb|EFU54961.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS 16-3]
 gi|315614890|gb|EFU95528.1| conserved hypothetical protein [Escherichia coli 3431]
 gi|320195068|gb|EFW69697.1| Putative Holliday junction resolvase [Escherichia coli WV_060327]
 gi|323188657|gb|EFZ73942.1| hypothetical protein ECRN5871_3077 [Escherichia coli RN587/1]
 gi|323936048|gb|EGB32343.1| hypothetical protein ERCG_02812 [Escherichia coli E1520]
 gi|323941965|gb|EGB38144.1| hypothetical protein ERDG_01740 [Escherichia coli E482]
 gi|323951613|gb|EGB47488.1| hypothetical protein ERKG_02256 [Escherichia coli H252]
 gi|323971704|gb|EGB66932.1| hypothetical protein ERHG_02242 [Escherichia coli TA007]
 gi|324011800|gb|EGB81019.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS 60-1]
 gi|324119744|gb|EGC13624.1| hypothetical protein ERBG_00332 [Escherichia coli E1167]
 gi|330908984|gb|EGH37498.1| putative Holliday junction resolvase [Escherichia coli AA86]
 gi|331037113|gb|EGI09337.1| putative Holliday junction resolvase [Escherichia coli H736]
 gi|331042451|gb|EGI14593.1| putative Holliday junction resolvase [Escherichia coli M605]
 gi|331053666|gb|EGI25695.1| putative Holliday junction resolvase [Escherichia coli TA206]
 gi|331063360|gb|EGI35273.1| putative Holliday junction resolvase [Escherichia coli TA271]
 gi|331073771|gb|EGI45092.1| putative Holliday junction resolvase [Escherichia coli H591]
 gi|332344848|gb|AEE58182.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 138

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYFEQ 136


>gi|332365435|gb|EGJ43196.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           SK355]
          Length = 139

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 50/138 (36%), Positives = 79/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +     K       L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIPIHEDKGEFGLERLGELVKEYKVDKFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+   + +    +P  + DERLTTV+A+++L++  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGQRVAE-LFGLPVDYQDERLTTVAAERMLVEQADISRSKRR 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|296875599|ref|ZP_06899670.1| crossover junction endodeoxyribonuclease [Streptococcus
           parasanguinis ATCC 15912]
 gi|296433396|gb|EFH19172.1| crossover junction endodeoxyribonuclease [Streptococcus
           parasanguinis ATCC 15912]
          Length = 139

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 49/138 (35%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+A+SDP    A     +     K       L   +    +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAVSDPLGFTAQGLEIIQIDEDKKEFGLERLAELVAQYKVDRFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+   + ++   +P  + DERLTTV+A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGTMIAEKF-GLPVDYQDERLTTVAAERMLIEQADISRSKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|254253087|ref|ZP_04946405.1| hypothetical protein BDAG_02337 [Burkholderia dolosa AUO158]
 gi|124895696|gb|EAY69576.1| hypothetical protein BDAG_02337 [Burkholderia dolosa AUO158]
          Length = 149

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 36/144 (25%), Positives = 69/144 (47%), Gaps = 1/144 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            +  + + D G KRIG+AI +   R A     +           +   +      A ++G
Sbjct: 7   RDATLLAFDYGEKRIGVAIGNALTRSARALVVIPNLNREHRFKAVGDLLAEWRPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+        + F +  ++ +  +P  + DER ++V A+  L + NV  + R+ 
Sbjct: 67  LPMHPDGTPHDMTQQAKRFGN-QLNGRFGLPVAWVDERYSSVEAEAGLRERNVRGRARVD 125

Query: 135 KVDSIAAALILQEVLDRISFLESS 158
            +D+ AA +ILQ+ LD++S  E  
Sbjct: 126 MLDAEAARVILQQYLDQLSDHEHH 149


>gi|226366326|ref|YP_002784109.1| Holliday junction resolvase-like protein [Rhodococcus opacus B4]
 gi|254767522|sp|C1B4H5|RUVX_RHOOB RecName: Full=Putative Holliday junction resolvase
 gi|226244816|dbj|BAH55164.1| putative Holliday junction resolvase [Rhodococcus opacus B4]
          Length = 178

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/144 (29%), Positives = 59/144 (40%), Gaps = 4/144 (2%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVT----QTALELLSFITTENIA 69
                   ID+G+ RIG+A SDP    A P   + R K           +   +      
Sbjct: 16  PGRGRRIGIDVGSVRIGVASSDPDGILATPVETVPRSKDRGPDAPDIRRIADIVEEYEAV 75

Query: 70  AFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR 129
             I+GLP  + G  G        F   +  +   +P    DERLTTV+A + L +  VS 
Sbjct: 76  EVIVGLPQTLRGERGKAASIATVFAKRLRRKVDPIPVRMADERLTTVTAARALRESGVSA 135

Query: 130 KKRIQKVDSIAAALILQEVLDRIS 153
           + +   +D  AA  ILQ  LD  S
Sbjct: 136 RGQRPVIDQAAAVAILQGWLDERS 159


>gi|224539751|ref|ZP_03680290.1| hypothetical protein BACCELL_04660 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224518629|gb|EEF87734.1| hypothetical protein BACCELL_04660 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 140

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 38/141 (26%), Positives = 67/141 (47%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++    L+   ++  E +   ++GL
Sbjct: 1   MSRILAIDYGKKRTGIAVSDTLQMIANGLTTVPTHELLTFILD---YVGKEPVERILVGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      +     FV  +  +   +P  + DER T+V A + +++  + +K R   
Sbjct: 58  PKQMNNEASENMKRIEPFVRLLKKKLPAMPVEYVDERFTSVLAHRTMLEAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   F
Sbjct: 118 ALVDEISATIILQSYLENKRF 138


>gi|282866221|ref|ZP_06275268.1| Holliday junction resolvase YqgF [Streptomyces sp. ACTE]
 gi|282559005|gb|EFB64560.1| Holliday junction resolvase YqgF [Streptomyces sp. ACTE]
          Length = 154

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 44/146 (30%), Positives = 64/146 (43%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 +ID+G  RIG+A  DP    A P   +  + V      L   +        ++G
Sbjct: 2   RRGRRLAIDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLGRIVEEYEPIEVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EGP     RAF   +      VP    DER++TV+A Q L    V+ KK   
Sbjct: 62  LPRSLGGGEGPAAVKVRAFAQVLARAIAPVPVRLVDERMSTVTATQGLRASGVTSKKGRS 121

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            +D  AA +ILQ  L+      ++ G
Sbjct: 122 VIDQAAAVVILQNALESERASGAAPG 147


>gi|322374034|ref|ZP_08048568.1| putative Holliday junction resolvase [Streptococcus sp. C150]
 gi|321277000|gb|EFX54071.1| putative Holliday junction resolvase [Streptococcus sp. C150]
          Length = 139

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 50/139 (35%), Positives = 80/139 (57%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV--TQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+AISDP    A     +   +         L   +    +  F++G
Sbjct: 1   MRVMGLDVGSKTVGVAISDPLGFTAQGVEIIKIDEEAEEFGFDRLGELVKEYKVDKFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN +EGPRV +++A+ +  I     +P  + DERLTTV A+++L++  +VSR KR 
Sbjct: 61  LPKNMNNTEGPRVEASKAYGN-KIKEIFGIPVDYQDERLTTVQAERMLVEQADVSRGKRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA LILQ  LDR+
Sbjct: 120 KVIDKLAAQLILQNYLDRM 138


>gi|229543745|ref|ZP_04432805.1| Holliday junction resolvase YqgF [Bacillus coagulans 36D1]
 gi|229328165|gb|EEN93840.1| Holliday junction resolvase YqgF [Bacillus coagulans 36D1]
          Length = 138

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/137 (30%), Positives = 75/137 (54%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFL--VRKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+A+SD     A     +     K       +        +   ++G
Sbjct: 1   MKIMGLDVGSKTVGVAVSDALGWTAQGIETIAINEAKGKFGFDRVAELAQIHGVEKIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            P NMN + GPR  +++ +    + +++ +P + WDERL+T  A++IL++ +VSRKKR +
Sbjct: 61  FPKNMNNTIGPRAEASKVYAE-ELKKRLNLPVILWDERLSTAQAERILLEADVSRKKRKK 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA++ILQ  LD 
Sbjct: 120 VIDKMAASVILQGFLDS 136


>gi|225869409|ref|YP_002745357.1| Holliday junction resolvase [Streptococcus equi subsp.
           zooepidemicus]
 gi|259495714|sp|C0MGB3|RUVX_STRS7 RecName: Full=Putative Holliday junction resolvase
 gi|225702685|emb|CAX00789.1| putative Holliday junction resolvase [Streptococcus equi subsp.
           zooepidemicus]
          Length = 139

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 78/137 (56%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +     K       L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIKINEDKQDFGFDRLAELVKQYQVDRFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I+   ++P  + DERLTTV A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASKAYGD-RIEELFHIPVSYQDERLTTVEAERMLIEQADISRGKRK 119

Query: 134 QKVDSIAAALILQEVLD 150
           + +D +AA LILQ  LD
Sbjct: 120 KVIDKLAAQLILQNYLD 136


>gi|194398342|ref|YP_002036896.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           G54]
 gi|226695305|sp|B5E6E1|RUVX_STRP4 RecName: Full=Putative Holliday junction resolvase
 gi|194358009|gb|ACF56457.1| conserved hypothetical protein [Streptococcus pneumoniae G54]
          Length = 139

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 49/138 (35%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +         +   + T  +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGXEIIQINEEQGQFGFDRVKELVDTYKVERFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    ++    +P  + DERLTTV+A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGA-KLEEFFGLPVDYQDERLTTVAAERMLIEQADISRNKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|282856373|ref|ZP_06265652.1| RNAse YqgF [Pyramidobacter piscolens W5455]
 gi|282585744|gb|EFB91033.1| RNAse YqgF [Pyramidobacter piscolens W5455]
          Length = 140

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 48/135 (35%), Positives = 68/135 (50%), Gaps = 2/135 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I  +D+GT RIG+A+SDP   FA                EL       +    ++GL
Sbjct: 1   MPRIICLDVGTVRIGVAVSDPLGMFAQGIAVWKAD--GPWLDELERAFERYDTGCLLVGL 58

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P+  +G+ GP     +  V  +  R   V   +WDER +T +A   L++ NVSR+KR Q 
Sbjct: 59  PIREDGTIGPSAQHVQDVVKEIQRRFPMVTVRYWDERYSTCTATSYLLEGNVSRRKRKQS 118

Query: 136 VDSIAAALILQEVLD 150
           VD IAAA+ILQ  +D
Sbjct: 119 VDKIAAAVILQSYMD 133


>gi|125972677|ref|YP_001036587.1| Holliday junction resolvase YqgF [Clostridium thermocellum ATCC
           27405]
 gi|256004836|ref|ZP_05429810.1| Holliday junction resolvase YqgF [Clostridium thermocellum DSM
           2360]
 gi|281416864|ref|ZP_06247884.1| Holliday junction resolvase YqgF [Clostridium thermocellum JW20]
 gi|167012716|sp|A3DBR5|RUVX_CLOTH RecName: Full=Putative Holliday junction resolvase
 gi|125712902|gb|ABN51394.1| Holliday junction resolvase YqgF [Clostridium thermocellum ATCC
           27405]
 gi|255991146|gb|EEU01254.1| Holliday junction resolvase YqgF [Clostridium thermocellum DSM
           2360]
 gi|281408266|gb|EFB38524.1| Holliday junction resolvase YqgF [Clostridium thermocellum JW20]
 gi|316941087|gb|ADU75121.1| Holliday junction resolvase YqgF [Clostridium thermocellum DSM
           1313]
          Length = 141

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/136 (33%), Positives = 65/136 (47%), Gaps = 1/136 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
             +  ID G  RIG+AISDP    A        R  V      +   +    +   I+G 
Sbjct: 1   MRVLGIDYGDSRIGIAISDPLGWTAQALETITWRSDVEVPLKRISELVEEYGVKTVIVGF 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NM+G+ G R   T  F+  +  R   +  + WDERLTTV+A + + +M + + K+   
Sbjct: 61  PKNMDGTVGARGEKTIEFIDLLQQRIKDIEVIKWDERLTTVAANRTMYEMGIKKSKKKLV 120

Query: 136 VDSIAAALILQEVLDR 151
           VD IAA  ILQ  LD 
Sbjct: 121 VDQIAAVYILQGYLDS 136


>gi|262283641|ref|ZP_06061406.1| conserved hypothetical protein [Streptococcus sp. 2_1_36FAA]
 gi|262260698|gb|EEY79399.1| conserved hypothetical protein [Streptococcus sp. 2_1_36FAA]
          Length = 139

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 81/138 (58%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELL-SFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A       + +   +   E L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEDQEEFGFERLGELVAEYKVDKFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV ++RA+   + +    +P  + DERLTTV+A+++LI+  +VSR KR 
Sbjct: 61  LPKNMNNTSGPRVEASRAYGAKVTE-LFGLPVEYQDERLTTVAAERMLIEQADVSRNKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|15803488|ref|NP_289521.1| Holliday junction resolvase-like protein [Escherichia coli O157:H7
           EDL933]
 gi|15833079|ref|NP_311852.1| Holliday junction resolvase-like protein [Escherichia coli O157:H7
           str. Sakai]
 gi|168747559|ref|ZP_02772581.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4113]
 gi|168753901|ref|ZP_02778908.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4401]
 gi|168760091|ref|ZP_02785098.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4501]
 gi|168766956|ref|ZP_02791963.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773412|ref|ZP_02798419.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4196]
 gi|168781808|ref|ZP_02806815.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4076]
 gi|168785807|ref|ZP_02810814.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC869]
 gi|168797524|ref|ZP_02822531.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC508]
 gi|195937087|ref|ZP_03082469.1| Holliday junction resolvase-like protein [Escherichia coli O157:H7
           str. EC4024]
 gi|208805896|ref|ZP_03248233.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208811883|ref|ZP_03253212.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208820347|ref|ZP_03260667.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209396593|ref|YP_002272429.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4115]
 gi|217327641|ref|ZP_03443724.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254794901|ref|YP_003079738.1| Holliday junction resolvase-like protein [Escherichia coli O157:H7
           str. TW14359]
 gi|261226261|ref|ZP_05940542.1| predicted Holliday junction resolvase [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261256481|ref|ZP_05949014.1| predicted Holliday junction resolvase [Escherichia coli O157:H7
           str. FRIK966]
 gi|291284270|ref|YP_003501088.1| putative Holliday junction resolvase [Escherichia coli O55:H7 str.
           CB9615]
 gi|32130044|sp|Q8XCV0|RUVX_ECO57 RecName: Full=Putative Holliday junction resolvase
 gi|226725516|sp|B5YQE7|RUVX_ECO5E RecName: Full=Putative Holliday junction resolvase
 gi|12517495|gb|AAG58080.1|AE005525_6 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|13363297|dbj|BAB37248.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|187770925|gb|EDU34769.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017800|gb|EDU55922.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4113]
 gi|189000577|gb|EDU69563.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189358781|gb|EDU77200.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189363715|gb|EDU82134.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189369432|gb|EDU87848.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4501]
 gi|189374231|gb|EDU92647.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC869]
 gi|189379713|gb|EDU98129.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC508]
 gi|208725697|gb|EDZ75298.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208733160|gb|EDZ81847.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208740470|gb|EDZ88152.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209157993|gb|ACI35426.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209760068|gb|ACI78346.1| hypothetical protein ECs3825 [Escherichia coli]
 gi|209760070|gb|ACI78347.1| hypothetical protein ECs3825 [Escherichia coli]
 gi|209760072|gb|ACI78348.1| hypothetical protein ECs3825 [Escherichia coli]
 gi|209760074|gb|ACI78349.1| hypothetical protein ECs3825 [Escherichia coli]
 gi|209760076|gb|ACI78350.1| hypothetical protein ECs3825 [Escherichia coli]
 gi|217320008|gb|EEC28433.1| putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254594301|gb|ACT73662.1| predicted Holliday junction resolvase [Escherichia coli O157:H7
           str. TW14359]
 gi|290764143|gb|ADD58104.1| Putative Holliday junction resolvase [Escherichia coli O55:H7 str.
           CB9615]
 gi|320189297|gb|EFW63956.1| Putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320640595|gb|EFX10134.1| Holliday junction resolvase-like protein [Escherichia coli O157:H7
           str. G5101]
 gi|320645842|gb|EFX14827.1| Holliday junction resolvase-like protein [Escherichia coli O157:H-
           str. 493-89]
 gi|320651142|gb|EFX19582.1| Holliday junction resolvase-like protein [Escherichia coli O157:H-
           str. H 2687]
 gi|320656638|gb|EFX24534.1| Holliday junction resolvase-like protein [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320662157|gb|EFX29558.1| Holliday junction resolvase-like protein [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320667233|gb|EFX34196.1| Holliday junction resolvase-like protein [Escherichia coli O157:H7
           str. LSU-61]
 gi|326338964|gb|EGD62779.1| Putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           1044]
 gi|326343155|gb|EGD66923.1| Putative Holliday junction resolvase [Escherichia coli O157:H7 str.
           1125]
          Length = 138

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNLIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           +DS +A +IL+   ++
Sbjct: 121 IDSASAVIILESYFEQ 136


>gi|24114204|ref|NP_708714.1| Holliday junction resolvase-like protein [Shigella flexneri 2a str.
           301]
 gi|30064265|ref|NP_838436.1| Holliday junction resolvase-like protein [Shigella flexneri 2a str.
           2457T]
 gi|74313506|ref|YP_311925.1| Holliday junction resolvase-like protein [Shigella sonnei Ss046]
 gi|82545428|ref|YP_409375.1| Holliday junction resolvase-like protein [Shigella boydii Sb227]
 gi|110806857|ref|YP_690377.1| Holliday junction resolvase-like protein [Shigella flexneri 5 str.
           8401]
 gi|157158748|ref|YP_001464301.1| Holliday junction resolvase-like protein [Escherichia coli E24377A]
 gi|170681746|ref|YP_001745110.1| Holliday junction resolvase-like protein [Escherichia coli SMS-3-5]
 gi|187731869|ref|YP_001881722.1| Holliday junction resolvase-like protein [Shigella boydii CDC
           3083-94]
 gi|191167958|ref|ZP_03029761.1| putative Holliday junction resolvase [Escherichia coli B7A]
 gi|193063467|ref|ZP_03044556.1| putative Holliday junction resolvase [Escherichia coli E22]
 gi|193067378|ref|ZP_03048346.1| putative Holliday junction resolvase [Escherichia coli E110019]
 gi|194426343|ref|ZP_03058898.1| putative Holliday junction resolvase [Escherichia coli B171]
 gi|194431639|ref|ZP_03063930.1| putative Holliday junction resolvase [Shigella dysenteriae 1012]
 gi|194436895|ref|ZP_03068995.1| putative Holliday junction resolvase [Escherichia coli 101-1]
 gi|215488247|ref|YP_002330678.1| Holliday junction resolvase-like protein [Escherichia coli O127:H6
           str. E2348/69]
 gi|218550196|ref|YP_002383987.1| Holliday junction resolvase-like protein [Escherichia fergusonii
           ATCC 35469]
 gi|218555508|ref|YP_002388421.1| Holliday junction resolvase-like protein [Escherichia coli IAI1]
 gi|218706464|ref|YP_002413983.1| Holliday junction resolvase-like protein [Escherichia coli UMN026]
 gi|254037998|ref|ZP_04872056.1| Holliday junction resolvase [Escherichia sp. 1_1_43]
 gi|256019249|ref|ZP_05433114.1| Holliday junction resolvase-like protein [Shigella sp. D9]
 gi|260845619|ref|YP_003223397.1| putative Holliday junction resolvase [Escherichia coli O103:H2 str.
           12009]
 gi|260857082|ref|YP_003230973.1| putative Holliday junction resolvase [Escherichia coli O26:H11 str.
           11368]
 gi|260869636|ref|YP_003236038.1| putative Holliday junction resolvase [Escherichia coli O111:H- str.
           11128]
 gi|293406456|ref|ZP_06650382.1| Holliday junction resolvase-like protein [Escherichia coli
           FVEC1412]
 gi|293449279|ref|ZP_06663700.1| hypothetical protein ECCG_02310 [Escherichia coli B088]
 gi|298382193|ref|ZP_06991790.1| Holliday junction resolvase [Escherichia coli FVEC1302]
 gi|300815581|ref|ZP_07095805.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           107-1]
 gi|300900234|ref|ZP_07118418.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           198-1]
 gi|300925055|ref|ZP_07140973.1| hypothetical protein HMPREF9548_03162 [Escherichia coli MS 182-1]
 gi|300928108|ref|ZP_07143653.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           187-1]
 gi|307310430|ref|ZP_07590078.1| Holliday junction resolvase YqgF [Escherichia coli W]
 gi|309794038|ref|ZP_07688463.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           145-7]
 gi|312964788|ref|ZP_07779028.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|331664532|ref|ZP_08365438.1| putative Holliday junction resolvase [Escherichia coli TA143]
 gi|331674430|ref|ZP_08375190.1| putative Holliday junction resolvase [Escherichia coli TA280]
 gi|331684576|ref|ZP_08385168.1| putative Holliday junction resolvase [Escherichia coli H299]
 gi|332280357|ref|ZP_08392770.1| holliday junction resolvase [Shigella sp. D9]
 gi|62901027|sp|Q83JS4|RUVX_SHIFL RecName: Full=Putative Holliday junction resolvase
 gi|123342527|sp|Q0T0U3|RUVX_SHIF8 RecName: Full=Putative Holliday junction resolvase
 gi|126352258|sp|Q3YXS2|RUVX_SHISS RecName: Full=Putative Holliday junction resolvase
 gi|146325606|sp|Q31WL1|RUVX_SHIBS RecName: Full=Putative Holliday junction resolvase
 gi|167012718|sp|A7ZR72|RUVX_ECO24 RecName: Full=Putative Holliday junction resolvase
 gi|226695304|sp|B2U0W9|RUVX_SHIB3 RecName: Full=Putative Holliday junction resolvase
 gi|226725518|sp|B7LYX9|RUVX_ECO8A RecName: Full=Putative Holliday junction resolvase
 gi|226725520|sp|B7N7K2|RUVX_ECOLU RecName: Full=Putative Holliday junction resolvase
 gi|226725522|sp|B1LDF8|RUVX_ECOSM RecName: Full=Putative Holliday junction resolvase
 gi|226725523|sp|B7LPR6|RUVX_ESCF3 RecName: Full=Putative Holliday junction resolvase
 gi|254767514|sp|B7UHZ6|RUVX_ECO27 RecName: Full=Putative Holliday junction resolvase
 gi|24053351|gb|AAN44421.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30042522|gb|AAP18246.1| hypothetical protein S3144 [Shigella flexneri 2a str. 2457T]
 gi|73856983|gb|AAZ89690.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81246839|gb|ABB67547.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|110616405|gb|ABF05072.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|157080778|gb|ABV20486.1| conserved hypothetical protein TIGR00250 [Escherichia coli E24377A]
 gi|170519464|gb|ACB17642.1| putative Holliday junction resolvase [Escherichia coli SMS-3-5]
 gi|187428861|gb|ACD08135.1| putative Holliday junction resolvase [Shigella boydii CDC 3083-94]
 gi|190902043|gb|EDV61789.1| putative Holliday junction resolvase [Escherichia coli B7A]
 gi|192930744|gb|EDV83349.1| putative Holliday junction resolvase [Escherichia coli E22]
 gi|192959335|gb|EDV89770.1| putative Holliday junction resolvase [Escherichia coli E110019]
 gi|194415651|gb|EDX31918.1| putative Holliday junction resolvase [Escherichia coli B171]
 gi|194419995|gb|EDX36073.1| putative Holliday junction resolvase [Shigella dysenteriae 1012]
 gi|194424377|gb|EDX40364.1| putative Holliday junction resolvase [Escherichia coli 101-1]
 gi|215266319|emb|CAS10750.1| predicted Holliday junction resolvase [Escherichia coli O127:H6
           str. E2348/69]
 gi|218357737|emb|CAQ90381.1| Holliday junction resolvase [Escherichia fergusonii ATCC 35469]
 gi|218362276|emb|CAQ99897.1| Holliday junction resolvase [Escherichia coli IAI1]
 gi|218433561|emb|CAR14464.1| Holliday junction resolvase [Escherichia coli UMN026]
 gi|226839622|gb|EEH71643.1| Holliday junction resolvase [Escherichia sp. 1_1_43]
 gi|257755731|dbj|BAI27233.1| predicted Holliday junction resolvase [Escherichia coli O26:H11
           str. 11368]
 gi|257760766|dbj|BAI32263.1| predicted Holliday junction resolvase [Escherichia coli O103:H2
           str. 12009]
 gi|257765992|dbj|BAI37487.1| predicted Holliday junction resolvase [Escherichia coli O111:H-
           str. 11128]
 gi|281602286|gb|ADA75270.1| putative Holliday junction resolvase [Shigella flexneri 2002017]
 gi|291322369|gb|EFE61798.1| hypothetical protein ECCG_02310 [Escherichia coli B088]
 gi|291426462|gb|EFE99494.1| Holliday junction resolvase-like protein [Escherichia coli
           FVEC1412]
 gi|298277333|gb|EFI18849.1| Holliday junction resolvase [Escherichia coli FVEC1302]
 gi|300356250|gb|EFJ72120.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           198-1]
 gi|300418801|gb|EFK02112.1| hypothetical protein HMPREF9548_03162 [Escherichia coli MS 182-1]
 gi|300463874|gb|EFK27367.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           187-1]
 gi|300531510|gb|EFK52572.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           107-1]
 gi|306909325|gb|EFN39820.1| Holliday junction resolvase YqgF [Escherichia coli W]
 gi|308122445|gb|EFO59707.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           145-7]
 gi|312290344|gb|EFR18224.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|313647999|gb|EFS12445.1| hypothetical protein SF2457T_3597 [Shigella flexneri 2a str. 2457T]
 gi|315062255|gb|ADT76582.1| predicted Holliday junction resolvase [Escherichia coli W]
 gi|320174055|gb|EFW49225.1| putative Holliday junction resolvase [Shigella dysenteriae CDC
           74-1112]
 gi|320181046|gb|EFW55967.1| Putative Holliday junction resolvase [Shigella boydii ATCC 9905]
 gi|320184296|gb|EFW59108.1| Putative Holliday junction resolvase [Shigella flexneri CDC 796-83]
 gi|323154658|gb|EFZ40857.1| hypothetical protein ECEPECA14_3458 [Escherichia coli EPECa14]
 gi|323162605|gb|EFZ48452.1| hypothetical protein ECE128010_1209 [Escherichia coli E128010]
 gi|323167999|gb|EFZ53688.1| hypothetical protein SS53G_1715 [Shigella sonnei 53G]
 gi|323173837|gb|EFZ59466.1| hypothetical protein ECLT68_2156 [Escherichia coli LT-68]
 gi|323180409|gb|EFZ65961.1| hypothetical protein ECOK1180_1091 [Escherichia coli 1180]
 gi|323183520|gb|EFZ68917.1| hypothetical protein ECOK1357_3299 [Escherichia coli 1357]
 gi|323377161|gb|ADX49429.1| Holliday junction resolvase YqgF [Escherichia coli KO11]
 gi|323946553|gb|EGB42576.1| hypothetical protein EREG_01795 [Escherichia coli H120]
 gi|323960758|gb|EGB56379.1| hypothetical protein ERGG_02693 [Escherichia coli H489]
 gi|323966466|gb|EGB61899.1| hypothetical protein ERJG_02055 [Escherichia coli M863]
 gi|323978756|gb|EGB73837.1| hypothetical protein ERFG_00347 [Escherichia coli TW10509]
 gi|324115036|gb|EGC09001.1| hypothetical protein ERIG_00364 [Escherichia fergusonii B253]
 gi|325498506|gb|EGC96365.1| Holliday junction resolvase-like protein [Escherichia fergusonii
           ECD227]
 gi|327251717|gb|EGE63403.1| hypothetical protein ECSTEC7V_3568 [Escherichia coli STEC_7v]
 gi|331058463|gb|EGI30444.1| putative Holliday junction resolvase [Escherichia coli TA143]
 gi|331068524|gb|EGI39919.1| putative Holliday junction resolvase [Escherichia coli TA280]
 gi|331078191|gb|EGI49397.1| putative Holliday junction resolvase [Escherichia coli H299]
 gi|332086878|gb|EGI92014.1| hypothetical protein SB521682_3504 [Shigella boydii 5216-82]
 gi|332087651|gb|EGI92778.1| hypothetical protein SD15574_3397 [Shigella dysenteriae 155-74]
 gi|332091359|gb|EGI96447.1| hypothetical protein SB359474_3535 [Shigella boydii 3594-74]
 gi|332102709|gb|EGJ06055.1| holliday junction resolvase [Shigella sp. D9]
 gi|332752992|gb|EGJ83376.1| hypothetical protein SF434370_3170 [Shigella flexneri 4343-70]
 gi|332753793|gb|EGJ84172.1| hypothetical protein SFK671_3523 [Shigella flexneri K-671]
 gi|332754509|gb|EGJ84875.1| hypothetical protein SF274771_3535 [Shigella flexneri 2747-71]
 gi|332765366|gb|EGJ95584.1| hypothetical protein SF293071_3447 [Shigella flexneri 2930-71]
 gi|332999696|gb|EGK19281.1| hypothetical protein SFVA6_3843 [Shigella flexneri VA-6]
 gi|333000337|gb|EGK19920.1| hypothetical protein SFK218_3952 [Shigella flexneri K-218]
 gi|333000451|gb|EGK20032.1| hypothetical protein SFK272_3772 [Shigella flexneri K-272]
 gi|333015023|gb|EGK34366.1| hypothetical protein SFK304_3754 [Shigella flexneri K-304]
 gi|333015289|gb|EGK34631.1| hypothetical protein SFK227_3745 [Shigella flexneri K-227]
          Length = 138

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNLIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYFEQ 136


>gi|254162859|ref|YP_003045967.1| Holliday junction resolvase-like protein [Escherichia coli B str.
           REL606]
 gi|297516337|ref|ZP_06934723.1| Holliday junction resolvase-like protein [Escherichia coli OP50]
 gi|242378475|emb|CAQ33259.1| predicted Holliday junction resolvase [Escherichia coli BL21(DE3)]
 gi|253974760|gb|ACT40431.1| Holliday junction resolvase-like protein [Escherichia coli B str.
           REL606]
 gi|253978926|gb|ACT44596.1| Holliday junction resolvase-like protein [Escherichia coli
           BL21(DE3)]
          Length = 138

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYFEQ 136


>gi|317476773|ref|ZP_07936016.1| hypothetical protein HMPREF1016_03000 [Bacteroides eggerthii
           1_2_48FAA]
 gi|316906948|gb|EFV28659.1| hypothetical protein HMPREF1016_03000 [Bacteroides eggerthii
           1_2_48FAA]
          Length = 141

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 38/141 (26%), Positives = 68/141 (48%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++    L+   ++  E +   ++GL
Sbjct: 1   MSRIIAIDYGKKRTGIAVSDTLQMIANGLTTVPTHELLAFILD---YVAKEPVERILVGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      +     FV ++  +   +P  + DER T+V A + +++  + +K R   
Sbjct: 58  PKQMNNEASENMKRIEPFVRSLKKKLPDMPVEYVDERFTSVLAHRTMLEAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   F
Sbjct: 118 ALVDEISATIILQTYLENKRF 138


>gi|157879567|pdb|1OVQ|A Chain A, Solution Structure Of The Hypothetical Protein Yqgf From
           Escherichia Coli
          Length = 138

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYFEQ 136


>gi|15902220|ref|NP_357770.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           R6]
 gi|116515819|ref|YP_815700.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           D39]
 gi|148983593|ref|ZP_01816912.1| hypothetical protein CGSSp3BS71_05664 [Streptococcus pneumoniae
           SP3-BS71]
 gi|148987930|ref|ZP_01819393.1| hypothetical protein CGSSp6BS73_10471 [Streptococcus pneumoniae
           SP6-BS73]
 gi|148992772|ref|ZP_01822415.1| hypothetical protein CGSSp9BS68_03488 [Streptococcus pneumoniae
           SP9-BS68]
 gi|148996617|ref|ZP_01824335.1| hypothetical protein CGSSp11BS70_07975 [Streptococcus pneumoniae
           SP11-BS70]
 gi|149001702|ref|ZP_01826675.1| anaerobic ribonucleoside triphosphate reductase [Streptococcus
           pneumoniae SP14-BS69]
 gi|149005945|ref|ZP_01829674.1| hypothetical protein CGSSp18BS74_07200 [Streptococcus pneumoniae
           SP18-BS74]
 gi|149011064|ref|ZP_01832369.1| hypothetical protein CGSSp19BS75_11428 [Streptococcus pneumoniae
           SP19-BS75]
 gi|168483832|ref|ZP_02708784.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1873-00]
 gi|168490343|ref|ZP_02714542.1| conserved hypothetical protein [Streptococcus pneumoniae SP195]
 gi|168492149|ref|ZP_02716292.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC0288-04]
 gi|168576377|ref|ZP_02722260.1| conserved hypothetical protein [Streptococcus pneumoniae MLV-016]
 gi|169834458|ref|YP_001693728.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           Hungary19A-6]
 gi|182683176|ref|YP_001834923.1| hypothetical protein SPCG_0206 [Streptococcus pneumoniae CGSP14]
 gi|225853803|ref|YP_002735315.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           JJA]
 gi|225855961|ref|YP_002737472.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           P1031]
 gi|225858051|ref|YP_002739561.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           70585]
 gi|225860238|ref|YP_002741747.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|237649736|ref|ZP_04523988.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           CCRI 1974]
 gi|237821434|ref|ZP_04597279.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           CCRI 1974M2]
 gi|298255974|ref|ZP_06979560.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           str. Canada MDR_19A]
 gi|303255107|ref|ZP_07341183.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           BS455]
 gi|303259248|ref|ZP_07345226.1| hypothetical protein CGSSp9vBS293_02607 [Streptococcus pneumoniae
           SP-BS293]
 gi|303263331|ref|ZP_07349254.1| hypothetical protein CGSSpBS397_03156 [Streptococcus pneumoniae
           BS397]
 gi|307066873|ref|YP_003875839.1| putative endonuclease [Streptococcus pneumoniae AP200]
 gi|32130028|sp|Q8DRE2|RUVX_STRR6 RecName: Full=Putative Holliday junction resolvase
 gi|122279414|sp|Q04MP8|RUVX_STRP2 RecName: Full=Putative Holliday junction resolvase
 gi|226695306|sp|B1I8I5|RUVX_STRPI RecName: Full=Putative Holliday junction resolvase
 gi|226695307|sp|B2IS28|RUVX_STRPS RecName: Full=Putative Holliday junction resolvase
 gi|254767527|sp|C1CAK0|RUVX_STRP7 RecName: Full=Putative Holliday junction resolvase
 gi|254767529|sp|C1CBZ4|RUVX_STRZJ RecName: Full=Putative Holliday junction resolvase
 gi|254767530|sp|C1CI84|RUVX_STRZP RecName: Full=Putative Holliday junction resolvase
 gi|254767531|sp|C1CP75|RUVX_STRZT RecName: Full=Putative Holliday junction resolvase
 gi|15457719|gb|AAK98980.1| Conserved hypothetical protein [Streptococcus pneumoniae R6]
 gi|116076395|gb|ABJ54115.1| conserved hypothetical protein TIGR00250 [Streptococcus pneumoniae
           D39]
 gi|147757192|gb|EDK64231.1| hypothetical protein CGSSp11BS70_07975 [Streptococcus pneumoniae
           SP11-BS70]
 gi|147760160|gb|EDK67149.1| anaerobic ribonucleoside triphosphate reductase [Streptococcus
           pneumoniae SP14-BS69]
 gi|147762301|gb|EDK69262.1| hypothetical protein CGSSp18BS74_07200 [Streptococcus pneumoniae
           SP18-BS74]
 gi|147764700|gb|EDK71630.1| hypothetical protein CGSSp19BS75_11428 [Streptococcus pneumoniae
           SP19-BS75]
 gi|147923740|gb|EDK74852.1| hypothetical protein CGSSp3BS71_05664 [Streptococcus pneumoniae
           SP3-BS71]
 gi|147926394|gb|EDK77467.1| hypothetical protein CGSSp6BS73_10471 [Streptococcus pneumoniae
           SP6-BS73]
 gi|147928498|gb|EDK79513.1| hypothetical protein CGSSp9BS68_03488 [Streptococcus pneumoniae
           SP9-BS68]
 gi|168996960|gb|ACA37572.1| conserved hypothetical protein [Streptococcus pneumoniae
           Hungary19A-6]
 gi|172042909|gb|EDT50955.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1873-00]
 gi|182628510|gb|ACB89458.1| hypothetical protein SPCG_0206 [Streptococcus pneumoniae CGSP14]
 gi|183571311|gb|EDT91839.1| conserved hypothetical protein [Streptococcus pneumoniae SP195]
 gi|183573647|gb|EDT94175.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC0288-04]
 gi|183577826|gb|EDT98354.1| conserved hypothetical protein [Streptococcus pneumoniae MLV-016]
 gi|225721840|gb|ACO17694.1| conserved hypothetical protein [Streptococcus pneumoniae 70585]
 gi|225722223|gb|ACO18076.1| conserved hypothetical protein [Streptococcus pneumoniae JJA]
 gi|225725306|gb|ACO21158.1| conserved hypothetical protein [Streptococcus pneumoniae P1031]
 gi|225727488|gb|ACO23339.1| conserved hypothetical protein [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|302597937|gb|EFL65007.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           BS455]
 gi|302639666|gb|EFL70123.1| hypothetical protein CGSSpBS293_02607 [Streptococcus pneumoniae
           SP-BS293]
 gi|302647104|gb|EFL77328.1| hypothetical protein CGSSpBS397_03156 [Streptococcus pneumoniae
           BS397]
 gi|306408410|gb|ADM83837.1| predicted endonuclease [Streptococcus pneumoniae AP200]
          Length = 139

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 49/138 (35%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +         +   + T  +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRVKELVDTYKVERFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    ++    +P  + DERLTTV+A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGA-KLEEFFGLPVDYQDERLTTVAAERMLIEQADISRNKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|184154999|ref|YP_001843339.1| endonuclease [Lactobacillus fermentum IFO 3956]
 gi|226731625|sp|B2GB27|RUVX_LACF3 RecName: Full=Putative Holliday junction resolvase
 gi|183226343|dbj|BAG26859.1| endonuclease [Lactobacillus fermentum IFO 3956]
          Length = 145

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 46/137 (33%), Positives = 80/137 (58%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+A SDP    A     +   +  +      +   + +  +A F++G
Sbjct: 1   MRLLGLDVGSKTVGVAESDPLGWTAQAVEIIPIDEEAEVFGLERVAELVKSRQVAGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN +EGPRV + R +   +++ +  +P  + DERLTTV A ++L++  +VSR+K+ 
Sbjct: 61  LPKNMNNTEGPRVEAARHYGE-LLEERFGLPIDYQDERLTTVQAHRMLVEEADVSRRKQK 119

Query: 134 QKVDSIAAALILQEVLD 150
           + +D +AA LILQ  LD
Sbjct: 120 KVIDELAATLILQNYLD 136


>gi|82703594|ref|YP_413160.1| Holliday junction resolvase-like protein [Nitrosospira multiformis
           ATCC 25196]
 gi|146325582|sp|Q2Y653|RUVX_NITMU RecName: Full=Putative Holliday junction resolvase
 gi|82411659|gb|ABB75768.1| Holliday junction resolvase YqgF [Nitrosospira multiformis ATCC
           25196]
          Length = 151

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/144 (27%), Positives = 67/144 (46%), Gaps = 1/144 (0%)

Query: 10  VKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIA 69
             S        + D G KRIG+AI +     AHP   L  K   +    +   +      
Sbjct: 6   KASQPHAGTALAFDFGEKRIGVAIGNLELGLAHPLVTLSNKNKEECLKSIARLMDEWKPV 65

Query: 70  AFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR 129
             ++GLP++ +G+E      +R F  + +  +  +  V  DER T++SA   L + +V  
Sbjct: 66  LLVVGLPVHADGTEHELTRRSRRFA-HRLQARFGIRTVLEDERYTSISASSALDEASVRG 124

Query: 130 KKRIQKVDSIAAALILQEVLDRIS 153
           +++ Q +D IAA LILQ   D+ +
Sbjct: 125 RRQKQVLDQIAAQLILQSYFDQRN 148


>gi|260663394|ref|ZP_05864285.1| conserved hypothetical protein [Lactobacillus fermentum 28-3-CHN]
 gi|260552246|gb|EEX25298.1| conserved hypothetical protein [Lactobacillus fermentum 28-3-CHN]
          Length = 145

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 46/138 (33%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+A SDP    A     +   +  +      +   + +  +A  ++G
Sbjct: 1   MRLLGLDVGSKTVGVAESDPLGWTAQAVEIIPIDEEAEVFGLERVAELVKSRQVAGIVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN +EGPRV + R +   +++ +  +P  + DERLTTV A ++L++  +VSR+K+ 
Sbjct: 61  LPKNMNNTEGPRVEAARHYGE-LLEERFGLPIDYQDERLTTVQAHRMLVEEADVSRRKQK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDELAATLILQNYLDR 137


>gi|29833393|ref|NP_828027.1| hypothetical protein SAV_6851 [Streptomyces avermitilis MA-4680]
 gi|62901021|sp|Q827S3|RUVX_STRAW RecName: Full=Putative Holliday junction resolvase
 gi|29610516|dbj|BAC74562.1| hypothetical protein [Streptomyces avermitilis MA-4680]
          Length = 156

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 44/146 (30%), Positives = 63/146 (43%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 ++D+G  RIG+A  DP    A P   +  + V      L   +        ++G
Sbjct: 4   RRGRRLAVDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLKQLVEEYEPIEVVLG 63

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EGP     RAF   +      VP    DER+TTV+A Q L    V  KK   
Sbjct: 64  LPRSLKGGEGPAAVKVRAFAQELARVIAPVPVRLMDERMTTVTASQGLRASGVKSKKGRS 123

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            +D  AA +ILQ+ L+       + G
Sbjct: 124 VIDQAAAVIILQQALESERVSGKAPG 149


>gi|218130012|ref|ZP_03458816.1| hypothetical protein BACEGG_01595 [Bacteroides eggerthii DSM 20697]
 gi|217987815|gb|EEC54141.1| hypothetical protein BACEGG_01595 [Bacteroides eggerthii DSM 20697]
          Length = 141

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/141 (26%), Positives = 68/141 (48%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++    L+   ++  E +   ++GL
Sbjct: 1   MSRIIAIDYGKKRTGIAVSDTLQMIANGLTTVPTHELLAFILD---YVAKEPVERILVGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      +     FV ++  +   +P  + DER T+V A + +++  + +K R   
Sbjct: 58  PKQMNNEASENMKRIEPFVRSLKKKLPDMPVEYVDERFTSVLAHRTMLEAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   F
Sbjct: 118 ALVDEISATIILQTYLENKRF 138


>gi|294501347|ref|YP_003565047.1| putative Holliday junction resolvase [Bacillus megaterium QM B1551]
 gi|295706694|ref|YP_003599769.1| putative Holliday junction resolvase [Bacillus megaterium DSM 319]
 gi|294351284|gb|ADE71613.1| putative Holliday junction resolvase [Bacillus megaterium QM B1551]
 gi|294804353|gb|ADF41419.1| putative Holliday junction resolvase [Bacillus megaterium DSM 319]
          Length = 138

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 78/137 (56%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             +  +D+GTK IG+A+SD     A     +      + Q+   L   I   ++   ++G
Sbjct: 1   MRVLGLDVGTKTIGVAVSDEMGWTAQGIETIKIADEQMEQSYPRLQQLIDEYSVEKIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNG+ GPR  +   F  N+ ++   +  + WDERL+T++A+++L+  +VSRKKR +
Sbjct: 61  LPKNMNGTIGPRGEACIEFADNVKEKL-NIETMMWDERLSTMAAERVLLSADVSRKKRKK 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LD 
Sbjct: 120 VIDKMAAVMILQGYLDS 136


>gi|225871407|ref|YP_002747354.1| Holliday junction resolvase [Streptococcus equi subsp. equi 4047]
 gi|254767526|sp|C0MAR3|RUVX_STRE4 RecName: Full=Putative Holliday junction resolvase
 gi|225700811|emb|CAW95508.1| putative Holliday junction resolvase [Streptococcus equi subsp.
           equi 4047]
          Length = 139

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 78/137 (56%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +     K       L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIRINEDKQDFGFDRLAELVKQYQVDRFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I+   ++P  + DERLTTV A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASKAYGD-KIEELFHIPVSYQDERLTTVEAERMLIEQADISRGKRK 119

Query: 134 QKVDSIAAALILQEVLD 150
           + +D +AA LILQ  LD
Sbjct: 120 KVIDKLAAQLILQNYLD 136


>gi|302385313|ref|YP_003821135.1| Holliday junction resolvase YqgF [Clostridium saccharolyticum WM1]
 gi|302195941|gb|ADL03512.1| Holliday junction resolvase YqgF [Clostridium saccharolyticum WM1]
          Length = 146

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 49/140 (35%), Positives = 72/140 (51%), Gaps = 4/140 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+K +G+A+SD     A     + R+   K+ +T   +   I    I   I+
Sbjct: 1   MRIMGLDYGSKTVGVAVSDLLGITAQGVETITREEENKLRKTCARIEELIREYEIETIIL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN S G R   T  F   +I R   +  + WDERLTTV++++IL +  V R+ R 
Sbjct: 61  GYPKNMNNSAGQRAEKTEQFKEMLIRRT-GLNVILWDERLTTVASERILQESGVRREHRK 119

Query: 134 QKVDSIAAALILQEVLDRIS 153
             +D +AA LILQ  LD + 
Sbjct: 120 AVIDQVAAGLILQGYLDSLP 139


>gi|21220001|ref|NP_625780.1| Holliday junction resolvase-like protein [Streptomyces coelicolor
           A3(2)]
 gi|32130071|sp|Q9KXQ0|RUVX_STRCO RecName: Full=Putative Holliday junction resolvase
 gi|8249959|emb|CAB93380.1| conserved hypothetical protein [Streptomyces coelicolor A3(2)]
          Length = 167

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/137 (30%), Positives = 60/137 (43%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 ++D+G  RIG+A  DP    A P   +  + V      L   +        ++G
Sbjct: 15  RRGRRLAVDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLRQLVAEYEPIEVVVG 74

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EGP     R F   +      VP    DER+TTV+A Q L    V  KK   
Sbjct: 75  LPRSLKGGEGPAAAKVRRFTQELAKGIAPVPVRLVDERMTTVTASQGLRASGVKSKKGRS 134

Query: 135 KVDSIAAALILQEVLDR 151
            +D  AA +ILQ+ L+ 
Sbjct: 135 VIDQAAAVIILQQALES 151


>gi|116628625|ref|YP_821244.1| Holliday junction resolvase-like protein [Streptococcus
           thermophilus LMD-9]
 gi|122266781|sp|Q03IC4|RUVX_STRTD RecName: Full=Putative Holliday junction resolvase
 gi|116101902|gb|ABJ67048.1| RNase H-like ribonuclease [Streptococcus thermophilus LMD-9]
 gi|312279278|gb|ADQ63935.1| Holliday junction resolvase YqgF [Streptococcus thermophilus ND03]
          Length = 139

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 50/139 (35%), Positives = 79/139 (56%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+AISDP    A     +    +        L   +    +  F++G
Sbjct: 1   MRVMGLDVGSKTVGVAISDPLGFTAQGVEIIKINEEAKEFGFDRLGELVKEYQVDKFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN +EGPRV +++A+    I     +P  + DERLTTV A+++L++  +VSR KR 
Sbjct: 61  LPKNMNNTEGPRVEASKAYGD-KIKEIFNLPVDYQDERLTTVQAERMLVEQADVSRDKRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA LILQ  LDR+
Sbjct: 120 KVIDKLAAQLILQNYLDRM 138


>gi|160889624|ref|ZP_02070627.1| hypothetical protein BACUNI_02050 [Bacteroides uniformis ATCC 8492]
 gi|317479181|ref|ZP_07938318.1| hypothetical protein HMPREF1007_01434 [Bacteroides sp. 4_1_36]
 gi|156860616|gb|EDO54047.1| hypothetical protein BACUNI_02050 [Bacteroides uniformis ATCC 8492]
 gi|316904669|gb|EFV26486.1| hypothetical protein HMPREF1007_01434 [Bacteroides sp. 4_1_36]
          Length = 141

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/141 (27%), Positives = 70/141 (49%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++ Q  L+   ++  E +   ++GL
Sbjct: 1   MSRIIAIDYGRKRTGIAVSDTLQMIANGLTTVPTHQLLQFLLD---YVAKEPVERILVGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      + +   FV ++  +   +P  + DER T+V A + +++  + +K R   
Sbjct: 58  PKQMNNEASENMKNIEPFVRSLKKKLPDMPVEYVDERFTSVLAHRTMLEAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   F
Sbjct: 118 ALVDEISATIILQTYLENKRF 138


>gi|331654461|ref|ZP_08355461.1| putative Holliday junction resolvase [Escherichia coli M718]
 gi|331047843|gb|EGI19920.1| putative Holliday junction resolvase [Escherichia coli M718]
          Length = 138

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/137 (29%), Positives = 63/137 (45%), Gaps = 1/137 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNLIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDRI 152
           VDS +A +IL+   ++ 
Sbjct: 121 VDSASAVIILESYFEQR 137


>gi|169334466|ref|ZP_02861659.1| hypothetical protein ANASTE_00869 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259183|gb|EDS73149.1| hypothetical protein ANASTE_00869 [Anaerofustis stercorihominis DSM
           17244]
          Length = 144

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/141 (30%), Positives = 72/141 (51%), Gaps = 2/141 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVR-KKVTQTALELLSFITTENIAAFIIG 74
            + I ++D G  RIG+A+SD     A     + R K + +   ++  +I   +    I+G
Sbjct: 2   KKRILALDYGDSRIGVAVSDALHITAQGICVIKRTKNIEEDIEKIKKYIKEYDTGLVILG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
            PLN++G  G R   T  F    +  K+ +P   WDERL+T  A++ L    V+ +K+ +
Sbjct: 62  HPLNLSGERGTRALVTEEFCDI-LKEKIDIPVELWDERLSTKEAERALEAGGVNWRKKRE 120

Query: 135 KVDSIAAALILQEVLDRISFL 155
            +D +AA +IL   LD  + L
Sbjct: 121 VIDMMAAQIILSSYLDYNNNL 141


>gi|169829318|ref|YP_001699476.1| putative Holliday junction resolvase [Lysinibacillus sphaericus
           C3-41]
 gi|168993806|gb|ACA41346.1| Putative Holliday junction resolvase [Lysinibacillus sphaericus
           C3-41]
          Length = 135

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/136 (30%), Positives = 74/136 (54%), Gaps = 3/136 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRK--KVTQTALELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+A+SD     A     +             +   +    I  F++G P 
Sbjct: 1   MGLDVGSKTVGVAVSDALGWTAQGIETVKIDEANGEFGIDRIAELVKEYAITQFVVGFPT 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMN + GPR  ++  +   +++    +P   WDERLTT++A+++LI+ +VSR+KR Q +D
Sbjct: 61  NMNNTVGPRGEASENY-KKLLEETFSLPVTLWDERLTTMAAERMLIEADVSRRKRKQVID 119

Query: 138 SIAAALILQEVLDRIS 153
            +AA +I+Q  LD  +
Sbjct: 120 KMAAVMIVQGYLDSKN 135


>gi|304316717|ref|YP_003851862.1| Holliday junction resolvase YqgF [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778219|gb|ADL68778.1| Holliday junction resolvase YqgF [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 140

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 46/135 (34%), Positives = 73/135 (54%), Gaps = 2/135 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
                +D+G K IG+AISDP    A     + R  +    LE+     +      ++G P
Sbjct: 1   MRTIGLDVGDKTIGVAISDPSGLIAQGIKTIKRSNLDDDILEIKRIANSFKAEEIVVGFP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQK 135
            NMNG+ G +      FV  ++ +++ +P + WDERLTTV A ++LI+  ++ R KR + 
Sbjct: 61  KNMNGTIGSQGQKVINFVE-VLKKEINLPIMLWDERLTTVEASRMLIEGADMRRDKRKKV 119

Query: 136 VDSIAAALILQEVLD 150
           +D +AA +ILQ  LD
Sbjct: 120 IDKLAATIILQGYLD 134


>gi|332523405|ref|ZP_08399657.1| RNAse H domain protein, YqgF family [Streptococcus porcinus str.
           Jelinkova 176]
 gi|332314669|gb|EGJ27654.1| RNAse H domain protein, YqgF family [Streptococcus porcinus str.
           Jelinkova 176]
          Length = 139

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 81/138 (58%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +  Q      L   +   +++ F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIKIDEDNQAFGFDRLSELVAQYDVSQFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I     +P V+ DERLTTV A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGQ-KIQELFKIPVVYQDERLTTVEAERMLIEQADISRGKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|111024086|ref|YP_707058.1| Holliday junction resolvase-like protein [Rhodococcus jostii RHA1]
 gi|118597220|sp|Q0S0N6|RUVX_RHOSR RecName: Full=Putative Holliday junction resolvase
 gi|110823616|gb|ABG98900.1| probable Holliday junction resolvase [Rhodococcus jostii RHA1]
          Length = 178

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/144 (29%), Positives = 59/144 (40%), Gaps = 4/144 (2%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVT----QTALELLSFITTENIA 69
                   ID+G+ RIG+A SDP    A P   + R K           +   +      
Sbjct: 16  PGRGRRIGIDVGSVRIGVASSDPDGILATPVETVPRSKERGPDAPDIRRIADIVEEYEAV 75

Query: 70  AFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR 129
             I+GLP  + G  G        F   +  +   +P    DERLTTV+A + L +  VS 
Sbjct: 76  EVIVGLPQTLRGERGKAASIATVFAKRLRRKVDPIPVRMADERLTTVTAARALRESGVSA 135

Query: 130 KKRIQKVDSIAAALILQEVLDRIS 153
           + +   +D  AA  ILQ  LD  S
Sbjct: 136 RGQRPVIDQAAAVAILQGWLDERS 159


>gi|237706398|ref|ZP_04536879.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|226899438|gb|EEH85697.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|315289503|gb|EFU48898.1| conserved hypothetical protein TIGR00250 [Escherichia coli MS
           110-3]
 gi|323957327|gb|EGB53049.1| hypothetical protein ERLG_01394 [Escherichia coli H263]
          Length = 138

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  +     DERL+TV A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGIEVKLHDERLSTVEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYFEQ 136


>gi|167763508|ref|ZP_02435635.1| hypothetical protein BACSTE_01882 [Bacteroides stercoris ATCC
           43183]
 gi|329954513|ref|ZP_08295604.1| RNAse H domain protein, YqgF family [Bacteroides clarus YIT 12056]
 gi|167698802|gb|EDS15381.1| hypothetical protein BACSTE_01882 [Bacteroides stercoris ATCC
           43183]
 gi|328527481|gb|EGF54478.1| RNAse H domain protein, YqgF family [Bacteroides clarus YIT 12056]
          Length = 141

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/141 (26%), Positives = 68/141 (48%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++    ++   ++  E +   ++GL
Sbjct: 1   MSRIIAIDYGKKRTGIAVSDTLQMIANGLTTVPTHELLAFIMD---YVAKEPVERILVGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      +     FV ++  R   +P  + DER T+V A + +++  + +K R   
Sbjct: 58  PKQMNNEASENMKRIEPFVRSLQKRLPDMPVEYVDERFTSVLAHRTMLEAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   F
Sbjct: 118 ALVDEISATIILQTYLENRRF 138


>gi|32475183|ref|NP_868177.1| an endonuclease [Rhodopirellula baltica SH 1]
 gi|62901008|sp|Q7UG74|RUVX_RHOBA RecName: Full=Putative Holliday junction resolvase
 gi|32445724|emb|CAD78455.1| conserved hypothetical protein-putative an endonuclease
           [Rhodopirellula baltica SH 1]
          Length = 173

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 45/147 (30%), Positives = 73/147 (49%), Gaps = 1/147 (0%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
                +AS+D GT RIG+AI DP    A P          + A   +    +E IAA+++
Sbjct: 13  PATGRLASVDYGTVRIGVAICDPDWILASPLEVHPVSTPEKDAQYFIDLAKSERIAAWVV 72

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP++ +G E  +   +R F    +     +P   +DER TTV+A   +     +RKK  
Sbjct: 73  GLPIHCDGGESDKSKESRKFAAW-LKETTGLPTRLFDERFTTVAANAKIRQGKTTRKKTK 131

Query: 134 QKVDSIAAALILQEVLDRISFLESSKG 160
           Q+VD++AA ++L+  L+   +     G
Sbjct: 132 QRVDAVAAQVLLESFLEACRYRGELAG 158


>gi|302550142|ref|ZP_07302484.1| Holliday junction resolvase YqgF [Streptomyces viridochromogenes
           DSM 40736]
 gi|302467760|gb|EFL30853.1| Holliday junction resolvase YqgF [Streptomyces viridochromogenes
           DSM 40736]
          Length = 154

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 44/146 (30%), Positives = 63/146 (43%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 +ID+G  RIG+A  DP    A P   +  + +      L   +        ++G
Sbjct: 2   RRGRRLAIDVGDARIGVASCDPDGILATPVETVPGRDIPAAQRRLKGLVEEYEPIEVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EGP     R FV  +      VP    DER+TTV+A Q L    V  KK   
Sbjct: 62  LPRSLKGGEGPAAVKVRGFVQELARMISPVPVRLVDERMTTVTASQGLRASGVKSKKGRS 121

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            +D  AA +ILQ+ L+       + G
Sbjct: 122 VIDQAAAVVILQQALESERVSGKAPG 147


>gi|220923238|ref|YP_002498540.1| Holliday junction resolvase YqgF [Methylobacterium nodulans ORS
           2060]
 gi|219947845|gb|ACL58237.1| Holliday junction resolvase YqgF [Methylobacterium nodulans ORS
           2060]
          Length = 163

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 63/156 (40%), Positives = 89/156 (57%), Gaps = 2/156 (1%)

Query: 1   MSILLIEDLVKSLKPNQ-PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALEL 59
           M+        +S +     +  +DLGTK IGLA+SD GRR A P   + R K T  A +L
Sbjct: 1   MNRESFARFAESSRAGGARLLGLDLGTKTIGLALSDVGRRIASPLETIRRVKFTPDAQKL 60

Query: 60  LSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQ 119
                   +   +IGLPLNM+GSEGPR  STRAFV   +   + +P + +DERL+T +  
Sbjct: 61  AGIARQHGVGGLVIGLPLNMDGSEGPRAQSTRAFVR-NLAPILPLPVLLFDERLSTAAVT 119

Query: 120 QILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           + L++ + SR +R   VD +AAA ILQ  LD ++ L
Sbjct: 120 RTLLEADASRARRGDLVDKLAAAYILQGCLDVLAGL 155


>gi|68536114|ref|YP_250819.1| putative Hollyday junction resolvase [Corynebacterium jeikeium
           K411]
 gi|146325565|sp|Q4JVF6|RUVX_CORJK RecName: Full=Putative Holliday junction resolvase
 gi|68263713|emb|CAI37201.1| putative Hollyday junction resolvase [Corynebacterium jeikeium
           K411]
          Length = 155

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/140 (25%), Positives = 59/140 (42%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
                   +D+GT RIG+AISDP    A P   +           ++       +   ++
Sbjct: 12  PGRGRRLGLDVGTVRIGVAISDPDCILATPVETIQATADDADVQRVVEICRDNFVVEIVV 71

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP+ + G+      +   F   + +    +P    DER++T++A        V+ KK  
Sbjct: 72  GLPVALRGNHTQSTLNAEEFARLVKEELPDIPVRMVDERMSTMAATHAFHASGVNSKKGR 131

Query: 134 QKVDSIAAALILQEVLDRIS 153
           +K+D  AA  ILQ  LD   
Sbjct: 132 KKIDQAAAVHILQGWLDTRR 151


>gi|107021941|ref|YP_620268.1| Holliday junction resolvase-like protein [Burkholderia cenocepacia
           AU 1054]
 gi|116688888|ref|YP_834511.1| Holliday junction resolvase-like protein [Burkholderia cenocepacia
           HI2424]
 gi|170732189|ref|YP_001764136.1| Holliday junction resolvase-like protein [Burkholderia cenocepacia
           MC0-3]
 gi|206561485|ref|YP_002232250.1| Holliday junction resolvase-like protein [Burkholderia cenocepacia
           J2315]
 gi|254246158|ref|ZP_04939479.1| conserved hypothetical protein [Burkholderia cenocepacia PC184]
 gi|124107439|sp|Q1BYL0|RUVX_BURCA RecName: Full=Putative Holliday junction resolvase
 gi|167012700|sp|A0K541|RUVX_BURCH RecName: Full=Putative Holliday junction resolvase
 gi|226725494|sp|B1JWP0|RUVX_BURCC RecName: Full=Putative Holliday junction resolvase
 gi|226725495|sp|B4ECT2|RUVX_BURCJ RecName: Full=Putative Holliday junction resolvase
 gi|105892130|gb|ABF75295.1| Holliday junction resolvase YqgF [Burkholderia cenocepacia AU 1054]
 gi|116646977|gb|ABK07618.1| Holliday junction resolvase YqgF [Burkholderia cenocepacia HI2424]
 gi|124870934|gb|EAY62650.1| conserved hypothetical protein [Burkholderia cenocepacia PC184]
 gi|169815431|gb|ACA90014.1| Holliday junction resolvase YqgF [Burkholderia cenocepacia MC0-3]
 gi|198037527|emb|CAR53464.1| conserved hypothetical protein [Burkholderia cenocepacia J2315]
          Length = 149

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/144 (25%), Positives = 68/144 (47%), Gaps = 1/144 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            +  + + D G KRIG+AI +   R A     +           +   +      A ++G
Sbjct: 7   RDATLLAFDYGEKRIGVAIGNALTRSARALVVIQNLNREHRFKAVGDLLAEWRPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+        + F +  ++ +  +P  + DER ++V A+  L + NV  + R  
Sbjct: 67  LPMHPDGTPHDMTQQAKRFGN-QLNGRFGLPVTWVDERYSSVEAEAGLRERNVRGRARTD 125

Query: 135 KVDSIAAALILQEVLDRISFLESS 158
            +D+ AA +ILQ+ LD++S  E  
Sbjct: 126 MLDAEAARVILQQYLDQLSDHEHH 149


>gi|260654149|ref|ZP_05859639.1| putative Holliday junction resolvase [Jonquetella anthropi E3_33
           E1]
 gi|260631134|gb|EEX49328.1| putative Holliday junction resolvase [Jonquetella anthropi E3_33
           E1]
          Length = 141

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 47/135 (34%), Positives = 68/135 (50%), Gaps = 2/135 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            + I ++DLGT RIG+A++DP   FA                +L   +        ++GL
Sbjct: 1   MKRIIALDLGTVRIGVAVTDPLGTFAQGVECWDAASG--WMGKLGELMAQYGTDRLLLGL 58

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P   +G+EG      R     +  R   V   FWDER T+  AQ  +I+ ++SR+KR  K
Sbjct: 59  PRKEDGTEGEMAAKVRETAGRIAKRYPQVQIRFWDERYTSRVAQSAMIEGDLSRRKRKGK 118

Query: 136 VDSIAAALILQEVLD 150
           VD IAA+LILQ  +D
Sbjct: 119 VDQIAASLILQNFID 133


>gi|218701659|ref|YP_002409288.1| Holliday junction resolvase-like protein [Escherichia coli IAI39]
 gi|226725517|sp|B7NI12|RUVX_ECO7I RecName: Full=Putative Holliday junction resolvase
 gi|218371645|emb|CAR19484.1| Holliday junction resolvase [Escherichia coli IAI39]
          Length = 138

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNLIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  +     DERL+TV A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGIEVKLHDERLSTVEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYFEQ 136


>gi|302517972|ref|ZP_07270314.1| Holliday junction resolvase YqgF [Streptomyces sp. SPB78]
 gi|302426867|gb|EFK98682.1| Holliday junction resolvase YqgF [Streptomyces sp. SPB78]
          Length = 157

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/137 (31%), Positives = 62/137 (45%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 +ID+G  RIG+A  DP    A P   +  + V      + + +        ++G
Sbjct: 5   RRGRRLAIDVGDARIGVASCDPDGILATPVETVPGRDVPAARRRIKALVDEYEPIELVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EGP     RAF   +      VP    DER+TTV+A Q L    V+ KK   
Sbjct: 65  LPRSLRGGEGPAAKKVRAFAGGLALLVAPVPVRLVDERMTTVTAGQGLRASGVNTKKGRS 124

Query: 135 KVDSIAAALILQEVLDR 151
            +D  AA +ILQ  L+ 
Sbjct: 125 VIDQAAAVIILQTALES 141


>gi|333028350|ref|ZP_08456414.1| putative holliday junction resolvase YqgF [Streptomyces sp. Tu6071]
 gi|332748202|gb|EGJ78643.1| putative holliday junction resolvase YqgF [Streptomyces sp. Tu6071]
          Length = 154

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/137 (31%), Positives = 62/137 (45%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 +ID+G  RIG+A  DP    A P   +  + V      + + +        ++G
Sbjct: 2   RRGRRLAIDVGDARIGVASCDPDGILATPVETVPGRDVPAARRRIKALVDEYEPIELVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EGP     RAF   +      VP    DER+TTV+A Q L    V+ KK   
Sbjct: 62  LPRSLRGGEGPAAKKVRAFAGGLALLVAPVPVRLVDERMTTVTAGQGLRASGVNTKKGRS 121

Query: 135 KVDSIAAALILQEVLDR 151
            +D  AA +ILQ  L+ 
Sbjct: 122 VIDQAAAVIILQTALES 138


>gi|313890363|ref|ZP_07823994.1| RNAse H domain protein, YqgF family [Streptococcus pseudoporcinus
           SPIN 20026]
 gi|313121206|gb|EFR44314.1| RNAse H domain protein, YqgF family [Streptococcus pseudoporcinus
           SPIN 20026]
          Length = 139

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +  Q      L   +    ++ F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIKIDEANQAFGFDRLSELVAQYKVSQFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I     +P V+ DERLTTV A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGQ-KIQELFKIPVVYQDERLTTVEAERMLIEQADISRGKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|119899749|ref|YP_934962.1| Holliday junction resolvase-like protein [Azoarcus sp. BH72]
 gi|167012690|sp|A1KB70|RUVX_AZOSB RecName: Full=Putative Holliday junction resolvase
 gi|119672162|emb|CAL96076.1| putative Hollyday junction resolvase [Azoarcus sp. BH72]
          Length = 156

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/139 (26%), Positives = 66/139 (47%), Gaps = 2/139 (1%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           L     + + D G  RIG+A+ +   R A+P   +  +        +   +      A +
Sbjct: 12  LPARGTLLAFDFGLARIGVAVGELETRHANPLLTVHEEANAARFAIIARLLDEWKPVALV 71

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR-KK 131
           +GLP +++G E       R F +  +  +  +P    DERL++ +A++ L D  +S  + 
Sbjct: 72  VGLPGHLDGREHELAPRCRRFAN-QLHGRFGIPVHLVDERLSSAAAERQLHDAGLSGWQA 130

Query: 132 RIQKVDSIAAALILQEVLD 150
           R   +D++AA LILQ  LD
Sbjct: 131 RKPVLDAVAAQLILQHFLD 149


>gi|161506351|ref|YP_001573463.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|189046104|sp|A9MQS7|RUVX_SALAR RecName: Full=Putative Holliday junction resolvase
 gi|160867698|gb|ABX24321.1| hypothetical protein SARI_04548 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 138

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/136 (30%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+AI       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAIGQRITGTARPLPAIKAQDGTPDWTLIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGVTVTLHDERLSTVEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYFEQ 136


>gi|227888504|ref|ZP_04006309.1| crossover junction endodeoxyribonuclease [Escherichia coli 83972]
 gi|227834773|gb|EEJ45239.1| crossover junction endodeoxyribonuclease [Escherichia coli 83972]
 gi|307554931|gb|ADN47706.1| putative holliday junction resolvase [Escherichia coli ABU 83972]
          Length = 138

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKSK 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYFEQ 136


>gi|149918360|ref|ZP_01906851.1| hypothetical protein PPSIR1_36632 [Plesiocystis pacifica SIR-1]
 gi|149820886|gb|EDM80295.1| hypothetical protein PPSIR1_36632 [Plesiocystis pacifica SIR-1]
          Length = 156

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 51/146 (34%), Positives = 80/146 (54%), Gaps = 4/146 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             + ++D+G+K IGLA+SD G   AH R  L R+     +  +L+  +   + A ++GLP
Sbjct: 1   MRVLALDVGSKTIGLAVSDVGGSMAHAREVLRRQGHKLDSAAVLALASELEVRALVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYV----PFVFWDERLTTVSAQQILIDMNVSRKKR 132
           L ++GSEG R    R F+  +           P   WDER +T +A++ L++ +VSR KR
Sbjct: 61  LELDGSEGHRARLVRRFLKVLEAAIAEAERALPVHTWDERYSTAAAERTLLEADVSRAKR 120

Query: 133 IQKVDSIAAALILQEVLDRISFLESS 158
            Q +D++AA  ILQ  LD  +    S
Sbjct: 121 KQNIDAVAAQFILQGWLDAQARRRES 146


>gi|82778279|ref|YP_404628.1| Holliday junction resolvase-like protein [Shigella dysenteriae
           Sd197]
 gi|209920408|ref|YP_002294492.1| Holliday junction resolvase-like protein [Escherichia coli SE11]
 gi|293416210|ref|ZP_06658850.1| hypothetical protein ECDG_03813 [Escherichia coli B185]
 gi|309785223|ref|ZP_07679854.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|146325607|sp|Q32C18|RUVX_SHIDS RecName: Full=Putative Holliday junction resolvase
 gi|226725521|sp|B6I787|RUVX_ECOSE RecName: Full=Putative Holliday junction resolvase
 gi|81242427|gb|ABB63137.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|209913667|dbj|BAG78741.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|291432399|gb|EFF05381.1| hypothetical protein ECDG_03813 [Escherichia coli B185]
 gi|308926343|gb|EFP71819.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|320202613|gb|EFW77183.1| Putative Holliday junction resolvase [Escherichia coli EC4100B]
 gi|324017221|gb|EGB86440.1| hypothetical protein HMPREF9542_04132 [Escherichia coli MS 117-3]
          Length = 138

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGVDVKLHDERLSTVEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYFEQ 136


>gi|157151461|ref|YP_001451289.1| Holliday junction resolvase-like protein [Streptococcus gordonii
           str. Challis substr. CH1]
 gi|189046109|sp|A8AZS9|RUVX_STRGC RecName: Full=Putative Holliday junction resolvase
 gi|157076255|gb|ABV10938.1| conserved hypothetical protein TIGR00250 [Streptococcus gordonii
           str. Challis substr. CH1]
          Length = 139

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 81/138 (58%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELL-SFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A       + +   +   E L   +    +  F+IG
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEDQEEFGFERLGELVAEYKVDKFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+   + +    +P  + DERLTTV+A+++LI+  +VSR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGAKVTE-LFGLPVEYQDERLTTVAAERMLIEQADVSRNKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|56416955|ref|YP_154029.1| hypothetical protein AM859 [Anaplasma marginale str. St. Maries]
 gi|222475321|ref|YP_002563738.1| Putative Holliday junction resolvase (YqgF) [Anaplasma marginale
           str. Florida]
 gi|56388187|gb|AAV86774.1| hypothetical protein AM859 [Anaplasma marginale str. St. Maries]
 gi|222419459|gb|ACM49482.1| Putative Holliday junction resolvase (YqgF) [Anaplasma marginale
           str. Florida]
          Length = 164

 Score =  135 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 54/150 (36%), Positives = 77/150 (51%), Gaps = 1/150 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    IE    +L  ++ I  +D G K+ GLA+SD     A P    +R+ V Q   EL 
Sbjct: 8   MLCDSIESFFGALGADRRILGLDFGEKKFGLAVSDSTGTIAMPHSVYLRRNVRQDLGELN 67

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  E I A ++GLPL ++G EG      R+FV  +I +   V     DER TT  A +
Sbjct: 68  AILKREGICAAVVGLPLQLDGMEGEMCAVVRSFVQKLIKK-SGVYVYLHDERFTTAMASR 126

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLD 150
               + + RK   +  D I+AALILQ+VLD
Sbjct: 127 TTESLGLRRKASQKVDDKISAALILQQVLD 156


>gi|118597213|sp|Q1WT34|RUVX_LACS1 RecName: Full=Putative Holliday junction resolvase
          Length = 147

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 46/138 (33%), Positives = 79/138 (57%), Gaps = 4/138 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFII 73
              +  +D+G++ +G+A+SD     A     +   +  Q      +   +    +  F++
Sbjct: 1   MGRLMGLDVGSRTVGVAVSDMLGWTAQGVEIVQINEDEQEFGLDRIAELVKENEVVGFVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKR 132
           GLP NMN + GPRV + +A+   +++ K  +P  F DERLTTV A+++L++  + SRKKR
Sbjct: 61  GLPKNMNNTSGPRVEAAKAYGE-LLEEKFNLPIDFIDERLTTVEAERMLVEQADASRKKR 119

Query: 133 IQKVDSIAAALILQEVLD 150
            + +D +AA+LILQ  LD
Sbjct: 120 KKVIDKLAASLILQNYLD 137


>gi|307708049|ref|ZP_07644517.1| conserved hypothetical protein [Streptococcus mitis NCTC 12261]
 gi|322377241|ref|ZP_08051733.1| putative Holliday junction resolvase [Streptococcus sp. M334]
 gi|307615834|gb|EFN95039.1| conserved hypothetical protein [Streptococcus mitis NCTC 12261]
 gi|321281954|gb|EFX58962.1| putative Holliday junction resolvase [Streptococcus sp. M334]
          Length = 139

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 49/138 (35%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +         +   + T  +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRVKELVDTYKVERFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    ++    +P  + DERLTTV+A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGA-KLEELFGLPVDYQDERLTTVAAERMLIEQADISRNKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|317471885|ref|ZP_07931220.1| hypothetical protein HMPREF1011_01569 [Anaerostipes sp. 3_2_56FAA]
 gi|316900658|gb|EFV22637.1| hypothetical protein HMPREF1011_01569 [Anaerostipes sp. 3_2_56FAA]
          Length = 138

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 45/139 (32%), Positives = 78/139 (56%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D GTK +G+A+SD     A P   + RK   K+ +T   +   +    +   ++
Sbjct: 1   MRILGLDYGTKTVGVALSDELGITAQPFETITRKDENKLRKTYARIEEIVAEYKVEKIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN + G R  +T AF  + + R+  +  + WDERL+TV++ ++L++  V R+ R 
Sbjct: 61  GYPKNMNNTIGERGMATEAF-RDSLVRRTGLDVILWDERLSTVASNKVLMESGVRREHRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA++ILQ  LD +
Sbjct: 120 KVIDQVAASMILQGYLDSL 138


>gi|327540307|gb|EGF26893.1| Resolvase, holliday junction-type, YqgF-like protein
           [Rhodopirellula baltica WH47]
          Length = 173

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 45/147 (30%), Positives = 74/147 (50%), Gaps = 1/147 (0%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
                +AS+D GT RIG+AI DP    A P        + + A   +    +E IAA+++
Sbjct: 13  PATGRLASVDYGTVRIGVAICDPDWILASPLEVHPVSTLEKDAQYFIDLAKSERIAAWVV 72

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP++ +G E  +   +R F    +     +P   +DER TTV+A   +     +RKK  
Sbjct: 73  GLPIHCDGGESDKSKESRKFAAW-LKETTGLPTRLFDERFTTVAANAKIRQGKTTRKKTK 131

Query: 134 QKVDSIAAALILQEVLDRISFLESSKG 160
           Q+VD++AA ++L+  L+   +     G
Sbjct: 132 QRVDAVAAQVLLESFLEACRYRGELAG 158


>gi|168054242|ref|XP_001779541.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162669022|gb|EDQ55617.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 171

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 50/162 (30%), Positives = 86/162 (53%), Gaps = 4/162 (2%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVT--QTALE 58
           M ++ ++ L + L     +  +D+G++ IGLA+SDP  R A P   + R   T  +    
Sbjct: 1   MELVSLKQLFQRLSSGGRLLGLDVGSRNIGLAVSDPKCRIASPHSVMYRSNTTTLKNISR 60

Query: 59  LLSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVH--NMIDRKVYVPFVFWDERLTTV 116
           L S +   NI   +IG PL + G +G +    + F     M  R   + +V+WDERLT+V
Sbjct: 61  LESLVQEMNITGLVIGYPLELTGFQGKQGAQVKLFAKELQMSGRFPNLAYVYWDERLTSV 120

Query: 117 SAQQILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFLESS 158
           +   ++  M+++ ++R   VD ++A  ILQ  LD +S +E+ 
Sbjct: 121 AVTNVIGSMDITGRRRKNIVDKMSALCILQGCLDSLSRIENG 162


>gi|270293966|ref|ZP_06200168.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270275433|gb|EFA21293.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 141

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 38/141 (26%), Positives = 69/141 (48%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++ Q  L+   ++  E +   ++G 
Sbjct: 1   MSRIIAIDYGRKRTGIAVSDTLQMIANGLTTVPTHQLLQFLLD---YVAKEPVERILVGF 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      + +   FV ++  +   +P  + DER T+V A + +++  + +K R   
Sbjct: 58  PKQMNNEASENMKNIEPFVRSLKKKLPDMPVEYVDERFTSVLAHRTMLEAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   F
Sbjct: 118 ALVDEISATIILQTYLENKRF 138


>gi|254995134|ref|ZP_05277324.1| Putative Holliday junction resolvase (YqgF) [Anaplasma marginale
           str. Mississippi]
 gi|255003304|ref|ZP_05278268.1| Putative Holliday junction resolvase (YqgF) [Anaplasma marginale
           str. Puerto Rico]
 gi|255004430|ref|ZP_05279231.1| Putative Holliday junction resolvase (YqgF) [Anaplasma marginale
           str. Virginia]
 gi|62900915|sp|Q5PAA6|RUVX_ANAMM RecName: Full=Putative Holliday junction resolvase
          Length = 157

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 54/150 (36%), Positives = 77/150 (51%), Gaps = 1/150 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    IE    +L  ++ I  +D G K+ GLA+SD     A P    +R+ V Q   EL 
Sbjct: 1   MLCDSIESFFGALGADRRILGLDFGEKKFGLAVSDSTGTIAMPHSVYLRRNVRQDLGELN 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  E I A ++GLPL ++G EG      R+FV  +I +   V     DER TT  A +
Sbjct: 61  AILKREGICAAVVGLPLQLDGMEGEMCAVVRSFVQKLIKK-SGVYVYLHDERFTTAMASR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLD 150
               + + RK   +  D I+AALILQ+VLD
Sbjct: 120 TTESLGLRRKASQKVDDKISAALILQQVLD 149


>gi|313891828|ref|ZP_07825433.1| RNAse H domain protein, YqgF family [Dialister microaerophilus UPII
           345-E]
 gi|329121066|ref|ZP_08249697.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Dialister micraerophilus DSM 19965]
 gi|313119822|gb|EFR43009.1| RNAse H domain protein, YqgF family [Dialister microaerophilus UPII
           345-E]
 gi|327471228|gb|EGF16682.1| YqgF family crossover junction endodeoxyribonuclease, YrrK
           [Dialister micraerophilus DSM 19965]
          Length = 145

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 50/142 (35%), Positives = 78/142 (54%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I ++D+G+  IG+AISD     A     +      +    L + I + ++   ++G+P
Sbjct: 1   MRIMALDVGSHTIGVAISDLMGWTAQGLETIRHSTREKDFERLKTIIDSYDVKEIVVGMP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNMNG++G R   T  FV ++      +P  FWDERLTTV AQ+ LI  ++SRKKR + +
Sbjct: 61  LNMNGTKGIRAELTEDFVKDLKSAFPNIPCAFWDERLTTVMAQKTLISADMSRKKRKKVI 120

Query: 137 DSIAAALILQEVLDRISFLESS 158
           D +AA +IL+  L  + F    
Sbjct: 121 DKLAATVILEGYLRHLEFKRKG 142


>gi|283835290|ref|ZP_06355031.1| putative Holliday junction resolvase [Citrobacter youngae ATCC
           29220]
 gi|291068448|gb|EFE06557.1| putative Holliday junction resolvase [Citrobacter youngae ATCC
           29220]
          Length = 138

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 42/136 (30%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + S D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLSFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNLIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGVTVTLHDERLSTVEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYFEQ 136


>gi|239978414|ref|ZP_04700938.1| hypothetical protein SalbJ_03203 [Streptomyces albus J1074]
 gi|291450310|ref|ZP_06589700.1| conserved hypothetical protein [Streptomyces albus J1074]
 gi|291353259|gb|EFE80161.1| conserved hypothetical protein [Streptomyces albus J1074]
          Length = 158

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 60/137 (43%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 ++D+G  RIG+A  DP    A P   +  + V      L + +        ++G
Sbjct: 6   RRGRRLAVDVGDARIGVASCDPDGILATPVETVPGRDVPAAHRRLAALVEEYEPIEVVVG 65

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EGP     R F   +      VP    DER++TV+A Q +    V  KK   
Sbjct: 66  LPRSLKGGEGPAAVKVRGFAQELARTIAPVPVRLVDERMSTVTAAQGMRASGVRSKKGRA 125

Query: 135 KVDSIAAALILQEVLDR 151
            +D  AA +ILQ  L+ 
Sbjct: 126 VIDQAAAVVILQSALES 142


>gi|170016827|ref|YP_001727746.1| endonuclease [Leuconostoc citreum KM20]
 gi|226731627|sp|B1MXQ0|RUVX_LEUCK RecName: Full=Putative Holliday junction resolvase
 gi|169803684|gb|ACA82302.1| Predicted endonuclease [Leuconostoc citreum KM20]
          Length = 143

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 76/137 (55%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIG 74
             +  +D+G++ +G+A+SDP    A     +   +  +      L   I  +     ++G
Sbjct: 1   MRLLGLDVGSRTVGVAVSDPMGWTAQGVEIIRINEDEKEFGLARLGEIIKEKQAKGVVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN SEGPR  + R +   + + +  +P  F DERLTTV A+++L++  +VSRKKR 
Sbjct: 61  LPKNMNNSEGPRAEAARQYAQMV-EDQFNLPTDFQDERLTTVQAERMLVEEADVSRKKRK 119

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D IAA  ILQ  LD
Sbjct: 120 QVIDKIAAEFILQNYLD 136


>gi|118617375|ref|YP_905707.1| Holliday junction resolvase-like protein [Mycobacterium ulcerans
           Agy99]
 gi|183982184|ref|YP_001850475.1| hypothetical protein MMAR_2171 [Mycobacterium marinum M]
 gi|167012739|sp|A0PPG7|RUVX_MYCUA RecName: Full=Putative Holliday junction resolvase
 gi|226731630|sp|B2HNC2|RUVX_MYCMM RecName: Full=Putative Holliday junction resolvase
 gi|118569485|gb|ABL04236.1| conserved hypothetical protein [Mycobacterium ulcerans Agy99]
 gi|183175510|gb|ACC40620.1| conserved hypothetical protein [Mycobacterium marinum M]
          Length = 170

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 44/144 (30%), Positives = 62/144 (43%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
                 ID+GT RIG+A SDP    A P   + R++  +    L + +        I+GL
Sbjct: 24  RGRRLGIDVGTVRIGVASSDPDGILATPLETVRRERSGKHLRRLATLVGETEAVEVIVGL 83

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P  +    G            +  R   +P    DERLTTVSAQ+ L +  V  K +   
Sbjct: 84  PRTLADRIGSSAQDAIDLADELAARVAPIPVRLADERLTTVSAQRSLREAGVRAKNQRAV 143

Query: 136 VDSIAAALILQEVLDRISFLESSK 159
           +D  AA  ILQ  LD+   L   +
Sbjct: 144 IDQAAAVAILQAWLDQRRTLAGGR 167


>gi|156743642|ref|YP_001433771.1| Holliday junction resolvase YqgF [Roseiflexus castenholzii DSM
           13941]
 gi|156234970|gb|ABU59753.1| Holliday junction resolvase YqgF [Roseiflexus castenholzii DSM
           13941]
          Length = 146

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 49/139 (35%), Positives = 84/139 (60%), Gaps = 1/139 (0%)

Query: 12  SLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAF 71
            +     + ++D+G +RIG+A+SDP R  A P   +  K        + S I   ++AA 
Sbjct: 2   KIDEPGRVMALDVGEQRIGVALSDPTRTLATPLTTIRAKPRATALKRIASLIREHDVAAL 61

Query: 72  IIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           ++GLPL M+G  GP+    + FV   + R + +P  F DERLTTV+A++++ID+ +  ++
Sbjct: 62  VVGLPLTMSGDVGPQAALVQQFVE-ELRRAIAIPLTFVDERLTTVAAERMMIDLKLKPEQ 120

Query: 132 RIQKVDSIAAALILQEVLD 150
           R  ++D +AA++ILQ+ LD
Sbjct: 121 RKARIDEVAASIILQDFLD 139


>gi|153815342|ref|ZP_01968010.1| hypothetical protein RUMTOR_01576 [Ruminococcus torques ATCC 27756]
 gi|317501696|ref|ZP_07959887.1| hypothetical protein HMPREF1026_01831 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331088419|ref|ZP_08337334.1| Holliday junction resolvase [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145847404|gb|EDK24322.1| hypothetical protein RUMTOR_01576 [Ruminococcus torques ATCC 27756]
 gi|316896947|gb|EFV19027.1| hypothetical protein HMPREF1026_01831 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330408186|gb|EGG87674.1| Holliday junction resolvase [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 145

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 72/137 (52%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+K +G+AISD  R  A     + RK   K+ +T   +   I   ++   ++
Sbjct: 1   MRIMGLDYGSKTVGVAISDALRLTAQAVETIERKEENKLRRTCARIEELIKKYDVEKIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P +MN   G R   +  F    + R+  +  + WDERLTTV A++ LI+ NV R+ R 
Sbjct: 61  GFPKHMNNDIGERAQQSMEFGEM-LKRRTGLEVILWDERLTTVEAERTLIESNVRRENRK 119

Query: 134 QKVDSIAAALILQEVLD 150
           + +D IAA  ILQ  LD
Sbjct: 120 KHIDQIAAVFILQGYLD 136


>gi|260589075|ref|ZP_05854988.1| putative holliday junction resolvase [Blautia hansenii DSM 20583]
 gi|331082505|ref|ZP_08331630.1| Holliday junction resolvase [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260540495|gb|EEX21064.1| putative holliday junction resolvase [Blautia hansenii DSM 20583]
 gi|330400483|gb|EGG80113.1| Holliday junction resolvase [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 144

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 72/137 (52%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+K IG+AISDP    A     + R+   K+ ++   +        ++  ++
Sbjct: 1   MRIMGLDYGSKTIGVAISDPLGITAQGIEIIRREEENKLRKSLRRVEELAKEYEVSEIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN + G R   +       ++R++ +P V WDERLTTV A + L++  V R+ R 
Sbjct: 61  GFPKNMNNTIGERAEKSLQL-KEALERRLGLPVVMWDERLTTVEANRTLMETGVRRENRG 119

Query: 134 QKVDSIAAALILQEVLD 150
           + VD IAA  ILQ  LD
Sbjct: 120 KYVDMIAAVFILQGYLD 136


>gi|301300898|ref|ZP_07207070.1| RNAse YqgF [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|300851497|gb|EFK79209.1| RNAse YqgF [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 147

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 46/138 (33%), Positives = 78/138 (56%), Gaps = 4/138 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFII 73
              +  +D+G++ +G+A+SD     A     +   +  Q      +   +    +  F++
Sbjct: 1   MGRLMGLDVGSRTVGVAVSDMLGWTAQGVEIVQINEDEQEFGLDRIAELVKENEVVGFVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKR 132
           GLP NMN + GPRV + +A+   ++  K  +P  F DERLTTV A+++L++  + SRKKR
Sbjct: 61  GLPKNMNNTSGPRVEAAKAYGE-LLKEKFNLPIDFIDERLTTVEAERMLVEQADASRKKR 119

Query: 133 IQKVDSIAAALILQEVLD 150
            + +D +AA+LILQ  LD
Sbjct: 120 KKVIDKLAASLILQNYLD 137


>gi|227891105|ref|ZP_04008910.1| crossover junction endodeoxyribonuclease [Lactobacillus salivarius
           ATCC 11741]
 gi|227866979|gb|EEJ74400.1| crossover junction endodeoxyribonuclease [Lactobacillus salivarius
           ATCC 11741]
          Length = 147

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 46/138 (33%), Positives = 78/138 (56%), Gaps = 4/138 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFII 73
              +  +D+G++ +G+A+SD     A     +   +  Q      +   +    +  F++
Sbjct: 1   MGRLMGLDVGSRTVGVAVSDMLGWTAQGVEIVQINEDEQEFGLDRIAELVKENEVVGFVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKR 132
           GLP NMN + GPRV + +A+   ++  K  +P  F DERLTTV A+++L++  + SRKKR
Sbjct: 61  GLPKNMNNTSGPRVEAAKAYGE-LLKEKFNLPIDFIDERLTTVEAERMLVEQADASRKKR 119

Query: 133 IQKVDSIAAALILQEVLD 150
            + +D +AA+LILQ  LD
Sbjct: 120 KKVIDKLAASLILQNYLD 137


>gi|323341645|ref|ZP_08081878.1| crossover junction endodeoxyribonuclease [Erysipelothrix
           rhusiopathiae ATCC 19414]
 gi|322464070|gb|EFY09263.1| crossover junction endodeoxyribonuclease [Erysipelothrix
           rhusiopathiae ATCC 19414]
          Length = 144

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 71/143 (49%), Gaps = 2/143 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGL 75
             I  +DLG+K  G+A+SD    +AHP   L  K       E L   I  E +    +G 
Sbjct: 3   GKIIGLDLGSKTCGVALSDGLGMYAHPVETLYYKVSIDELKEPLDSLIKKERVKVIALGF 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P  MN   G R   +  F    ++       V  DERLT+V A + LID +VSRKKR + 
Sbjct: 63  PKMMNNDVGERAQISEEF-KKTLESWFNCEVVLIDERLTSVVANRQLIDQDVSRKKRKKV 121

Query: 136 VDSIAAALILQEVLDRISFLESS 158
           VD +AA  ILQ  LD+  F+E +
Sbjct: 122 VDQLAAVHILQTYLDKRRFMEGN 144


>gi|259046501|ref|ZP_05736902.1| Holliday junction resolvase [Granulicatella adiacens ATCC 49175]
 gi|259036666|gb|EEW37921.1| Holliday junction resolvase [Granulicatella adiacens ATCC 49175]
          Length = 144

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 50/139 (35%), Positives = 82/139 (58%), Gaps = 4/139 (2%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFI 72
           PN  +  +D+G+K +G+A+SD     A     +    K        ++  +    +   +
Sbjct: 2   PNMRLMGLDVGSKTVGVAVSDLMGWTAQGVETIPINEKASEFGFKRVVELVEEYGVEKIV 61

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMN-VSRKK 131
           IGLP NMN +EGPRV ++R +    +++++ +P VF DERLTT+ A+++L++   VSRKK
Sbjct: 62  IGLPKNMNNTEGPRVEASRRYGA-SLEKRLQIPIVFHDERLTTMQAERMLVEEGNVSRKK 120

Query: 132 RIQKVDSIAAALILQEVLD 150
           R Q +D +AA +ILQ  LD
Sbjct: 121 RKQVIDMLAAVMILQNYLD 139


>gi|312862410|ref|ZP_07722653.1| RNAse H domain protein, YqgF family [Streptococcus vestibularis
           F0396]
 gi|322515847|ref|ZP_08068791.1| crossover junction endodeoxyribonuclease [Streptococcus
           vestibularis ATCC 49124]
 gi|311102053|gb|EFQ60253.1| RNAse H domain protein, YqgF family [Streptococcus vestibularis
           F0396]
 gi|322125733|gb|EFX97055.1| crossover junction endodeoxyribonuclease [Streptococcus
           vestibularis ATCC 49124]
          Length = 139

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 50/139 (35%), Positives = 79/139 (56%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV--TQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+AISDP    A     +   +         L   +    +  F++G
Sbjct: 1   MRVMGLDVGSKTVGVAISDPLGFTAQGVEIIKIDEEAEEFGFDRLGELVKEYKVEKFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN +EGPRV +++A+    I     +P  + DERLTTV A+++L++  +VSR KR 
Sbjct: 61  LPKNMNNTEGPRVEASKAYGD-KIKEIFEIPVDYQDERLTTVQAERMLVEQADVSRGKRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA LILQ  LDR+
Sbjct: 120 KVIDKLAAQLILQNYLDRM 138


>gi|237722140|ref|ZP_04552621.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|260170793|ref|ZP_05757205.1| Holliday junction resolvase-like protein [Bacteroides sp. D2]
 gi|299149163|ref|ZP_07042224.1| putative Holliday junction resolvase [Bacteroides sp. 3_1_23]
 gi|315919127|ref|ZP_07915367.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|229447950|gb|EEO53741.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|298512830|gb|EFI36718.1| putative Holliday junction resolvase [Bacteroides sp. 3_1_23]
 gi|313693002|gb|EFS29837.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 138

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 42/141 (29%), Positives = 68/141 (48%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++     E   +I  E +   IIGL
Sbjct: 1   MSRIVAIDYGRKRTGIAVSDTMQLIANGLTTVPTHELLNFIGE---YIAKEPVERIIIGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      + +   FV ++  R   +P  + DER T+V A + +++  + +K R   
Sbjct: 58  PKQMNNEVSENMKNIEPFVRSLKKRYPDLPVEYVDERFTSVLAHRTMLEAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   F
Sbjct: 118 ALVDEISATIILQTYLESKRF 138


>gi|120403626|ref|YP_953455.1| Holliday junction resolvase YqgF [Mycobacterium vanbaalenii PYR-1]
 gi|119956444|gb|ABM13449.1| Holliday junction resolvase YqgF [Mycobacterium vanbaalenii PYR-1]
          Length = 175

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/141 (29%), Positives = 61/141 (43%), Gaps = 1/141 (0%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK-VTQTALELLSFITTENIAAFI 72
                   +D+GT RIG+A+SDP    A P   + R K  T+    L + +    +   +
Sbjct: 23  PGRGRRLGVDVGTVRIGVAVSDPDAILATPVETVPRDKRGTKHVRRLAALVDEYQVVEVV 82

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLP  +    G            +  R   VP    DER TTV+AQ+ L +  V  + +
Sbjct: 83  VGLPRTLADRAGSSAQDATEVAEVLAGRIAPVPVRLADERFTTVTAQRALREAGVRARGQ 142

Query: 133 IQKVDSIAAALILQEVLDRIS 153
              +D  AA  ILQ  LD+  
Sbjct: 143 RSVIDQAAAVGILQNWLDQRR 163


>gi|269837589|ref|YP_003319817.1| Holliday junction resolvase YqgF [Sphaerobacter thermophilus DSM
           20745]
 gi|269786852|gb|ACZ38995.1| Holliday junction resolvase YqgF [Sphaerobacter thermophilus DSM
           20745]
          Length = 143

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 56/139 (40%), Positives = 80/139 (57%), Gaps = 3/139 (2%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P + + ++D+G +R+G+A+SD     A P   +  K+       L++ I   +    IIG
Sbjct: 7   PGRRLIALDVGARRVGVAVSDELGLIASPVESVDMKRDGM--DRLVALIERYDPERIIIG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPL M+G EGP+  +TRAF    +  +V  P +FWDERLTT  A Q LI+    R +R Q
Sbjct: 65  LPLGMSGREGPQAAATRAFAQ-QLRGRVDRPIIFWDERLTTFMADQSLIEAGHRRARRKQ 123

Query: 135 KVDSIAAALILQEVLDRIS 153
            VD++AAALILQ  LD   
Sbjct: 124 HVDAVAAALILQSYLDSQR 142


>gi|148657331|ref|YP_001277536.1| Holliday junction resolvase YqgF [Roseiflexus sp. RS-1]
 gi|226731646|sp|A5UY83|RUVX_ROSS1 RecName: Full=Putative Holliday junction resolvase
 gi|148569441|gb|ABQ91586.1| Holliday junction resolvase YqgF [Roseiflexus sp. RS-1]
          Length = 141

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 47/140 (33%), Positives = 81/140 (57%), Gaps = 1/140 (0%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
                + ++D+G +RIG+A+SDP R  A P   +     +     +L+ I    + A ++
Sbjct: 3   SEPGRVMALDVGERRIGVALSDPTRMLASPLTTIRAVPRSTALKRILTLIRDYQVTALVV 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLPL MNG  GP+    + FV   +   + +P  F DERLTTV+A++++ID+ +  ++R 
Sbjct: 63  GLPLTMNGDIGPQATLVQQFVD-ELRPLIDIPIFFVDERLTTVAAERMMIDLKIKPEQRR 121

Query: 134 QKVDSIAAALILQEVLDRIS 153
            ++D +AA++ILQ+ LD   
Sbjct: 122 ARIDEVAASIILQDFLDSQR 141


>gi|302037044|ref|YP_003797366.1| putative holliday junction resolvase [Candidatus Nitrospira
           defluvii]
 gi|300605108|emb|CBK41441.1| predicted Holliday junction resolvase (modular protein) [Candidatus
           Nitrospira defluvii]
          Length = 203

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 46/138 (33%), Positives = 73/138 (52%), Gaps = 1/138 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
             Q I +ID G+KRIG A+SD     A P     R+        +   +    +   ++G
Sbjct: 2   KGQRILAIDHGSKRIGFALSDELGWTAQPLETFYRRNPDADIRHIQDLVREHEVGQVLVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           +PL ++G  GP       F+  +++  + VP + WDER+TT +A+ +LI  +V R+KR  
Sbjct: 62  MPLRLDGEIGPAAKVVAEFIQ-LLEPALSVPVITWDERMTTCAAEDLLIAADVGRRKRKG 120

Query: 135 KVDSIAAALILQEVLDRI 152
            VD IAAA++LQ  L  +
Sbjct: 121 IVDRIAAAILLQSYLASL 138


>gi|21911333|ref|NP_665601.1| Holliday junction resolvase-like protein [Streptococcus pyogenes
           MGAS315]
 gi|21905548|gb|AAM80404.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315]
          Length = 136

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 49/135 (36%), Positives = 78/135 (57%), Gaps = 4/135 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +    +K       L   +    +  F+IGLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGFTAQGLEIIKIDEEKAEFGFTRLEELVKQYQVEQFVIGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN + GPRV ++  + ++ I+    +P  + DERLTTV A+++LI+  ++SR KR + +
Sbjct: 61  NMNNTNGPRVDASITYGNH-IEHLFGLPVHYQDERLTTVEAERMLIEQADISRGKRKKVI 119

Query: 137 DSIAAALILQEVLDR 151
           D +AA LILQ  L+R
Sbjct: 120 DKLAAQLILQNYLNR 134


>gi|332654093|ref|ZP_08419837.1| putative Holliday junction resolvase [Ruminococcaceae bacterium
           D16]
 gi|332517179|gb|EGJ46784.1| putative Holliday junction resolvase [Ruminococcaceae bacterium
           D16]
          Length = 140

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 47/141 (33%), Positives = 67/141 (47%), Gaps = 1/141 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             + +ID G    G+AISDP    A     +  +K      EL   +    +   ++G P
Sbjct: 1   MRVMAIDYGDAHTGVAISDPTGFLAGMTTTIHSRKAEVVLSELARLVKEHQVDQLVMGFP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NM+G+EGPR    R F   +       P   WDER TTV A +IL +   + KKR + V
Sbjct: 61  RNMDGTEGPRAQLYRDFAAQVAQATGLEPV-LWDERRTTVDAHRILAEGGKNAKKRKKTV 119

Query: 137 DSIAAALILQEVLDRISFLES 157
           D++AA+LIL+  LD       
Sbjct: 120 DAVAASLILEGYLDFQRMKNR 140


>gi|306834532|ref|ZP_07467645.1| crossover junction endodeoxyribonuclease [Streptococcus bovis ATCC
           700338]
 gi|304423334|gb|EFM26487.1| crossover junction endodeoxyribonuclease [Streptococcus bovis ATCC
           700338]
          Length = 136

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 50/136 (36%), Positives = 79/136 (58%), Gaps = 4/136 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +   +         L   +    +  F++GLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGFTAQGVEIVRIDEEAGEFGFERLEELVKQYKVDKFVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN +EGPRV +++A+    I+    +P  + DERLTTV A+++L++  +VSR KR + +
Sbjct: 61  NMNNTEGPRVEASKAYGD-KINELFNIPVDYQDERLTTVQAERMLVEQADVSRGKRKKVI 119

Query: 137 DSIAAALILQEVLDRI 152
           D +AA LILQ  LDR+
Sbjct: 120 DKLAAQLILQNYLDRM 135


>gi|170765861|ref|ZP_02900672.1| putative Holliday junction resolvase [Escherichia albertii TW07627]
 gi|170125007|gb|EDS93938.1| putative Holliday junction resolvase [Escherichia albertii TW07627]
          Length = 138

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWLPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGVDVKLHDERLSTVEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYFEQ 136


>gi|219847050|ref|YP_002461483.1| Holliday junction resolvase YqgF [Chloroflexus aggregans DSM 9485]
 gi|254767505|sp|B8GC73|RUVX_CHLAD RecName: Full=Putative Holliday junction resolvase
 gi|219541309|gb|ACL23047.1| Holliday junction resolvase YqgF [Chloroflexus aggregans DSM 9485]
          Length = 142

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 44/138 (31%), Positives = 75/138 (54%), Gaps = 1/138 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           Q I  +D+G +RIG+AISD   R A P   +      +   ++   +    +   ++GLP
Sbjct: 4   QTILGLDVGERRIGVAISDVEARIAAPLTTIPAHPPERAIAQIARLVAERGVRRVVVGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           L M G  GP+  + + FV   +   +  P   +DERLT+V+A+Q+L ++ V   K  +++
Sbjct: 64  LTMRGEHGPQAAAIQRFVD-ALAAVLNCPVEMFDERLTSVAAEQMLRNLGVKPAKIKEQI 122

Query: 137 DSIAAALILQEVLDRISF 154
           D +AA++ILQ+ LD    
Sbjct: 123 DQVAASIILQDYLDARRN 140


>gi|283479686|emb|CAY75602.1| putative Holliday junction resolvase [Erwinia pyrifoliae DSM 12163]
          Length = 141

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 40/139 (28%), Positives = 63/139 (45%), Gaps = 1/139 (0%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           +  +Q + + D GTK IG+AI       A P   L  +        + + +        +
Sbjct: 1   MMSHQTLMAFDFGTKSIGVAIGQQLTGTARPMNALKAQDGIPDWNRIEALLKEWQPDRVV 60

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLPLNM+GSE P     R F +  +  +  V     DERL+TV A+  L +    R   
Sbjct: 61  VGLPLNMDGSEQPLTVRARKFAN-RLHGRFGVQVDLHDERLSTVEARAELFERGGFRALS 119

Query: 133 IQKVDSIAAALILQEVLDR 151
              VDS++A +IL+   + 
Sbjct: 120 KGNVDSLSAVIILESWFEN 138


>gi|225017619|ref|ZP_03706811.1| hypothetical protein CLOSTMETH_01548 [Clostridium methylpentosum
           DSM 5476]
 gi|224949584|gb|EEG30793.1| hypothetical protein CLOSTMETH_01548 [Clostridium methylpentosum
           DSM 5476]
          Length = 145

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/136 (30%), Positives = 64/136 (47%), Gaps = 1/136 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I ++D G  R GLA+ D     A P   +  +       +        ++   ++G P
Sbjct: 1   MKIMAVDFGDARTGLAVCDRTEFLASPIGTIQERDFNMAVCKTAVAAKEYDVKMVVVGYP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NM+GS G R      F    +   + +P   WDER TTVSA Q L ++NV  +KR + V
Sbjct: 61  KNMDGSCGERAKKCEEFAK-RLGEMIPLPIKLWDERQTTVSAHQFLNEVNVRGQKRKEVV 119

Query: 137 DSIAAALILQEVLDRI 152
           D +AA +IL+  L+  
Sbjct: 120 DEVAATIILESYLEYR 135


>gi|319651656|ref|ZP_08005783.1| Holliday junction resolvase [Bacillus sp. 2_A_57_CT2]
 gi|317396723|gb|EFV77434.1| Holliday junction resolvase [Bacillus sp. 2_A_57_CT2]
          Length = 135

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/134 (31%), Positives = 79/134 (58%), Gaps = 3/134 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+A+SD     A     +    ++       +   I    ++  ++GLP 
Sbjct: 1   MGLDVGSKTVGVALSDAFGWTAQGLETIKISEEEKEFGFERISEIIKEHEVSKIVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMNG+ GPR  +++ +    +++   +P V WDERL+T++A+++L++ +VSRKKR + +D
Sbjct: 61  NMNGTIGPRGEASQFYAS-ELEKLFGLPVVLWDERLSTMAAERVLLEADVSRKKRKKVID 119

Query: 138 SIAAALILQEVLDR 151
            +AA +ILQ  L+ 
Sbjct: 120 KMAAVMILQGFLNS 133


>gi|153808040|ref|ZP_01960708.1| hypothetical protein BACCAC_02326 [Bacteroides caccae ATCC 43185]
 gi|149129649|gb|EDM20863.1| hypothetical protein BACCAC_02326 [Bacteroides caccae ATCC 43185]
          Length = 138

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 67/141 (47%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++     +   +I  E +   I+GL
Sbjct: 1   MSRIVAIDYGRKRTGIAVSDTMQLIANGLTTVPTHELLNFIGD---YIAKEPVERIIVGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      + +   FV ++  R   +P  + DER T+V A + + +  + +K R   
Sbjct: 58  PRQMNNEVSENMKNIEPFVRSLKKRFPDIPVEYVDERFTSVLAHRTMQEAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   F
Sbjct: 118 ALVDEISATIILQTYLESKRF 138


>gi|289168746|ref|YP_003447015.1| holiday junction resolvase [Streptococcus mitis B6]
 gi|288908313|emb|CBJ23155.1| holiday junction resolvase [Streptococcus mitis B6]
          Length = 139

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 49/138 (35%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +         +   + T  +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRVKELVDTYKVERFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    ++    +P  + DERLTTV+A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGA-KLEELFSLPVDYQDERLTTVAAERMLIEQADISRNKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|41407176|ref|NP_960012.1| Holliday junction resolvase-like protein [Mycobacterium avium
           subsp. paratuberculosis K-10]
 gi|254775876|ref|ZP_05217392.1| Holliday junction resolvase-like protein [Mycobacterium avium
           subsp. avium ATCC 25291]
 gi|62900995|sp|Q741L2|RUVX_MYCPA RecName: Full=Putative Holliday junction resolvase
 gi|41395527|gb|AAS03395.1| hypothetical protein MAP_1078 [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 167

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/147 (28%), Positives = 60/147 (40%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
                   ID+G+ RIG+A SDP    A P   + R +  +    L + +T       ++
Sbjct: 19  PGRGRRLGIDVGSVRIGVACSDPDAVLATPVETVRRDRSGKHLRRLAALVTELGAVEVVV 78

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP  +    G            +  R    P    DERLTTV+AQ+ L    V  K++ 
Sbjct: 79  GLPRTLADRTGTSALDAIDLADQLARRIAPTPVRLADERLTTVAAQRSLRAAGVRAKEQR 138

Query: 134 QKVDSIAAALILQEVLDRISFLESSKG 160
             +D  AA  ILQ  LD+        G
Sbjct: 139 AVIDQAAAVAILQSWLDQRRAATREAG 165


>gi|313888091|ref|ZP_07821765.1| RNAse H domain protein, YqgF family [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312845781|gb|EFR33168.1| RNAse H domain protein, YqgF family [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 138

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 48/138 (34%), Positives = 72/138 (52%), Gaps = 1/138 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I  +D+G   IG+AISD     A P   + R+       ++   I   N+   ++GL
Sbjct: 1   MNKILGLDVGDVWIGVAISDALMLTAQPLMTIKRESNKIAYEKIHEIIKENNVEKVVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + GP+      F    +  K  V   + DER+TT+ A+Q+LI+ +V R+ R + 
Sbjct: 61  PKNMNNTIGPQSEKVIKFAE-KLKNKFKVEIEYVDERMTTLMAEQVLIEGSVRRENRKKY 119

Query: 136 VDSIAAALILQEVLDRIS 153
           +D IAA  ILQ  LDRI+
Sbjct: 120 IDKIAATYILQSYLDRIN 137


>gi|81428003|ref|YP_395002.1| Holliday junction resolvase-like protein [Lactobacillus sakei
           subsp. sakei 23K]
 gi|146325576|sp|Q38YN7|RUVX_LACSS RecName: Full=Putative Holliday junction resolvase
 gi|78609644|emb|CAI54690.1| Hypothetical protein LCA_0389 [Lactobacillus sakei subsp. sakei
           23K]
          Length = 147

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/137 (30%), Positives = 71/137 (51%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             +   D+G++ +G+A+SD     A     +     +       +   +    +  F++G
Sbjct: 1   MRLMGFDVGSRTVGIAVSDLFGWTAQGVEIIRINEDESEFGLDRVKELVAQHQVTGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN S GPR    + +   + +    +P  + DERLTTV A+++L++  + SRKKR 
Sbjct: 61  LPKNMNNSIGPRAVKAQEYGAMLTELFPEIPVDYIDERLTTVQAERMLVEQADTSRKKRK 120

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D +AA +ILQ  LD
Sbjct: 121 QVIDKLAAVMILQNYLD 137


>gi|290961839|ref|YP_003493021.1| Holliday junction resolvase subunit [Streptomyces scabiei 87.22]
 gi|260651365|emb|CBG74487.1| putative holliday junction resolvase subunit [Streptomyces scabiei
           87.22]
          Length = 154

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 44/146 (30%), Positives = 62/146 (42%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 ++D+G  RIG+A  DP    A P   +  + V      L   +        I+G
Sbjct: 2   RRGRRLALDVGDARIGVASCDPDGILATPVETVPGRDVPAAQRRLRQLVDEYVPMEVIVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EGP     R F   +      VP    DER+TTV+A Q L    V  KK   
Sbjct: 62  LPRSLKGGEGPAAVKVRGFAQELARMIAPVPVRLLDERMTTVTAGQGLRASGVKSKKGRS 121

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            +D  AA +ILQ+ L+       + G
Sbjct: 122 VIDQAAAVIILQQALESERMSGKAPG 147


>gi|189220288|ref|YP_001940928.1| RNase H-like ribonuclease [Methylacidiphilum infernorum V4]
 gi|189187146|gb|ACD84331.1| RNase H-like ribonuclease [Methylacidiphilum infernorum V4]
          Length = 168

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 50/142 (35%), Positives = 74/142 (52%), Gaps = 1/142 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I S+D G K IGLA++D     A P   L  +   +   +L   I    ++  I+GLP N
Sbjct: 25  ILSLDYGNKHIGLAVNDESFSIAIPLDPLPAEPYVKFIGKLKEIIVNYEVSLLIVGLPRN 84

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+GS GP     R FV   + + + +P  F DERLTT  A ++L     + +++ +K+DS
Sbjct: 85  MDGSYGPAAEKVRQFV-LKLKQWIPIPVEFHDERLTTKLADRLLTQCGCNGREKKKKIDS 143

Query: 139 IAAALILQEVLDRISFLESSKG 160
            AAA+ILQ  LD +       G
Sbjct: 144 YAAAVILQSYLDVLPLKGKRAG 165


>gi|298384714|ref|ZP_06994274.1| Holliday junction resolvase [Bacteroides sp. 1_1_14]
 gi|298262993|gb|EFI05857.1| Holliday junction resolvase [Bacteroides sp. 1_1_14]
          Length = 138

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 41/141 (29%), Positives = 68/141 (48%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++     E   ++  E +   IIGL
Sbjct: 1   MSRIVAIDYGRKRTGIAVSDTLQLIANGLTTVPTHELLNFIGE---YVAKEPVERIIIGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      + +   FV ++  R   +P  + DER T+V A + +++  + +K R   
Sbjct: 58  PKQMNNEASENMKNIEPFVRSLKKRFPELPVEYVDERFTSVLAHRTMLEAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   F
Sbjct: 118 ALVDEISATIILQTYLESKRF 138


>gi|322375055|ref|ZP_08049569.1| putative Holliday junction resolvase [Streptococcus sp. C300]
 gi|321280555|gb|EFX57594.1| putative Holliday junction resolvase [Streptococcus sp. C300]
          Length = 139

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 48/138 (34%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +         +   + +  +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIHINEDQGQFGFDRIKELVDSYKVERFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    ++    +P  + DERLTTV+A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGA-KLEELFGLPVDYQDERLTTVAAERMLIEQADISRNKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|229820506|ref|YP_002882032.1| Holliday junction resolvase YqgF [Beutenbergia cavernae DSM 12333]
 gi|229566419|gb|ACQ80270.1| Holliday junction resolvase YqgF [Beutenbergia cavernae DSM 12333]
          Length = 163

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 39/131 (29%), Positives = 64/131 (48%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
             +D+G+ R+G+A  DP    A P   L R+       E+   +  ++    +IGLP  +
Sbjct: 3   LGVDVGSVRVGVARCDPSGVIATPVTTLARRGKRGGVAEIAGLVREDSAIEVVIGLPRAL 62

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +G EG      RA+   +      VP    DERL+TV+A + + +   + ++  + VD  
Sbjct: 63  DGHEGSSARQARAYAGQVARAVEPVPVRLVDERLSTVAAHRAMHEAGRAGRRHREVVDQA 122

Query: 140 AAALILQEVLD 150
           AA +ILQ  LD
Sbjct: 123 AAVVILQSALD 133


>gi|311278135|ref|YP_003940366.1| Holliday junction resolvase YqgF [Enterobacter cloacae SCF1]
 gi|308747330|gb|ADO47082.1| Holliday junction resolvase YqgF [Enterobacter cloacae SCF1]
          Length = 138

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 64/136 (47%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P   L  +  T     +   +T     A I+GL
Sbjct: 2   SGTLIAFDFGTKSIGVAVGQRITGTARPLSALKAQDGTPDWNAVEKILTEWQPDAVIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  +  +  V     DERL+TV A+  L +    R     +
Sbjct: 62  PLNMDGTEQPLTARARKFAN-KLHGRFGVKIELHDERLSTVEARAGLFEHGGYRALNKGR 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYFEQ 136


>gi|222151503|ref|YP_002560659.1| hypothetical protein MCCL_1256 [Macrococcus caseolyticus JCSC5402]
 gi|222120628|dbj|BAH17963.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402]
          Length = 139

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 47/134 (35%), Positives = 69/134 (51%), Gaps = 2/134 (1%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRK--KVTQTALELLSFITTENIAAFIIGLPL 77
             +D+G+K IG+A+SD     A     L             L   I T N+   +IGLP 
Sbjct: 5   IGLDVGSKTIGVALSDAMGWTAQGLTTLRIDEANEDYGIEALKEIIETNNVTTAVIGLPK 64

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NMN + GP   ++  F   +      +  + WDERL+TV A++ L++ +VSRKKR Q +D
Sbjct: 65  NMNNTIGPSGEASLHFSEILKSACPELDIIMWDERLSTVGAERSLLEADVSRKKRKQVID 124

Query: 138 SIAAALILQEVLDR 151
            +AA  ILQ  L+ 
Sbjct: 125 KMAAVFILQGYLNS 138


>gi|228478096|ref|ZP_04062707.1| conserved hypothetical protein [Streptococcus salivarius SK126]
 gi|228250276|gb|EEK09529.1| conserved hypothetical protein [Streptococcus salivarius SK126]
          Length = 139

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 49/139 (35%), Positives = 79/139 (56%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV--TQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+AISDP    A     +   +         L   +    +  F++G
Sbjct: 1   MRVMGLDVGSKTVGVAISDPLGFTAQGVEIIKIDEEAEEFGFDRLGELVKEYKVEKFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN +EGPRV +++A+    I     +P  + DERLTTV A+++L++  ++SR KR 
Sbjct: 61  LPKNMNNTEGPRVEASKAYGD-KIKEIFGIPVDYQDERLTTVQAERMLVEQADISRGKRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA LILQ  LDR+
Sbjct: 120 KVIDKLAAQLILQNYLDRM 138


>gi|16766398|ref|NP_462013.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|167552011|ref|ZP_02345764.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167990376|ref|ZP_02571476.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|194442861|ref|YP_002042356.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|197265538|ref|ZP_03165612.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|200388976|ref|ZP_03215588.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204928137|ref|ZP_03219337.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|238909895|ref|ZP_04653732.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|32130052|sp|Q8ZM50|RUVX_SALTY RecName: Full=Putative Holliday junction resolvase
 gi|226731652|sp|B4T5K4|RUVX_SALNS RecName: Full=Putative Holliday junction resolvase
 gi|16421650|gb|AAL21972.1| putative endonuclease involved in recombination [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|194401524|gb|ACF61746.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|197243793|gb|EDY26413.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|199606074|gb|EDZ04619.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204322459|gb|EDZ07656.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205323262|gb|EDZ11101.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205331084|gb|EDZ17848.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|261248228|emb|CBG26065.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995262|gb|ACY90147.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301159652|emb|CBW19171.1| Putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312914119|dbj|BAJ38093.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|321225770|gb|EFX50824.1| Putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322613494|gb|EFY10435.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322621086|gb|EFY17944.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322624150|gb|EFY20984.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322628111|gb|EFY24900.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322633230|gb|EFY29972.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322636192|gb|EFY32900.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322639530|gb|EFY36218.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322647537|gb|EFY44026.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322648721|gb|EFY45168.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322653776|gb|EFY50102.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322657882|gb|EFY54150.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322663985|gb|EFY60184.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322669004|gb|EFY65155.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673002|gb|EFY69109.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322678007|gb|EFY74070.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322681183|gb|EFY77216.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322687887|gb|EFY83854.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|323131453|gb|ADX18883.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|323194917|gb|EFZ80104.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323199621|gb|EFZ84711.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323202632|gb|EFZ87672.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323207881|gb|EFZ92827.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323212567|gb|EFZ97384.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323214950|gb|EFZ99698.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323222680|gb|EGA07045.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323225423|gb|EGA09655.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323230562|gb|EGA14680.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323235087|gb|EGA19173.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323239126|gb|EGA23176.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323244516|gb|EGA28522.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323247131|gb|EGA31097.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323253386|gb|EGA37215.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323256307|gb|EGA40043.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323262517|gb|EGA46073.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323267387|gb|EGA50871.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323269209|gb|EGA52664.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
 gi|332989964|gb|AEF08947.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 138

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 42/136 (30%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+AI       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAIGQRITGTARPLPAIKAQDGTPDWTLIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGVTVTLHDERLSTVEARSGLFERGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYFEQ 136


>gi|254881557|ref|ZP_05254267.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|254834350|gb|EET14659.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
          Length = 139

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 41/142 (28%), Positives = 69/142 (48%), Gaps = 5/142 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A++D  +  A+    +      Q    +L ++  E +   I+G 
Sbjct: 1   MSRILAIDYGKKRTGVAVTDVLQIIANGLTTVPTH---QLLDFILKYVEKEPVERIIVGH 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN  E   + +   FV+ +  +   +P  F DER T+V A Q ++D  + +K R   
Sbjct: 58  PKQMNNQESENMRNIVPFVNQLRKKLPDIPVEFVDERFTSVLAHQAMLDGGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISFL 155
             VD I+A +ILQ  L+   ++
Sbjct: 118 ALVDEISATIILQSYLESKKYI 139


>gi|310766485|gb|ADP11435.1| putative Holliday junction resolvase [Erwinia sp. Ejp617]
          Length = 141

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 40/139 (28%), Positives = 63/139 (45%), Gaps = 1/139 (0%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           +  +Q + + D GTK IG+AI       A P   L  +        + + +        +
Sbjct: 1   MMSHQTLMAFDFGTKSIGVAIGQQLTGTARPMNALKAQDGIPDWNRIEALLKEWQPDRVV 60

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLPLNM+GSE P     R F +  +  +  V     DERL+TV A+  L +    R   
Sbjct: 61  VGLPLNMDGSEQPLTARARKFAN-RLHGRFGVQVDLHDERLSTVEARAELFERGGFRALS 119

Query: 133 IQKVDSIAAALILQEVLDR 151
              VDS++A +IL+   + 
Sbjct: 120 KGNVDSLSAVIILESWFEN 138


>gi|318057083|ref|ZP_07975806.1| Holliday junction resolvase-like protein [Streptomyces sp.
           SA3_actG]
 gi|318077855|ref|ZP_07985187.1| Holliday junction resolvase-like protein [Streptomyces sp.
           SA3_actF]
          Length = 154

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 42/137 (30%), Positives = 61/137 (44%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 +ID+G  RIG+A  DP    A P   +  + V      + + +        ++G
Sbjct: 2   RRGRRLAIDVGDARIGVASCDPDGILATPVETVPGRDVPAARRRIKALVDEYEPIELVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++ G EG      RAF   +      VP    DER+TTV+A Q L    V+ KK   
Sbjct: 62  LPRSLRGGEGSAAKKVRAFAGGLALLVAPVPVRLVDERMTTVTAGQGLRASGVNTKKGRS 121

Query: 135 KVDSIAAALILQEVLDR 151
            +D  AA +ILQ  L+ 
Sbjct: 122 VIDQAAAVIILQTALES 138


>gi|312880062|ref|ZP_07739862.1| Holliday junction resolvase YqgF [Aminomonas paucivorans DSM 12260]
 gi|310783353|gb|EFQ23751.1| Holliday junction resolvase YqgF [Aminomonas paucivorans DSM 12260]
          Length = 144

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 52/136 (38%), Positives = 75/136 (55%), Gaps = 2/136 (1%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
               + ++DLGT R+G+A+SDP RRFA P   L  +        +   + T  +   ++G
Sbjct: 2   TEGRVLALDLGTVRVGVALSDPTRRFAQPLDVLPAQ--ENWIQRVRELVVTHQVTLVLVG 59

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP   +G+ GP V   R +   +      VP  F+DER TT  AQQ L+  +VSRK R Q
Sbjct: 60  LPTRTDGTAGPEVERVRGWTEELRQGIPQVPIQFYDERFTTRIAQQALLAGDVSRKGRKQ 119

Query: 135 KVDSIAAALILQEVLD 150
           +VD +AAA++LQ  LD
Sbjct: 120 RVDKVAAAVLLQGFLD 135


>gi|160883801|ref|ZP_02064804.1| hypothetical protein BACOVA_01773 [Bacteroides ovatus ATCC 8483]
 gi|156110886|gb|EDO12631.1| hypothetical protein BACOVA_01773 [Bacteroides ovatus ATCC 8483]
          Length = 138

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 42/141 (29%), Positives = 68/141 (48%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++     E   +I  E +   IIGL
Sbjct: 1   MSRIVAIDYGRKRTGIAVSDTMQLIANGLTTVPTHELLNFIGE---YIAKEPVERIIIGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      + +   FV ++  R   +P  + DER T+V A + +++  + +K R   
Sbjct: 58  PKQMNNELSENMKNIEPFVRSLKKRYPDLPVEYVDERFTSVLAHRTMLEAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   F
Sbjct: 118 ALVDEISATIILQTYLESKRF 138


>gi|329961282|ref|ZP_08299448.1| RNAse H domain protein, YqgF family [Bacteroides fluxus YIT 12057]
 gi|328531947|gb|EGF58764.1| RNAse H domain protein, YqgF family [Bacteroides fluxus YIT 12057]
          Length = 141

 Score =  133 bits (336), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 38/141 (26%), Positives = 69/141 (48%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++    L+   ++  E +   ++GL
Sbjct: 1   MSRIIAIDYGRKRTGIAVSDTLQMIANGLTTVPTHQLLTFILD---YVAKEPVERILVGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      + +   FV ++  +   +P  + DER T+V A + +++  + +K R   
Sbjct: 58  PKQMNNEVSENMKNIEPFVRSLQKKLPDMPIEYVDERFTSVLAHRTMLEAGLKKKARQNK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   F
Sbjct: 118 ALVDEISATIILQTYLENRRF 138


>gi|291618771|ref|YP_003521513.1| YqgF [Pantoea ananatis LMG 20103]
 gi|291153801|gb|ADD78385.1| YqgF [Pantoea ananatis LMG 20103]
 gi|327395104|dbj|BAK12526.1| putative Holliday junction resolvase YqgF [Pantoea ananatis
           AJ13355]
          Length = 138

 Score =  133 bits (336), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 40/134 (29%), Positives = 63/134 (47%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           Q +   D GTK IG+A+       A P   +  +  T   L++   +        ++GLP
Sbjct: 4   QTLLGFDFGTKSIGVAVGQQLTGSARPLSAIKAQDGTPDWLQIEKLLKEWQPDFVVVGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+G+E P     R F +  +  +  +     DERL+TV A+  L +    R      V
Sbjct: 64  LNMDGTEQPLTARARKFAN-RLHGRFGIRVELQDERLSTVEARAGLFERGGYRALNKGSV 122

Query: 137 DSIAAALILQEVLD 150
           DS +AA+ILQ+  +
Sbjct: 123 DSQSAAIILQDWFE 136


>gi|237729880|ref|ZP_04560361.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908486|gb|EEH94404.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 138

 Score =  133 bits (336), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 42/136 (30%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + S D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLSFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWSLIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGVTVTLHDERLSTVEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVVILESYFEQ 136


>gi|167747070|ref|ZP_02419197.1| hypothetical protein ANACAC_01782 [Anaerostipes caccae DSM 14662]
 gi|167654030|gb|EDR98159.1| hypothetical protein ANACAC_01782 [Anaerostipes caccae DSM 14662]
          Length = 138

 Score =  133 bits (336), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 45/139 (32%), Positives = 77/139 (55%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D GTK +G+A+SD     A P   + RK   K+ +T   +        +   ++
Sbjct: 1   MRILGLDYGTKTVGVALSDELGITAQPFETITRKDENKLRKTYARIEEIAAEYKVEKIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P NMN + G R  +T AF  + + R+  +  + WDERL+TV++ ++L++  V R+ R 
Sbjct: 61  GYPKNMNNTIGERGMATEAF-RDSLVRRTGLDVILWDERLSTVASNKVLMESGVRREHRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA++ILQ  LD +
Sbjct: 120 KVIDQVAASMILQGYLDSL 138


>gi|302023160|ref|ZP_07248371.1| Holliday junction resolvase-like protein [Streptococcus suis
           05HAS68]
 gi|330831916|ref|YP_004400741.1| Holliday junction resolvase-like protein [Streptococcus suis ST3]
 gi|319757235|gb|ADV69177.1| Holliday junction resolvase-like protein [Streptococcus suis JS14]
 gi|329306139|gb|AEB80555.1| Holliday junction resolvase-like protein [Streptococcus suis ST3]
          Length = 136

 Score =  133 bits (336), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 49/135 (36%), Positives = 80/135 (59%), Gaps = 4/135 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +    +K       L   +    +  F++GLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGFTAQGLEIIPIDEEKGEFGLERLTELVEQYKVDKFVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN + GPRV +++A+   ++  +  +P  + DERLTTV+A+++LI+  ++SR KR + +
Sbjct: 61  NMNNTSGPRVEASQAYGD-LLTERYKLPVDYQDERLTTVAAERMLIEQADISRGKRKKVI 119

Query: 137 DSIAAALILQEVLDR 151
           D +AA LILQ  LDR
Sbjct: 120 DKLAAQLILQNYLDR 134


>gi|270291980|ref|ZP_06198195.1| putative Holliday junction resolvase [Streptococcus sp. M143]
 gi|270279508|gb|EFA25350.1| putative Holliday junction resolvase [Streptococcus sp. M143]
          Length = 139

 Score =  133 bits (336), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 48/138 (34%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +         +   + +  +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEDQGQFGFDRIKELVDSYKVERFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    ++    +P  + DERLTTV+A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGA-KLEELFGLPVDYQDERLTTVAAERMLIEQADISRNKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|259909608|ref|YP_002649964.1| Putative Holliday junction resolvase [Erwinia pyrifoliae Ep1/96]
 gi|224965230|emb|CAX56762.1| Putative Holliday junction resolvase [Erwinia pyrifoliae Ep1/96]
          Length = 140

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 62/137 (45%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            +Q + + D GTK IG+AI       A P   L  +        + + +        ++G
Sbjct: 2   SHQTLMAFDFGTKSIGVAIGQQLTGTARPMNALKAQDGIPDWNRIEALLKEWQPDRVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPLNM+GSE P     R F +  +  +  V     DERL+TV A+  L +    R     
Sbjct: 62  LPLNMDGSEQPLTVRARKFAN-RLHGRFGVQVDLHDERLSTVEARAELFERGGFRALSKG 120

Query: 135 KVDSIAAALILQEVLDR 151
            VDS++A +IL+   + 
Sbjct: 121 NVDSLSAVIILESWFEN 137


>gi|205374237|ref|ZP_03227036.1| Holliday junction resolvase-like protein [Bacillus coahuilensis
           m4-4]
          Length = 138

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 43/137 (31%), Positives = 76/137 (55%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             I  +D+GT+ +G+A+SD     A     +   +         +   +    ++  ++G
Sbjct: 1   MRIMGLDVGTRTVGVAVSDAFGWTAQGIETIKIHEELGFLGYERIKELVKEYEVSKIVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMN + GPR  +++ +    +  K  +P  ++DERLTT+ A+++LI+ +VSR KR +
Sbjct: 61  LPKNMNNTMGPRGEASQRYGE-GLREKFGIPVDYYDERLTTMQAERVLIEADVSRGKRKK 119

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA +ILQ  LDR
Sbjct: 120 VIDKMAAVMILQGYLDR 136


>gi|150006542|ref|YP_001301286.1| Holliday junction resolvase-like protein [Bacteroides vulgatus ATCC
           8482]
 gi|294778839|ref|ZP_06744256.1| RNAse YqgF [Bacteroides vulgatus PC510]
 gi|319642941|ref|ZP_07997577.1| Holliday junction resolvase [Bacteroides sp. 3_1_40A]
 gi|167012694|sp|A6L7K0|RUVX_BACV8 RecName: Full=Putative Holliday junction resolvase
 gi|149934966|gb|ABR41664.1| putative endonuclease [Bacteroides vulgatus ATCC 8482]
 gi|294447292|gb|EFG15875.1| RNAse YqgF [Bacteroides vulgatus PC510]
 gi|317385489|gb|EFV66432.1| Holliday junction resolvase [Bacteroides sp. 3_1_40A]
          Length = 139

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 41/142 (28%), Positives = 69/142 (48%), Gaps = 5/142 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A++D  +  A+    +      Q    +L ++  E +   I+G 
Sbjct: 1   MSRILAIDYGKKRTGVAVTDVLQIIANGLTTVPTH---QLLDFILKYVEKEPVERIIVGH 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN  E   + +   FV+ +  +   +P  F DER T+V A Q ++D  + +K R   
Sbjct: 58  PKQMNNQESENMRNIVPFVNQLRKKIPDIPVEFVDERFTSVLAHQAMLDGGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISFL 155
             VD I+A +ILQ  L+   ++
Sbjct: 118 ALVDEISATIILQSYLESKKYI 139


>gi|237716075|ref|ZP_04546556.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262407687|ref|ZP_06084235.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|298480835|ref|ZP_06999030.1| Holliday junction resolvase [Bacteroides sp. D22]
 gi|229443722|gb|EEO49513.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262354495|gb|EEZ03587.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|298272858|gb|EFI14424.1| Holliday junction resolvase [Bacteroides sp. D22]
          Length = 138

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 41/141 (29%), Positives = 68/141 (48%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++     E   ++  E +   IIGL
Sbjct: 1   MSRIVAIDYGRKRTGIAVSDTMQLIANGLTTVPTHELLNFIGE---YMAKEPVERIIIGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      + +   FV ++  R   +P  + DER T+V A + +++  + +K R   
Sbjct: 58  PKQMNNEVSENMKNIEPFVRSLKKRYPDLPVEYVDERFTSVLAHRTMLEAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   F
Sbjct: 118 ALVDEISATIILQTYLESKRF 138


>gi|323669743|emb|CBJ94867.1| conserved hypothetical protein [Salmonella bongori]
 gi|327412913|emb|CAX67927.1| conserved hypothetical protein [Salmonella bongori]
          Length = 138

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 43/134 (32%), Positives = 62/134 (46%), Gaps = 1/134 (0%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPL 77
            + + D GTK IG+AI       A P P L  +  T     +   +        I+GLPL
Sbjct: 4   TLLAFDFGTKSIGVAIGQRITGTARPLPALKAQDGTPDWTLIERLLKEWQPDEIIVGLPL 63

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     KVD
Sbjct: 64  NMDGTEQPLTARARKFAN-RIHGRFGVTVTLHDERLSTVEARAGLFEQGGYRALNKGKVD 122

Query: 138 SIAAALILQEVLDR 151
           S +A +IL+   ++
Sbjct: 123 SASAVIILESYFEQ 136


>gi|116617674|ref|YP_818045.1| RNase H-like ribonuclease [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|122272125|sp|Q03YQ0|RUVX_LEUMM RecName: Full=Putative Holliday junction resolvase
 gi|116096521|gb|ABJ61672.1| RNase H-like ribonuclease [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
          Length = 143

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 52/142 (36%), Positives = 80/142 (56%), Gaps = 4/142 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIG 74
             I  +D+G++ +G+++SDP    A     +   +  +      L   I  +N    ++G
Sbjct: 1   MRILGLDVGSRTVGVSVSDPMGWTAQGVEIIRINEDEKEFGIDRLGEIIKEKNATGVVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN SEGPR  ++R +   +I++   +P  F DERLTTV A+++LI+  N+SRKKR 
Sbjct: 61  LPKNMNNSEGPRAEASRNYAK-LIEKTFGLPTDFQDERLTTVEAERMLIEEANISRKKRK 119

Query: 134 QKVDSIAAALILQEVLDRISFL 155
           + +D IAA  ILQ  LD    L
Sbjct: 120 KVIDKIAAEFILQNYLDSKGKL 141


>gi|291615388|ref|YP_003525545.1| Holliday junction resolvase YqgF [Sideroxydans lithotrophicus ES-1]
 gi|291585500|gb|ADE13158.1| Holliday junction resolvase YqgF [Sideroxydans lithotrophicus ES-1]
          Length = 148

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 36/144 (25%), Positives = 65/144 (45%), Gaps = 1/144 (0%)

Query: 10  VKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIA 69
           + + + +  + + D GTKRIG+A+ +     A P   +  +K       +   +     A
Sbjct: 1   MAAHRFSGTLLAFDFGTKRIGVAVGNTVSATARPLTTIGAEKNDLRFAAIAELLKEWQPA 60

Query: 70  AFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR 129
           A ++GLP N +G+       +R F +  +  +  +P +  DER T+ +A   L    +  
Sbjct: 61  ALVVGLPCNDDGTPHEMTALSRRFAN-RLKGRFNLPTLLIDERYTSAAASSALDKEGIHG 119

Query: 130 KKRIQKVDSIAAALILQEVLDRIS 153
           +K+   +D  AA  ILQ   D  S
Sbjct: 120 RKQKNLIDQYAAQQILQAYFDEPS 143


>gi|290968330|ref|ZP_06559871.1| RNAse YqgF [Megasphaera genomosp. type_1 str. 28L]
 gi|290781605|gb|EFD94192.1| RNAse YqgF [Megasphaera genomosp. type_1 str. 28L]
          Length = 143

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 49/135 (36%), Positives = 71/135 (52%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I  +D+G+K IG+A SD     A     + RK        L +  T   +   ++G 
Sbjct: 2   RMRILGLDIGSKTIGVACSDALGITAQGITTIQRKTAQDDWQRLQALATERRVTRMVVGR 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MNG +   V    AF+  +  +   + FV+WDERLTT+ A+Q+L+   V R+KR Q 
Sbjct: 62  PRHMNGEDSENVKQIEAFITYLKRQMPAMEFVYWDERLTTMMARQVLMAGGVRREKRKQF 121

Query: 136 VDSIAAALILQEVLD 150
           VD +AA LILQ  LD
Sbjct: 122 VDKMAAILILQNYLD 136


>gi|302671971|ref|YP_003831931.1| holliday junction resolvase YqgF [Butyrivibrio proteoclasticus
           B316]
 gi|302396444|gb|ADL35349.1| holliday junction resolvase YqgF [Butyrivibrio proteoclasticus
           B316]
          Length = 145

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 49/138 (35%), Positives = 74/138 (53%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+K +G+AISD     A  R  + RK   K+ +T   +   I    +   ++
Sbjct: 1   MRIMGLDYGSKTVGVAISDELLLTAQGREIIRRKEENKLRRTLARIEELIVEYGVTKIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLPLNM+ +   R      F  + I+R+  +P V WDERLTTV A +I+ +  +  + R 
Sbjct: 61  GLPLNMDQTPSERSQLCLEF-KDKIERRTGIPVVMWDERLTTVEADEIMDEAGIRGRDRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + VD IAA +ILQ+ LD 
Sbjct: 120 EYVDMIAAQIILQDYLDN 137


>gi|85373365|ref|YP_457427.1| Holliday junction resolvase-like protein [Erythrobacter litoralis
           HTCC2594]
 gi|84786448|gb|ABC62630.1| hypothetical protein ELI_02690 [Erythrobacter litoralis HTCC2594]
          Length = 167

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 56/146 (38%), Positives = 87/146 (59%), Gaps = 1/146 (0%)

Query: 8   DLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN 67
           +   +L     + ++DLGTK IG A SD G RFA     L R +  +   +L   +++ N
Sbjct: 14  EYGDALPDGGVLLALDLGTKTIGTATSDAGWRFATAGKTLPRGRFGKDKAKLQEIVSSRN 73

Query: 68  IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV 127
           +A  ++GLP NM+GSEGPR  ++RA+    +     +P + WDER +T SA+  +I  ++
Sbjct: 74  VAGLVLGLPRNMDGSEGPRAQASRAYAR-NLAEAFGLPVLLWDERWSTQSAESAMIGQDM 132

Query: 128 SRKKRIQKVDSIAAALILQEVLDRIS 153
           SR KR +K+DS AAA+ LQ  LD ++
Sbjct: 133 SRAKRAEKIDSHAAAIFLQAALDTLA 158


>gi|134294911|ref|YP_001118646.1| Holliday junction resolvase-like protein [Burkholderia
           vietnamiensis G4]
 gi|167012706|sp|A4JC08|RUVX_BURVG RecName: Full=Putative Holliday junction resolvase
 gi|134138068|gb|ABO53811.1| Holliday junction resolvase YqgF [Burkholderia vietnamiensis G4]
          Length = 149

 Score =  133 bits (335), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 34/144 (23%), Positives = 65/144 (45%), Gaps = 1/144 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            +    + D G KRIG+A+ +   R A     +           +   +      A ++G
Sbjct: 7   RDATFLAFDYGEKRIGVALGNALTRSARALVVIPNLNREHRFKAVGELLAEWRPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+        + F +  ++ +  +P  + DER ++V A+  L + NV  + R  
Sbjct: 67  LPMHPDGTPHDMTQQAKRFGN-QLNGRFGLPVTWVDERYSSVEAEAGLRERNVRGRARTD 125

Query: 135 KVDSIAAALILQEVLDRISFLESS 158
            +D+ AA +ILQ+  D +S  E  
Sbjct: 126 MLDAEAARVILQQYFDELSDHEHH 149


>gi|319902633|ref|YP_004162361.1| Holliday junction resolvase YqgF [Bacteroides helcogenes P 36-108]
 gi|319417664|gb|ADV44775.1| Holliday junction resolvase YqgF [Bacteroides helcogenes P 36-108]
          Length = 141

 Score =  133 bits (335), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 37/141 (26%), Positives = 70/141 (49%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++    ++   ++  E +   ++GL
Sbjct: 1   MSRIIAIDYGRKRTGIAVSDTLQMIANGLTTVPTHQLLAFIID---YVAKEPVERILVGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      + +   FV ++ ++   +P  + DER T+V A + +++  + +K R   
Sbjct: 58  PKQMNNEVSENMRNIEPFVRSLRNKLPDMPIEYVDERFTSVLAHRTMLEAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   F
Sbjct: 118 ALVDEISATIILQTYLENKRF 138


>gi|261401282|ref|ZP_05987407.1| putative Holliday junction resolvase [Neisseria lactamica ATCC
           23970]
 gi|269208768|gb|EEZ75223.1| putative Holliday junction resolvase [Neisseria lactamica ATCC
           23970]
          Length = 151

 Score =  133 bits (335), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 62/136 (45%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P     + D G  RIG+A  D     +HP   +      +    +   +       F++G
Sbjct: 5   PKGTALAFDFGEARIGVAQGDAELGLSHPLSTVTGSSNDEKFAAIAKLVQEWQPRYFVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+E    H +R F    +  +  +P  + DERL++V A+ +L +  V  KKR  
Sbjct: 65  LPVHTDGTEHEMTHLSRKFGR-RLHGRFGLPVYWVDERLSSVYAESLLSEARVFGKKRKS 123

Query: 135 KVDSIAAALILQEVLD 150
            +D  AA  ILQ   +
Sbjct: 124 VLDQAAAQAILQSFFE 139


>gi|224476714|ref|YP_002634320.1| Holliday junction resolvase-like protein [Staphylococcus carnosus
           subsp. carnosus TM300]
 gi|254767525|sp|B9DNH1|RUVX_STACT RecName: Full=Putative Holliday junction resolvase
 gi|222421321|emb|CAL28135.1| conserved hypothetical protein [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 142

 Score =  133 bits (335), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 45/137 (32%), Positives = 74/137 (54%), Gaps = 2/137 (1%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIGL 75
            I  +D+G+K +G+A+SD     A     L    ++      +L   I  E+    +IGL
Sbjct: 5   KIIGLDVGSKTVGVAVSDLMGWTAQGLDTLRINEEENELGITKLAEIIKKEDADTVVIGL 64

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN S G R  ++  +   ++     +  V WDERL+T++A++ L++ +VSR KR + 
Sbjct: 65  PKNMNNSIGFRGEASLKYKEELLKILPDINVVMWDERLSTMAAERSLLEADVSRSKRKKV 124

Query: 136 VDSIAAALILQEVLDRI 152
           +D +AA  ILQ  LD +
Sbjct: 125 IDKMAAVFILQGYLDSL 141


>gi|291301347|ref|YP_003512625.1| Holliday junction resolvase YqgF [Stackebrandtia nassauensis DSM
           44728]
 gi|290570567|gb|ADD43532.1| Holliday junction resolvase YqgF [Stackebrandtia nassauensis DSM
           44728]
          Length = 151

 Score =  133 bits (335), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 42/149 (28%), Positives = 66/149 (44%), Gaps = 5/149 (3%)

Query: 10  VKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQ-----TALELLSFIT 64
           +    P      +D+G  R+G+A+SDP    A P   + R    +         +   + 
Sbjct: 1   MNDTPPRGRRLGVDVGKVRVGVALSDPDGILAAPLETVPRDMSGKSVPPADISRIADLVN 60

Query: 65  TENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID 124
             ++   +IGLP+ ++G E      +RA+   +      VP  F DERLTT  A + L +
Sbjct: 61  EHSVVEIVIGLPVTLSGEESYAAAESRAYAEQVTAAVGDVPVRFVDERLTTAVASRRLSE 120

Query: 125 MNVSRKKRIQKVDSIAAALILQEVLDRIS 153
             V  K+R   VD  AA  ILQ  L++  
Sbjct: 121 RGVKGKRRKAVVDQAAAVEILQLWLEKQR 149


>gi|224826991|ref|ZP_03700089.1| Holliday junction resolvase YqgF [Lutiella nitroferrum 2002]
 gi|224600824|gb|EEG07009.1| Holliday junction resolvase YqgF [Lutiella nitroferrum 2002]
          Length = 142

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 35/137 (25%), Positives = 66/137 (48%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P+    + D G +RIG+A+ +     AHP   +  +   Q    +   I     A  ++G
Sbjct: 2   PDGTTLAFDFGERRIGVAMGETLLGIAHPLTTIDTEITEQRFAAIGKLIEEWRPAQLVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+E      +R F +  +  +  +P    DER T++ A+ +L +  V  +K+  
Sbjct: 62  LPVHADGTEHDLTRLSRRFAN-RLKGRFGLPVWLVDERHTSLIAESLLNEAGVRGRKQKP 120

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA  ILQ   ++
Sbjct: 121 ALDQVAAQAILQTWFEQ 137


>gi|313668473|ref|YP_004048757.1| hypothetical protein NLA_11710 [Neisseria lactamica ST-640]
 gi|313005935|emb|CBN87392.1| conserved hypothetical protein [Neisseria lactamica 020-06]
          Length = 151

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P     + D G  RIG+A  D     +HP   +      +    +   +       F++G
Sbjct: 5   PKGTALAFDFGEARIGVAQGDAELGLSHPLSTVTGSSNDEKFAAIAKLVQEWQPRYFVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+E    H +R F    +  +  +P  + DERL++V A+ +L +  V  KKR  
Sbjct: 65  LPVHTDGTEHEMTHLSRKFGR-RLHGRFGLPVYWVDERLSSVYAEGLLSEAQVFGKKRKS 123

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA  ILQ   +
Sbjct: 124 VLDQVAAQAILQSFFE 139


>gi|118466058|ref|YP_882612.1| Holliday junction resolvase-like protein [Mycobacterium avium 104]
 gi|118167345|gb|ABK68242.1| conserved hypothetical protein [Mycobacterium avium 104]
          Length = 165

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 42/147 (28%), Positives = 60/147 (40%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
                   ID+G+ RIG+A SDP    A P   + R +  +    L + +T       ++
Sbjct: 17  PGRGRRLGIDVGSVRIGVACSDPDAVLATPVETVRRDRSGKHLRRLAALVTELGAVEVVV 76

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP  +    G            +  R    P    DERLTTV+AQ+ L    V  K++ 
Sbjct: 77  GLPRTLADRTGASALDAIDLADQLARRIAPTPVRLADERLTTVAAQRSLRAAGVRAKEQR 136

Query: 134 QKVDSIAAALILQEVLDRISFLESSKG 160
             +D  AA  ILQ  LD+        G
Sbjct: 137 AVIDQAAAVAILQSWLDQRRAAVREAG 163


>gi|260583980|ref|ZP_05851728.1| Holliday junction resolvase [Granulicatella elegans ATCC 700633]
 gi|260158606|gb|EEW93674.1| Holliday junction resolvase [Granulicatella elegans ATCC 700633]
          Length = 140

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 46/137 (33%), Positives = 81/137 (59%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+AISDP    A     +V  +         ++  +    +   +IG
Sbjct: 1   MRVMGLDVGSKTVGVAISDPLGWTAQGVETIVINEAASEFGFNRVVELVKEYEVEKIVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           +P NMN + GPR  +++ +    +++++ +P VF DERLTT+ A+++L++  NVSRKKR 
Sbjct: 61  MPKNMNNTAGPRAEASQKYGR-SLEKRLEIPIVFHDERLTTMQAERMLVEEANVSRKKRK 119

Query: 134 QKVDSIAAALILQEVLD 150
           + +D +AA +ILQ  LD
Sbjct: 120 EVIDKLAAVIILQNYLD 136


>gi|330994858|ref|ZP_08318780.1| Putative Holliday junction resolvase [Gluconacetobacter sp. SXCC-1]
 gi|329758119|gb|EGG74641.1| Putative Holliday junction resolvase [Gluconacetobacter sp. SXCC-1]
          Length = 246

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 49/151 (32%), Positives = 84/151 (55%), Gaps = 2/151 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +  I  L   L+ +Q +  +D G K IG+A+SD G   A P   L R K++  A ++ 
Sbjct: 84  MPLFNISHLRTLLRRDQRLLGLDPGRKTIGVALSDVGLMLASPHTGLKRAKLSVNAAQIS 143

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +    +++   ++GLPL+++GS GP   + R +    +     +P   WDERL++ +  +
Sbjct: 144 TIARAQDVGGLVVGLPLSLDGSFGPAAQAARDW-TLNLSELTGLPAAMWDERLSSSAVNR 202

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLD 150
            LI + +++R++R   VD +AAA ILQ  LD
Sbjct: 203 FLIAEADMTRQRRGAVVDQMAAAYILQAALD 233


>gi|296314469|ref|ZP_06864410.1| putative Holliday junction resolvase [Neisseria polysaccharea ATCC
           43768]
 gi|296838766|gb|EFH22704.1| putative Holliday junction resolvase [Neisseria polysaccharea ATCC
           43768]
          Length = 151

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P     + D G  RIG+A  D     +HP   +      +    +   +       F++G
Sbjct: 5   PKGTALAFDFGEARIGVAQGDAELGLSHPLATVTGSSNDEKFAAIAKLVQEWQPRYFVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+E    H +R F    +  +  +P  + DERL++V A+ +L +  V  KKR  
Sbjct: 65  LPVHTDGTEHEMTHLSRKFGR-RLHGRFGLPVYWVDERLSSVYAEGLLSEAQVFGKKRKS 123

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA  ILQ   +
Sbjct: 124 VLDQVAAQAILQSFFE 139


>gi|212691279|ref|ZP_03299407.1| hypothetical protein BACDOR_00770 [Bacteroides dorei DSM 17855]
 gi|237712292|ref|ZP_04542773.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|237726431|ref|ZP_04556912.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|265752000|ref|ZP_06087793.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|212666511|gb|EEB27083.1| hypothetical protein BACDOR_00770 [Bacteroides dorei DSM 17855]
 gi|229434957|gb|EEO45034.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
 gi|229453613|gb|EEO59334.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|263236792|gb|EEZ22262.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 139

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 41/142 (28%), Positives = 69/142 (48%), Gaps = 5/142 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A++D  +  A+    +      Q    +L ++  E +   I+G 
Sbjct: 1   MSRILAIDYGKKRTGVAVTDVLQIIANGLTTVPTH---QLLDFILKYVEKEPVERIIVGH 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN  E   + +   FV+ +  +   +P  F DER T+V A Q ++D  + +K R   
Sbjct: 58  PKQMNNQESENMRNIVPFVNQLRKKLPDIPIEFVDERFTSVLAHQAMLDGGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISFL 155
             VD I+A +ILQ  L+   ++
Sbjct: 118 ALVDEISATIILQSYLESKKYI 139


>gi|284991580|ref|YP_003410134.1| Holliday junction resolvase YqgF [Geodermatophilus obscurus DSM
           43160]
 gi|284064825|gb|ADB75763.1| Holliday junction resolvase YqgF [Geodermatophilus obscurus DSM
           43160]
          Length = 222

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 40/135 (29%), Positives = 64/135 (47%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
             ID+GT R+G+AISDP    A P   + R +       + + +    +   I+G P ++
Sbjct: 86  LGIDVGTVRVGVAISDPTGTLASPLETVQRARDESDLDRIAALVVEHEVTEVIVGEPRHL 145

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +G+ G      RA+   +  R   VP    DERL+TV+A   L    +  +++   +D  
Sbjct: 146 SGASGASAKEARAYSRALAGRIGSVPVHLVDERLSTVTAASSLRANGLDSRRQRPVIDQA 205

Query: 140 AAALILQEVLDRISF 154
           AA +ILQ  LD    
Sbjct: 206 AAVVILQAYLDAQRE 220


>gi|268593081|ref|ZP_06127302.1| putative Holliday junction resolvase [Providencia rettgeri DSM
           1131]
 gi|291311350|gb|EFE51803.1| putative Holliday junction resolvase [Providencia rettgeri DSM
           1131]
          Length = 139

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 39/137 (28%), Positives = 60/137 (43%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
             + + + D GTK IG+A+       A P   L          ++   +        I+G
Sbjct: 2   SGRTLLAFDFGTKSIGVAVGQEITGTARPLTSLKASDGRPDWQQIEKLLKEWQPQLVIVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPLNM+G+E       R F +  I  +  V     DERL+TV A+  L +    R     
Sbjct: 62  LPLNMDGTEQLVTSQARNFAN-RIHGRFGVKVELHDERLSTVEAKAGLFEQGGYRALSKG 120

Query: 135 KVDSIAAALILQEVLDR 151
           KVDS +A +IL+   ++
Sbjct: 121 KVDSASAVVILESWFEQ 137


>gi|227510199|ref|ZP_03940248.1| crossover junction endodeoxyribonuclease [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
 gi|227513127|ref|ZP_03943176.1| crossover junction endodeoxyribonuclease [Lactobacillus buchneri
           ATCC 11577]
 gi|227524342|ref|ZP_03954391.1| crossover junction endodeoxyribonuclease [Lactobacillus hilgardii
           ATCC 8290]
 gi|227083702|gb|EEI19014.1| crossover junction endodeoxyribonuclease [Lactobacillus buchneri
           ATCC 11577]
 gi|227088573|gb|EEI23885.1| crossover junction endodeoxyribonuclease [Lactobacillus hilgardii
           ATCC 8290]
 gi|227190404|gb|EEI70471.1| crossover junction endodeoxyribonuclease [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
          Length = 144

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 46/142 (32%), Positives = 77/142 (54%), Gaps = 4/142 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+A+SD     +     +    +        +   +    +  F++G
Sbjct: 1   MRLMGLDVGSKTVGVAVSDSLGWTSQGVEIIPIDEENGEFGLERVAQLVDKYEVDGFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL-IDMNVSRKKRI 133
           LP NMN S GPR  ++  +    +++K  +P  F DERLTTV AQ++L  + ++SR+KR 
Sbjct: 61  LPKNMNNSLGPRAEASEQYGD-RLEKKFKLPVDFEDERLTTVEAQRMLTEEADISRRKRK 119

Query: 134 QKVDSIAAALILQEVLDRISFL 155
           + +D +AA LILQ  LDR   L
Sbjct: 120 KVIDKLAAGLILQNYLDRKGKL 141


>gi|77408149|ref|ZP_00784895.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           COH1]
 gi|77173249|gb|EAO76372.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           COH1]
          Length = 136

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 76/136 (55%), Gaps = 4/136 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +    +        L   +    +  F++GLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGFTAQGLEIIKIDEESGNFGFDRLAELVKEYKVDKFVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN + GPRV +++ +    I     +P  + DERLTTV A+++L++  ++SR KR + +
Sbjct: 61  NMNNTSGPRVEASQVYGD-KITELFNLPVEYQDERLTTVQAERMLVEQADISRGKRKKVI 119

Query: 137 DSIAAALILQEVLDRI 152
           D +AA LILQ  LDR+
Sbjct: 120 DKLAAQLILQNYLDRM 135


>gi|304440513|ref|ZP_07400400.1| crossover junction endodeoxyribonuclease [Peptoniphilus duerdenii
           ATCC BAA-1640]
 gi|304370991|gb|EFM24610.1| crossover junction endodeoxyribonuclease [Peptoniphilus duerdenii
           ATCC BAA-1640]
          Length = 141

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 43/139 (30%), Positives = 72/139 (51%), Gaps = 1/139 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
                 +D+G K IG++ISD     A     + R    +   E+   +   NI   ++G+
Sbjct: 1   MNRFLGLDVGDKYIGVSISDTTCTIASNLVTIRRTSNDKAYEEIEGILNDYNIGTVVVGV 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P+NM+GS+       R F    +  K  V  +F DER T++ A++ LI  NV R+ R + 
Sbjct: 61  PINMDGSDTVMSKRIRKFAR-KLTPKFGVEVIFQDERFTSIEAERTLIQSNVRRENRKKY 119

Query: 136 VDSIAAALILQEVLDRISF 154
           +D +AA++ILQ  +DR++ 
Sbjct: 120 IDQLAASIILQTYIDRMNN 138


>gi|160931527|ref|ZP_02078922.1| hypothetical protein CLOLEP_00359 [Clostridium leptum DSM 753]
 gi|156869398|gb|EDO62770.1| hypothetical protein CLOLEP_00359 [Clostridium leptum DSM 753]
          Length = 139

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 64/136 (47%), Gaps = 1/136 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I  IDLG  R G+A+ D     A P   +      +   +++            +GLP N
Sbjct: 3   ILGIDLGKARTGVAVCDRAEMLASPLCVIQEHNRERLIEKIVKLSNERRAEQIALGLPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           M+GSEG    + R F   ++  K  +P  F DER TTV+A   L   +V  KKR   VDS
Sbjct: 63  MDGSEGESAQNAREFGA-LLQEKTGLPVAFVDERGTTVTAHGYLNQTDVRGKKRKAVVDS 121

Query: 139 IAAALILQEVLDRISF 154
           +AA +ILQ  LD    
Sbjct: 122 VAAVIILQNYLDYRRN 137


>gi|87198928|ref|YP_496185.1| Holliday junction resolvase YqgF [Novosphingobium aromaticivorans
           DSM 12444]
 gi|146325585|sp|Q2G9X2|RUVX_NOVAD RecName: Full=Putative Holliday junction resolvase
 gi|87134609|gb|ABD25351.1| Holliday junction resolvase YqgF [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 155

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 53/153 (34%), Positives = 84/153 (54%), Gaps = 2/153 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M      ++  +L     +  +D GTK IG+A+ D   RFA     + R K      ++ 
Sbjct: 1   MITQSALEMRDALAEGGSLIGLDTGTKTIGVALCDREWRFATAGTTIRRTKFAADKAQIR 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +    +   +IGLPLNM+GSE PR    RA   N+    + +P + WDER TT +A++
Sbjct: 61  AIVAERGVKGIVIGLPLNMDGSESPRSQGARAMARNL--EDLGLPILLWDERWTTQAAER 118

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
            +I+ + SR KR +++DS AAALILQ  +D ++
Sbjct: 119 AMIEQDFSRAKRAERIDSHAAALILQGAIDALA 151


>gi|310829301|ref|YP_003961658.1| RNAse H-fold protein YqgF [Eubacterium limosum KIST612]
 gi|308741035|gb|ADO38695.1| RNAse H-fold protein YqgF [Eubacterium limosum KIST612]
          Length = 178

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/134 (30%), Positives = 71/134 (52%), Gaps = 1/134 (0%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPL 77
            +  +D+G K IG+A+SDP    A       R             +   N+   + GLP 
Sbjct: 41  RLLGLDVGDKYIGIAVSDPLGITAQGYRTWKRGTRDDDLAFFTDVVEQFNVTTLVSGLPK 100

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           +M G+E  +   TR F    + +++ +  V+ DERLT+ +++++LI+  V R+KR + +D
Sbjct: 101 DMEGNETAQARKTRNFCQF-LKKRLNLEVVYIDERLTSKASERVLIEGGVRREKRKEYID 159

Query: 138 SIAAALILQEVLDR 151
           ++AA +ILQ  LD 
Sbjct: 160 TLAAQMILQVYLDS 173


>gi|293364362|ref|ZP_06611088.1| crossover junction endodeoxyribonuclease [Streptococcus oralis ATCC
           35037]
 gi|291317208|gb|EFE57635.1| crossover junction endodeoxyribonuclease [Streptococcus oralis ATCC
           35037]
          Length = 139

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 48/138 (34%), Positives = 79/138 (57%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             I  +D+G+K +G+AISDP    A     +   +         +   +    +  F++G
Sbjct: 1   MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEDQGQFGFDRIKELVDIYKVERFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    ++    +P  + DERLTTV+A+++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGA-KLEELFGLPVDYQDERLTTVAAERMLIEQADISRNKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAQLILQNYLDR 137


>gi|308188042|ref|YP_003932173.1| Holliday junction resolvase [Pantoea vagans C9-1]
 gi|308058552|gb|ADO10724.1| putative Holliday junction resolvase [Pantoea vagans C9-1]
          Length = 139

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 60/135 (44%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           Q +   D GTK IG+A+       A P   +  +        +   +        ++GLP
Sbjct: 4   QTLLGFDFGTKSIGVAVGQELTGSARPLTAIKAQDGIPDWQVIEKLLKEWQPDFVVVGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+G+E P     R F +  +  +  +     DERL+TV A+  L +    R      V
Sbjct: 64  LNMDGTEQPLTDRARKFAN-RLHGRFGIRVELQDERLSTVEARAGLFERGGYRALNKGSV 122

Query: 137 DSIAAALILQEVLDR 151
           DS +AA+ILQ+  + 
Sbjct: 123 DSQSAAIILQDWFEN 137


>gi|296110666|ref|YP_003621047.1| Holliday junction resolvase-like protein [Leuconostoc kimchii IMSNU
           11154]
 gi|295832197|gb|ADG40078.1| Holliday junction resolvase-like protein [Leuconostoc kimchii IMSNU
           11154]
          Length = 143

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 52/137 (37%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIG 74
             I  +D+G++ +G+A+SDP    A     +   +  +      L   I  +     ++G
Sbjct: 1   MRILGLDVGSRTVGVAVSDPMGWTAQGVEIIRINEDEKEFGLERLGEIIKDKQAKGVVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN SEGPR  ++R +   + D+   +P  F DERLTTV A+++LI+  N+SRKKR 
Sbjct: 61  LPKNMNNSEGPRAEASRLYAKMVQDKF-NLPIDFQDERLTTVQAERMLIEEANISRKKRK 119

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D IAA  ILQ  LD
Sbjct: 120 QVIDKIAAEFILQNYLD 136


>gi|148360766|ref|YP_001251973.1| putative ribonuclease [Legionella pneumophila str. Corby]
 gi|148282539|gb|ABQ56627.1| putative ribonuclease with RNase H fold; smart00732 [Legionella
           pneumophila str. Corby]
          Length = 142

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/137 (29%), Positives = 63/137 (45%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P       D G KRIG+A+       A P   +  K        +   IT  N  A I+G
Sbjct: 5   PRGVYLGFDFGYKRIGVAVGQRLTCSASPLSTIEAKAGIPDWNTIQKVITQWNPQALIVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP  ++  E     + R F    + ++  +P    DERL+TV A+  L +    R+ +  
Sbjct: 65  LPTCIDDRELYTTSAARCFAK-QLHKRFSLPVHLVDERLSTVEARGYLFEQGGYRQIKKA 123

Query: 135 KVDSIAAALILQEVLDR 151
           +VDSIAA +IL++ L +
Sbjct: 124 EVDSIAACVILEQWLQQ 140


>gi|83945529|ref|ZP_00957876.1| hypothetical protein OA2633_01404 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851105|gb|EAP88963.1| hypothetical protein OA2633_01404 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 162

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 55/142 (38%), Positives = 84/142 (59%), Gaps = 1/142 (0%)

Query: 12  SLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAF 71
           +L P  P+ +ID GTK +G+A+S+  R    P   + R+K TQ A  LL+          
Sbjct: 7   ALLPQGPLMAIDPGTKTLGVAVSNTDRTLVTPLTTIQREKFTQDAQALLNLYDERACVGL 66

Query: 72  IIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           I+GLPL+M+G +G R  S+R+FV N++ R   +P  + DERL+T +A + LI+  V    
Sbjct: 67  IVGLPLHMHGGDGRRAQSSRSFVTNLL-RLRDLPVAYQDERLSTFAATESLIEAGVKPSH 125

Query: 132 RIQKVDSIAAALILQEVLDRIS 153
           R   VD+ AAA+IL+  + RI+
Sbjct: 126 RKDFVDAQAAAVILESAIGRIN 147


>gi|329296973|ref|ZP_08254309.1| Holliday junction resolvase YqgF [Plautia stali symbiont]
          Length = 138

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/133 (30%), Positives = 60/133 (45%), Gaps = 1/133 (0%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPL 77
            +   D GTK IG+AI       A P   L  +  T     +   +        ++GLPL
Sbjct: 5   TLLGFDFGTKSIGVAIGQQLTGTARPLTALKAQDGTPDWELIGKLLKEWRPDCVVVGLPL 64

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NM+GSE P     R F +  +  +  V     DERL+TV A+  L +    R  +   +D
Sbjct: 65  NMDGSEQPLTARARKFAN-RLHGRFGVRVELQDERLSTVEARADLFERGGYRALQKGHID 123

Query: 138 SIAAALILQEVLD 150
           S +A +ILQ+  +
Sbjct: 124 SQSAVIILQDWFE 136


>gi|322392530|ref|ZP_08065990.1| crossover junction endodeoxyribonuclease [Streptococcus peroris
           ATCC 700780]
 gi|321144522|gb|EFX39923.1| crossover junction endodeoxyribonuclease [Streptococcus peroris
           ATCC 700780]
          Length = 136

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 49/135 (36%), Positives = 79/135 (58%), Gaps = 4/135 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +   +         L   + +  +  F++GLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGFTAQGLEIIQINEDQGQFGFDRLKELVESYKVEHFVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN + GPRV +++A+    ++    +P  + DERLTTV+A+++LI+  +VSR KR + +
Sbjct: 61  NMNNTSGPRVEASQAYGA-KLEELFGLPVEYQDERLTTVAAERMLIEQADVSRNKRKKVI 119

Query: 137 DSIAAALILQEVLDR 151
           D +AA LILQ  LDR
Sbjct: 120 DKLAAQLILQNYLDR 134


>gi|292487084|ref|YP_003529954.1| putative Holliday junction resolvase [Erwinia amylovora CFBP1430]
 gi|291552501|emb|CBA19546.1| putative Holliday junction resolvase [Erwinia amylovora CFBP1430]
 gi|312171187|emb|CBX79446.1| putative Holliday junction resolvase [Erwinia amylovora ATCC
           BAA-2158]
          Length = 141

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 42/139 (30%), Positives = 62/139 (44%), Gaps = 1/139 (0%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           +  NQ   + D GTK IG+AI       A P   L  +        L + +        +
Sbjct: 1   MMRNQTCLAFDFGTKSIGVAIGQQLTGTARPLIALKAQDGIPDWNRLEALLKEWQPDRVV 60

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLPLNM+GSE P     R F +  +  +  V     DERL+TV A+  L +    R   
Sbjct: 61  VGLPLNMDGSEQPLTVRARKFAN-RLHGRFGVQVDLHDERLSTVEARAELFERGGFRALS 119

Query: 133 IQKVDSIAAALILQEVLDR 151
              VDS++A +IL+   + 
Sbjct: 120 KGNVDSLSAVIILESWFEN 138


>gi|29345829|ref|NP_809332.1| Holliday junction resolvase-like protein [Bacteroides
           thetaiotaomicron VPI-5482]
 gi|253567815|ref|ZP_04845226.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|32130022|sp|Q8AAP5|RUVX_BACTN RecName: Full=Putative Holliday junction resolvase
 gi|29337722|gb|AAO75526.1| putative endonuclease [Bacteroides thetaiotaomicron VPI-5482]
 gi|251841888|gb|EES69968.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 138

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 67/141 (47%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++         ++  E +   IIGL
Sbjct: 1   MSRIVAIDYGRKRTGIAVSDTLQLIANGLTTVPTHELLNFI---GGYVAKEPVERIIIGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      + +   FV ++  R   +P  + DER T+V A + +++  + +K R   
Sbjct: 58  PKQMNNEASENMKNIEPFVRSLKKRFPELPVEYVDERFTSVLAHRTMLEAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   F
Sbjct: 118 ALVDEISATIILQTYLESKRF 138


>gi|288801321|ref|ZP_06406775.1| Holliday junction resolvase [Prevotella sp. oral taxon 299 str.
           F0039]
 gi|288331704|gb|EFC70188.1| Holliday junction resolvase [Prevotella sp. oral taxon 299 str.
           F0039]
          Length = 137

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 42/137 (30%), Positives = 66/137 (48%), Gaps = 5/137 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR GLA++D  +  A+    +    + +      ++I  E +   IIGL
Sbjct: 1   MSRILAIDYGQKRTGLAVTDTLQLIANGLDTIPTHTLYEFL---CAYIEKEPVERIIIGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P   NG     +     FV      +  VP  ++DER T+V A + +ID  + +K R   
Sbjct: 58  PRQTNGLPSENMKRIEPFVARWKKHQPNVPIEYYDERFTSVLAHRAMIDGGLKKKARQDK 117

Query: 134 QKVDSIAAALILQEVLD 150
             VD I+A +ILQ+ L+
Sbjct: 118 ALVDKISATIILQDYLE 134


>gi|218259649|ref|ZP_03475312.1| hypothetical protein PRABACTJOHN_00971 [Parabacteroides johnsonii
           DSM 18315]
 gi|218224965|gb|EEC97615.1| hypothetical protein PRABACTJOHN_00971 [Parabacteroides johnsonii
           DSM 18315]
          Length = 140

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/141 (29%), Positives = 73/141 (51%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR GLA++D  +  A+    +   ++T+   +   +++ E +  F++GL
Sbjct: 1   MGRIIAIDYGRKRTGLAVTDTLQMIANGLTTVPSGELTKFLAD---YVSREPVERFVVGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      +    AFV ++      +P  ++DER T+V A + ++D  + +KKR   
Sbjct: 58  PKQMNNELSENMKYVEAFVAHLKRTIPDIPVEYYDERFTSVLAHKAMLDGGLKKKKRQDK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   +
Sbjct: 118 GLVDEISAVIILQSYLENKKY 138


>gi|54296606|ref|YP_122975.1| Holliday junction resolvase-like protein [Legionella pneumophila
           str. Paris]
 gi|62900944|sp|Q5X7G8|RUVX_LEGPA RecName: Full=Putative Holliday junction resolvase
 gi|53750391|emb|CAH11785.1| hypothetical protein lpp0637 [Legionella pneumophila str. Paris]
          Length = 139

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/137 (29%), Positives = 63/137 (45%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P       D G KRIG+A+       A P   +  K        +   IT  N  A I+G
Sbjct: 2   PRGVYLGFDFGYKRIGVAVGQRLTCSASPLSTIEAKAGIPDWNTIQKVITQWNPQALIVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP  ++  E     + R F    + ++  +P    DERL+TV A+  L +    R+ +  
Sbjct: 62  LPTCIDDRELYTTSAARHFAK-QLHKRFSLPVHLVDERLSTVEARGYLFEQGGYRQIKKA 120

Query: 135 KVDSIAAALILQEVLDR 151
           +VDSIAA +IL++ L +
Sbjct: 121 EVDSIAACVILEQWLQQ 137


>gi|22538225|ref|NP_689076.1| Holliday junction resolvase-like protein [Streptococcus agalactiae
           2603V/R]
 gi|76788469|ref|YP_330619.1| Holliday junction resolvase-like protein [Streptococcus agalactiae
           A909]
 gi|76799707|ref|ZP_00781806.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           18RS21]
 gi|77406617|ref|ZP_00783663.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           H36B]
 gi|77410840|ref|ZP_00787197.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           CJB111]
 gi|77412943|ref|ZP_00789146.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           515]
 gi|22535137|gb|AAN00949.1|AE014286_12 conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           2603V/R]
 gi|76563526|gb|ABA46110.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           A909]
 gi|76584940|gb|EAO61599.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           18RS21]
 gi|77160955|gb|EAO72063.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           515]
 gi|77163058|gb|EAO74012.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           CJB111]
 gi|77174776|gb|EAO77599.1| conserved hypothetical protein TIGR00250 [Streptococcus agalactiae
           H36B]
 gi|319745985|gb|EFV98267.1| crossover junction endodeoxyribonuclease [Streptococcus agalactiae
           ATCC 13813]
          Length = 136

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 48/136 (35%), Positives = 77/136 (56%), Gaps = 4/136 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +    +        L   +    +  F++GLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGFTAQGLEIIKIDEESGNFGFDRLAELVKEYKVDKFVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN + GPRV +++A+    I     +P  + DERLTTV A+++L++  ++SR KR + +
Sbjct: 61  NMNNTSGPRVEASQAYGD-KITELFNLPVEYQDERLTTVQAERMLVEQADISRGKRKKVI 119

Query: 137 DSIAAALILQEVLDRI 152
           D +AA LILQ  LDR+
Sbjct: 120 DKLAAQLILQNYLDRM 135


>gi|242278598|ref|YP_002990727.1| Holliday junction resolvase YqgF [Desulfovibrio salexigens DSM
           2638]
 gi|259495701|sp|C6C125|RUVX_DESAD RecName: Full=Putative Holliday junction resolvase
 gi|242121492|gb|ACS79188.1| Holliday junction resolvase YqgF [Desulfovibrio salexigens DSM
           2638]
          Length = 135

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 49/133 (36%), Positives = 75/133 (56%), Gaps = 1/133 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             + SID GTKR+GLAISDP + FA P   + R        ELL  I  E +   +IGLP
Sbjct: 1   MKVLSIDFGTKRVGLAISDPDQIFAFPYKVMERTTRDAMFSELLEIIENEKVGDIVIGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           L+++G +       R F    ++R+V +P    DERL++++A+  L +  +  +KR + +
Sbjct: 61  LSLDGEDTLTTRQVRNFAA-SLERRVDLPIHLVDERLSSIAAEDELKEAGLWDRKRKKNL 119

Query: 137 DSIAAALILQEVL 149
           DS AA +IL+  L
Sbjct: 120 DSQAAKIILETWL 132


>gi|198275232|ref|ZP_03207763.1| hypothetical protein BACPLE_01391 [Bacteroides plebeius DSM 17135]
 gi|198271815|gb|EDY96085.1| hypothetical protein BACPLE_01391 [Bacteroides plebeius DSM 17135]
          Length = 138

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A++DP +  A+    +   ++    L    ++  E +   ++G 
Sbjct: 1   MSRILAIDYGRKRTGIAVTDPMQIIANGLTTVPTHELMDFLL---KYVAQEKVERIVVGH 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN  +   +   + FV  +  +   +P    DER T+V A Q ++D  + +K R   
Sbjct: 58  PKQMNNEDSENMKYIKPFVAQLKKKLPDMPVELVDERFTSVLAHQAMLDGGLKKKARQDK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+    
Sbjct: 118 ALVDEISATIILQSYLESRRM 138


>gi|15827175|ref|NP_301438.1| Holliday junction resolvase-like protein [Mycobacterium leprae TN]
 gi|221229653|ref|YP_002503069.1| Holliday junction resolvase-like protein [Mycobacterium leprae
           Br4923]
 gi|32130062|sp|Q9CCS9|RUVX_MYCLE RecName: Full=Putative Holliday junction resolvase
 gi|254767521|sp|B8ZUJ7|RUVX_MYCLB RecName: Full=Putative Holliday junction resolvase
 gi|13092723|emb|CAC30021.1| conserved hypothetical protein [Mycobacterium leprae]
 gi|219932760|emb|CAR70606.1| conserved hypothetical protein [Mycobacterium leprae Br4923]
          Length = 184

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 47/145 (32%), Positives = 66/145 (45%), Gaps = 1/145 (0%)

Query: 8   DLVKSLKP-NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTE 66
           DL K+L P       ID+G+ RIG+A SDP    A P   + R +  +    L   +   
Sbjct: 16  DLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILATPVETVRRYRSAKHLRRLAELVVEL 75

Query: 67  NIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMN 126
            +   ++GLP  +    G            +  R   VP    DERLTTVSAQ++L    
Sbjct: 76  QVVEVVVGLPWTLTDRTGSSAKDAIDTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAG 135

Query: 127 VSRKKRIQKVDSIAAALILQEVLDR 151
           V  K +   +D  AA +ILQ  LD+
Sbjct: 136 VRAKDQRAVIDQAAAVVILQNWLDQ 160


>gi|331091336|ref|ZP_08340176.1| Holliday junction resolvase [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330404497|gb|EGG84041.1| Holliday junction resolvase [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 142

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 50/139 (35%), Positives = 77/139 (55%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+K +G+AISD     A     + RK   K+ +T   + + I    +   ++
Sbjct: 1   MRIMGLDYGSKTVGVAISDALCLTAQGIETIQRKEENKLRKTLARIETLIKEYEVDKIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P +MN   G R   + AF  +M++R+  +  + WDERLTTV A++ LI+ NV R++R 
Sbjct: 61  GFPKHMNNDIGDRAEKSLAF-KDMLERRTGLEVIMWDERLTTVEAERTLIESNVRREERK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + VD IAA  ILQ  LD +
Sbjct: 120 KYVDKIAAIFILQGYLDSV 138


>gi|304396757|ref|ZP_07378637.1| Holliday junction resolvase YqgF [Pantoea sp. aB]
 gi|304355553|gb|EFM19920.1| Holliday junction resolvase YqgF [Pantoea sp. aB]
          Length = 139

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/135 (29%), Positives = 61/135 (45%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           Q +   D GTK IG+A+       A P   L  +      L +   +        ++GLP
Sbjct: 4   QTLLGFDFGTKSIGVAVGQQLTGSARPLTALKAQDGIPDWLVIEKLLKEWQPDFVVVGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+G+E P     R F +  +  +  +     DERL+TV A+  L +    R      V
Sbjct: 64  LNMDGTEQPLTDRARKFAN-RLHGRFGIRVELQDERLSTVEARAGLFERGGYRALNKGSV 122

Query: 137 DSIAAALILQEVLDR 151
           DS +AA+ILQ+  + 
Sbjct: 123 DSQSAAIILQDWFEN 137


>gi|261377526|ref|ZP_05982099.1| putative Holliday junction resolvase [Neisseria cinerea ATCC 14685]
 gi|269146263|gb|EEZ72681.1| putative Holliday junction resolvase [Neisseria cinerea ATCC 14685]
          Length = 151

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P     + D G  RIG+A  D     +HP   +      +    +   +       F++G
Sbjct: 5   PQGTALAFDFGEARIGVAQGDTELGLSHPLSTVTGSSNDEKFAAIAKLVQEWQPRYFVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+E    H +R F    +  +  +P  + DERL++V A+ +L +  V  KKR  
Sbjct: 65  LPVHTDGTEHEMTHLSRKFGR-RLHGRFGLPVYWVDERLSSVYAEGLLSEAQVFGKKRKS 123

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA  ILQ   +
Sbjct: 124 VLDQVAAQAILQSFFE 139


>gi|227432459|ref|ZP_03914446.1| crossover junction endodeoxyribonuclease [Leuconostoc mesenteroides
           subsp. cremoris ATCC 19254]
 gi|227351780|gb|EEJ42019.1| crossover junction endodeoxyribonuclease [Leuconostoc mesenteroides
           subsp. cremoris ATCC 19254]
          Length = 143

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 53/142 (37%), Positives = 77/142 (54%), Gaps = 4/142 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G++ +G++ISDP    A     +             L   I  +N    ++G
Sbjct: 1   MRILGLDVGSRTVGVSISDPMGWTAQGVEIIRINEDDKEFGIDRLGEIIKEKNATGVVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN SEGPR  ++R +   +I+    +P  F DERLTTV A+++LI+  N+SRKKR 
Sbjct: 61  LPKNMNNSEGPRAEASRNYAK-LIEETFGLPTDFQDERLTTVEAERMLIEEANISRKKRK 119

Query: 134 QKVDSIAAALILQEVLDRISFL 155
           + +D IAA  ILQ  LD    L
Sbjct: 120 KVIDKIAAEFILQNYLDSKGKL 141


>gi|54293569|ref|YP_125984.1| hypothetical protein lpl0621 [Legionella pneumophila str. Lens]
 gi|62900943|sp|Q5WYW4|RUVX_LEGPL RecName: Full=Putative Holliday junction resolvase
 gi|53753401|emb|CAH14854.1| hypothetical protein lpl0621 [Legionella pneumophila str. Lens]
          Length = 139

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/137 (29%), Positives = 63/137 (45%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P       D G KRIG+A+       A P   +  K        +   IT  N  A I+G
Sbjct: 2   PRGVYLGFDFGYKRIGVAVGQRLTCSASPLSTIEAKAGIPDWNTIQKVITQWNPQALIVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP  ++  E     + R F    + ++  +P    DERL+TV A+  L +    R+ +  
Sbjct: 62  LPTCIDDRELYTTSAARRFAK-QLHKQFSLPVHLVDERLSTVEARGYLFEQGGYRQIKKA 120

Query: 135 KVDSIAAALILQEVLDR 151
           +VDSIAA +IL++ L +
Sbjct: 121 EVDSIAACVILEQWLQQ 137


>gi|227499548|ref|ZP_03929655.1| crossover junction endodeoxyribonuclease [Anaerococcus tetradius
           ATCC 35098]
 gi|227218307|gb|EEI83561.1| crossover junction endodeoxyribonuclease [Anaerococcus tetradius
           ATCC 35098]
          Length = 139

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 50/137 (36%), Positives = 78/137 (56%), Gaps = 1/137 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I  +D+G K IG+A+SDP    A+    + RK  +     L   I   ++   ++GL
Sbjct: 1   MSRIMGLDVGNKTIGVALSDPMFLLANGLETIKRKNASSDIERLREIINDNDVELIVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + GP+     +FV  +I ++V +  V+ DER+TT+ ++ +LIDM+V R+ R + 
Sbjct: 61  PKNMNNTIGPQAMRVMSFVD-LIKKQVDIEIVYQDERMTTIQSEAVLIDMDVRRENRKKY 119

Query: 136 VDSIAAALILQEVLDRI 152
           +D IAA  ILQ  LDR 
Sbjct: 120 IDKIAATFILQTYLDRR 136


>gi|227357858|ref|ZP_03842206.1| Holliday junction resolvase [Proteus mirabilis ATCC 29906]
 gi|227161968|gb|EEI46986.1| Holliday junction resolvase [Proteus mirabilis ATCC 29906]
          Length = 139

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/137 (27%), Positives = 59/137 (43%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            N+ +   D GTK IG+AI       A P      K       ++   I        ++G
Sbjct: 2   SNRTVMGFDFGTKSIGVAIGQEVTGTARPLASFKAKDGIPDWSQIEKIIKEWQPDLVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPLNM+G+E       + F +  +  +  V     DERL+TV A+  L +    R     
Sbjct: 62  LPLNMDGTEQLVTTQAKKFAN-RLHGRFGVQIALHDERLSTVEARAHLFEQGGYRSLDKG 120

Query: 135 KVDSIAAALILQEVLDR 151
            VD+ +A +IL+   +R
Sbjct: 121 SVDATSAVIILESWFER 137


>gi|195978958|ref|YP_002124202.1| putative Holliday junction resolvase RvuC-like [Streptococcus equi
           subsp. zooepidemicus MGCS10565]
 gi|195975663|gb|ACG63189.1| putative Holliday junction resolvase RvuC-like [Streptococcus equi
           subsp. zooepidemicus MGCS10565]
          Length = 136

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 50/134 (37%), Positives = 77/134 (57%), Gaps = 4/134 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +     K       L   +    +  F+IGLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGFTAQGLEIIKINEDKQDFGFDRLAELVKQYQVDRFVIGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN + GPRV +++A+    I+   ++P  + DERLTTV A+++LI+  ++SR KR + +
Sbjct: 61  NMNNTSGPRVEASKAYGD-RIEELFHIPVSYQDERLTTVEAERMLIEQADISRGKRKKVI 119

Query: 137 DSIAAALILQEVLD 150
           D +AA LILQ  LD
Sbjct: 120 DKLAAQLILQNYLD 133


>gi|332878466|ref|ZP_08446187.1| RNAse H domain protein, YqgF family [Capnocytophaga sp. oral taxon
           329 str. F0087]
 gi|332683561|gb|EGJ56437.1| RNAse H domain protein, YqgF family [Capnocytophaga sp. oral taxon
           329 str. F0087]
          Length = 144

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/145 (26%), Positives = 72/145 (49%), Gaps = 5/145 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              + +ID G KR G+A++DP +  A+    +    V    +    ++  E++   ++GL
Sbjct: 1   MGRVLAIDYGKKRTGVAVTDPLQLIANGLTTVSTSSVMDFIVS---YVRQEHVERIVVGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P   NG +   +    +FV  + +R   +P  F+DER T+V A Q ++   + +K R   
Sbjct: 58  PKQANGEDSENMGRINSFVRCLHERLPEIPVEFFDERYTSVLAHQAMLQGGLRKKARQNK 117

Query: 134 QKVDSIAAALILQEVLDRISFLESS 158
             VD I+A +ILQ  ++    L+ +
Sbjct: 118 ALVDEISATIILQGWMESRMMLKKN 142


>gi|37520701|ref|NP_924078.1| Holliday junction resolvase-like protein [Gloeobacter violaceus PCC
           7421]
 gi|62901004|sp|Q7NLJ1|RUVX_GLOVI RecName: Full=Putative Holliday junction resolvase
 gi|35211696|dbj|BAC89073.1| gll1132 [Gloeobacter violaceus PCC 7421]
          Length = 156

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 50/132 (37%), Positives = 72/132 (54%), Gaps = 3/132 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  +D+G+KRIG+A  DP    A     +VR  +      +  +I      A +IGLP N
Sbjct: 6   VLGLDVGSKRIGVAGCDPTGLIASGLETIVRCNLGADLDAIRHWIERRRAQAVVIGLPRN 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNGS GP+ H  + F    + R + VP  + DERL+TV A + L   +VS  +R   +D 
Sbjct: 66  MNGSLGPQAHRIQHFGQ-QLARVIDVPIDYVDERLSTVQAGRAL--QSVSATRRKALIDQ 122

Query: 139 IAAALILQEVLD 150
            AAA+ILQ+ LD
Sbjct: 123 QAAAIILQQWLD 134


>gi|312864393|ref|ZP_07724626.1| RNAse H domain protein, YqgF family [Streptococcus downei F0415]
 gi|311100114|gb|EFQ58325.1| RNAse H domain protein, YqgF family [Streptococcus downei F0415]
          Length = 139

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 49/139 (35%), Positives = 78/139 (56%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK--KVTQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+AISDP    A     +     K       L   +    +  F++G
Sbjct: 1   MRLMGLDIGSKTVGVAISDPLGFTAQGLEIIPINEAKEDFGFQRLGELVKQYKVEKFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPRV +++A+    I     +P  + DERLTTV A+++L++  +VSR KR 
Sbjct: 61  LPKNMNNTSGPRVEASQAYGE-KIAELFDIPVDYQDERLTTVQAERMLVEQADVSRGKRK 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA LILQ  L+R+
Sbjct: 120 KVIDKLAAQLILQNYLERM 138


>gi|160915322|ref|ZP_02077535.1| hypothetical protein EUBDOL_01331 [Eubacterium dolichum DSM 3991]
 gi|158433121|gb|EDP11410.1| hypothetical protein EUBDOL_01331 [Eubacterium dolichum DSM 3991]
          Length = 137

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 49/139 (35%), Positives = 74/139 (53%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPF--LVRKKVTQTALELLSFITTENIAAFIIG 74
             +  +DLG++ +G+++SD     A P        +       ++ ++I    I   ++G
Sbjct: 1   MRVLGLDLGSRTLGVSVSDALGMIAQPVTTIRFEEEDYDSAFGQVQTYIKEYQIKTVVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP +MNG  G R   +  F   +    + V  V WDERLTTV+AQ+ILI  +VSRKKR +
Sbjct: 61  LPKHMNGDVGIRGDISIMFKERL--ETLGVTVVLWDERLTTVAAQRILIAADVSRKKRKK 118

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA  ILQ  LD  S
Sbjct: 119 VIDQMAAVQILQGYLDSQS 137


>gi|292900531|ref|YP_003539900.1| holliday junction resolvase [Erwinia amylovora ATCC 49946]
 gi|291200379|emb|CBJ47507.1| putative holliday junction resolvase [Erwinia amylovora ATCC 49946]
          Length = 140

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 42/137 (30%), Positives = 61/137 (44%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            NQ   + D GTK IG+AI       A P   L  +        L + +        ++G
Sbjct: 2   RNQTCLAFDFGTKSIGVAIGQQLTGTARPLIALKAQDGIPDWNRLEALLKEWQPDRVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPLNM+GSE P     R F +  +  +  V     DERL+TV A+  L +    R     
Sbjct: 62  LPLNMDGSEQPLTVRARKFAN-RLHGRFGVQVDLHDERLSTVEARAELFERGGFRALSKG 120

Query: 135 KVDSIAAALILQEVLDR 151
            VDS++A +IL+   + 
Sbjct: 121 NVDSLSAVIILESWFEN 137


>gi|111658812|ref|ZP_01409443.1| hypothetical protein SpneT_02000110 [Streptococcus pneumoniae
           TIGR4]
 gi|149017883|ref|ZP_01834342.1| hypothetical protein CGSSp23BS72_11110 [Streptococcus pneumoniae
           SP23-BS72]
 gi|183603171|ref|ZP_02710544.2| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1087-00]
 gi|183603568|ref|ZP_02718032.2| conserved hypothetical protein [Streptococcus pneumoniae
           CDC3059-06]
 gi|221231101|ref|YP_002510253.1| Holliday junction resolvase [Streptococcus pneumoniae ATCC 700669]
 gi|298230981|ref|ZP_06964662.1| Holliday junction resolvase-like protein [Streptococcus pneumoniae
           str. Canada MDR_19F]
 gi|298502010|ref|YP_003723950.1| crossover junction endodeoxyribonuclease [Streptococcus pneumoniae
           TCH8431/19A]
 gi|303265496|ref|ZP_07351396.1| hypothetical protein CGSSpBS457_01582 [Streptococcus pneumoniae
           BS457]
 gi|303267946|ref|ZP_07353748.1| hypothetical protein CGSSpBS458_10928 [Streptococcus pneumoniae
           BS458]
 gi|307126416|ref|YP_003878447.1| hypothetical protein SP670_0270 [Streptococcus pneumoniae 670-6B]
 gi|147931447|gb|EDK82425.1| hypothetical protein CGSSp23BS72_11110 [Streptococcus pneumoniae
           SP23-BS72]
 gi|183570834|gb|EDT91362.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC1087-00]
 gi|183576182|gb|EDT96710.1| conserved hypothetical protein [Streptococcus pneumoniae
           CDC3059-06]
 gi|220673561|emb|CAR68047.1| putative Holliday junction resolvase [Streptococcus pneumoniae ATCC
           700669]
 gi|298237605|gb|ADI68736.1| crossover junction endodeoxyribonuclease [Streptococcus pneumoniae
           TCH8431/19A]
 gi|301799346|emb|CBW31881.1| putative Holliday junction resolvase [Streptococcus pneumoniae
           OXC141]
 gi|301801141|emb|CBW33814.1| putative Holliday junction resolvase [Streptococcus pneumoniae
           INV200]
 gi|302642642|gb|EFL72987.1| hypothetical protein CGSSpBS458_10928 [Streptococcus pneumoniae
           BS458]
 gi|302644936|gb|EFL75183.1| hypothetical protein CGSSpBS457_01582 [Streptococcus pneumoniae
           BS457]
 gi|306483478|gb|ADM90347.1| conserved hypothetical protein [Streptococcus pneumoniae 670-6B]
 gi|327390615|gb|EGE88955.1| hypothetical protein SPAR5_0192 [Streptococcus pneumoniae GA04375]
 gi|332075862|gb|EGI86329.1| uncharacterized family protein [Streptococcus pneumoniae GA17570]
 gi|332076642|gb|EGI87104.1| hypothetical protein SPAR148_0175 [Streptococcus pneumoniae
           GA17545]
 gi|332077498|gb|EGI87959.1| hypothetical protein SPAR68_0240 [Streptococcus pneumoniae GA41301]
 gi|332202111|gb|EGJ16180.1| hypothetical protein SPAR69_0222 [Streptococcus pneumoniae GA41317]
 gi|332203361|gb|EGJ17428.1| hypothetical protein SPAR93_0231 [Streptococcus pneumoniae GA47368]
 gi|332204204|gb|EGJ18269.1| hypothetical protein SPAR120_0169 [Streptococcus pneumoniae
           GA47901]
          Length = 136

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 48/135 (35%), Positives = 79/135 (58%), Gaps = 4/135 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +   +         +   + T  +  F++GLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRVKELVDTYKVERFVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN + GPRV +++A+    ++    +P  + DERLTTV+A+++LI+  ++SR KR + +
Sbjct: 61  NMNNTSGPRVEASQAYGA-KLEEFFGLPVDYQDERLTTVAAERMLIEQADISRNKRKKVI 119

Query: 137 DSIAAALILQEVLDR 151
           D +AA LILQ  LDR
Sbjct: 120 DKLAAQLILQNYLDR 134


>gi|299144217|ref|ZP_07037297.1| putative Holliday junction resolvase [Peptoniphilus sp. oral taxon
           386 str. F0131]
 gi|298518702|gb|EFI42441.1| putative Holliday junction resolvase [Peptoniphilus sp. oral taxon
           386 str. F0131]
          Length = 140

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 52/136 (38%), Positives = 74/136 (54%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
            + I  +D+G K IG+A+SD     A P   + R+   Q   ++ + I   NIA  ++GL
Sbjct: 5   MEKILGLDIGDKWIGVAVSDLLGITAQPLVTIKRESNKQAYEDIYNLIKENNIAKVVVGL 64

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + GP+      F    +  K  V  ++ DER+TT+SA +ILI+  V R+ R Q 
Sbjct: 65  PKNMNNTLGPQSEKVLKFSE-KLKNKYGVEIIYIDERMTTISANRILIEGEVRRENRKQY 123

Query: 136 VDSIAAALILQEVLDR 151
           VD IAA  ILQ  LD 
Sbjct: 124 VDKIAATYILQTYLDS 139


>gi|323341498|ref|ZP_08081739.1| crossover junction endodeoxyribonuclease [Lactobacillus ruminis
           ATCC 25644]
 gi|323091109|gb|EFZ33740.1| crossover junction endodeoxyribonuclease [Lactobacillus ruminis
           ATCC 25644]
          Length = 148

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/138 (31%), Positives = 79/138 (57%), Gaps = 4/138 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFII 73
              +  +D+G++ +G+A+SD     A     +    ++       +   +   ++  F++
Sbjct: 1   MARLMGLDVGSRTVGIAVSDELGWTAQGVEIIKINEEEAIFGIERVKELVEKYDVCGFVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKR 132
           GLP NMN + GPR  +++A+   +I+    +P  F DERLTTV A+++L++  + SRKKR
Sbjct: 61  GLPKNMNNTLGPRAEASKAYGELLIE-TFGLPIDFQDERLTTVEAERMLVEQADASRKKR 119

Query: 133 IQKVDSIAAALILQEVLD 150
            + +D +AA+LILQ  LD
Sbjct: 120 KKVIDKLAASLILQNYLD 137


>gi|62900951|sp|Q5ZXZ3|RUVX_LEGPH RecName: Full=Putative Holliday junction resolvase
          Length = 139

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/137 (29%), Positives = 63/137 (45%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P       D G KRIG+A+       A P   +  K        +   IT  N  A I+G
Sbjct: 2   PRGVYLGFDFGYKRIGVAVGQRLTCSASPLSTIEAKAGIPDWNTIQKVITQWNPQALIVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP  ++  E     + R F    + ++  +P    DERL+TV A+  L +    R+ +  
Sbjct: 62  LPTCIDDRELYTTSAARRFAK-QLHKRFSLPVHLVDERLSTVEARGYLFEQGGYRQIKKA 120

Query: 135 KVDSIAAALILQEVLDR 151
           +VDSIAA +IL++ L +
Sbjct: 121 EVDSIAACVILEQWLQQ 137


>gi|154490275|ref|ZP_02030536.1| hypothetical protein PARMER_00507 [Parabacteroides merdae ATCC
           43184]
 gi|154089167|gb|EDN88211.1| hypothetical protein PARMER_00507 [Parabacteroides merdae ATCC
           43184]
          Length = 140

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/141 (29%), Positives = 73/141 (51%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR GLA++D  +  A+    +   ++T+   +   +++ E +  F++GL
Sbjct: 1   MGRIIAIDYGRKRTGLAVTDTLQMIANGLTTVPSGELTRFLAD---YVSREPVERFVVGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      +    AFV ++      +P  ++DER T+V A + ++D  + +KKR   
Sbjct: 58  PKQMNNELSENMRYVEAFVTHLKRTIPDIPVEYYDERFTSVLAHKAMLDGGLKKKKRQDK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   +
Sbjct: 118 GLVDEISAVIILQSYLENKKY 138


>gi|91205622|ref|YP_537977.1| Holliday junction resolvase-like protein [Rickettsia bellii
           RML369-C]
 gi|157827335|ref|YP_001496399.1| Holliday junction resolvase-like protein [Rickettsia bellii OSU
           85-389]
 gi|146325604|sp|Q1RIC6|RUVX_RICBR RecName: Full=Putative Holliday junction resolvase
 gi|167012755|sp|A8GU80|RUVX_RICB8 RecName: Full=Putative Holliday junction resolvase
 gi|91069166|gb|ABE04888.1| Putative endonuclease [Rickettsia bellii RML369-C]
 gi|157802639|gb|ABV79362.1| Holliday junction resolvase-like protein [Rickettsia bellii OSU
           85-389]
          Length = 154

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 50/155 (32%), Positives = 80/155 (51%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I  +++  + L PN P+ SID G+K+IG+AIS+  R  A P   +           LL
Sbjct: 1   MIINNLQEFYRLLLPNAPLISIDYGSKKIGIAISNQERNIAMPLNIITEASKKAIIASLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             I        +IGLP++M+G +  +      F    + + + +P    DERLTT +A  
Sbjct: 61  EKIEQYKACGIVIGLPIDMSGMQTEQSAIVIKFAE-ELTKSINLPIYLQDERLTTKAANN 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            L    + RK+R    D++AA++IL+ VL+ I+ L
Sbjct: 120 FLKSFGIKRKERNNNDDAVAASMILETVLNSINKL 154


>gi|16761872|ref|NP_457489.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29143359|ref|NP_806701.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|56415035|ref|YP_152110.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|62181607|ref|YP_218024.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|161616061|ref|YP_001590026.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|168234352|ref|ZP_02659410.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168236165|ref|ZP_02661223.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168242900|ref|ZP_02667832.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168264457|ref|ZP_02686430.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168463716|ref|ZP_02697633.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168819873|ref|ZP_02831873.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194450224|ref|YP_002047085.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194469087|ref|ZP_03075071.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194734127|ref|YP_002116045.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197247485|ref|YP_002148011.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197363964|ref|YP_002143601.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|213027960|ref|ZP_03342407.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Typhi str. 404ty]
 gi|213163042|ref|ZP_03348752.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213420491|ref|ZP_03353557.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
 gi|213424109|ref|ZP_03357002.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213580645|ref|ZP_03362471.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213648203|ref|ZP_03378256.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|213850163|ref|ZP_03381061.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|224584890|ref|YP_002638689.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|289804300|ref|ZP_06534929.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Typhi str. AG3]
 gi|289828650|ref|ZP_06546460.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|32130050|sp|Q8Z3V1|RUVX_SALTI RecName: Full=Putative Holliday junction resolvase
 gi|62900917|sp|Q5PJJ7|RUVX_SALPA RecName: Full=Putative Holliday junction resolvase
 gi|81309593|sp|Q57K19|RUVX_SALCH RecName: Full=Putative Holliday junction resolvase
 gi|189046105|sp|A9N4P3|RUVX_SALPB RecName: Full=Putative Holliday junction resolvase
 gi|226731647|sp|B5F5M2|RUVX_SALA4 RecName: Full=Putative Holliday junction resolvase
 gi|226731651|sp|B4THI2|RUVX_SALHS RecName: Full=Putative Holliday junction resolvase
 gi|226731653|sp|B5BFQ4|RUVX_SALPK RecName: Full=Putative Holliday junction resolvase
 gi|226731654|sp|B4TV66|RUVX_SALSV RecName: Full=Putative Holliday junction resolvase
 gi|254767524|sp|C0PY74|RUVX_SALPC RecName: Full=Putative Holliday junction resolvase
 gi|25306239|pir||AI0877 conserved hypothetical protein STY3250 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16504174|emb|CAD02921.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138993|gb|AAO70561.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56129292|gb|AAV78798.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62129240|gb|AAX66943.1| putative endonuclease involved in recombination [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|161365425|gb|ABX69193.1| hypothetical protein SPAB_03862 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194408528|gb|ACF68747.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194455451|gb|EDX44290.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194709629|gb|ACF88850.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195633281|gb|EDX51695.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197095441|emb|CAR61000.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197211188|gb|ACH48585.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197290851|gb|EDY30205.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|205331717|gb|EDZ18481.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205338254|gb|EDZ25018.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205343317|gb|EDZ30081.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205347041|gb|EDZ33672.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|224469418|gb|ACN47248.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|320087529|emb|CBY97294.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|322716090|gb|EFZ07661.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
          Length = 138

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/134 (31%), Positives = 62/134 (46%), Gaps = 1/134 (0%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPL 77
            + + D GTK IG+AI       A P P +  +  T     +   +        I+GLPL
Sbjct: 4   TLLAFDFGTKSIGVAIGQRITGTARPLPAIKAQDGTPDWTLIERLLKEWQPDEIIVGLPL 63

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     KVD
Sbjct: 64  NMDGTEQPLTARARKFAN-RIHGRFGVTVTLHDERLSTVEARSGLFERGGYRALNKGKVD 122

Query: 138 SIAAALILQEVLDR 151
           S +A +IL+   ++
Sbjct: 123 SASAVIILESYFEQ 136


>gi|198242309|ref|YP_002217072.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|205354020|ref|YP_002227821.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|207858358|ref|YP_002245009.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|226731648|sp|B5FUW0|RUVX_SALDC RecName: Full=Putative Holliday junction resolvase
 gi|226731649|sp|B5QY73|RUVX_SALEP RecName: Full=Putative Holliday junction resolvase
 gi|226731650|sp|B5RE57|RUVX_SALG2 RecName: Full=Putative Holliday junction resolvase
 gi|197936825|gb|ACH74158.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205273801|emb|CAR38796.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206710161|emb|CAR34517.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|326624844|gb|EGE31189.1| putative Holliday junction resolvase [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326629133|gb|EGE35476.1| Holliday junction resolvase-like protein [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 138

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/134 (31%), Positives = 63/134 (47%), Gaps = 1/134 (0%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPL 77
            + + D GTK IG+AI       A P P +  +  T   + +   +        I+GLPL
Sbjct: 4   TLLAFDFGTKSIGVAIGQRITGTARPLPAIKAQDGTPDWMLIERLLKEWQPDEIIVGLPL 63

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     KVD
Sbjct: 64  NMDGTEQPLTARARKFAN-RIHGRFGVTVTLHDERLSTVEARSGLFERGGYRALNKGKVD 122

Query: 138 SIAAALILQEVLDR 151
           S +A +IL+   ++
Sbjct: 123 SASAVIILESYFEQ 136


>gi|218282249|ref|ZP_03488548.1| hypothetical protein EUBIFOR_01130 [Eubacterium biforme DSM 3989]
 gi|218216787|gb|EEC90325.1| hypothetical protein EUBIFOR_01130 [Eubacterium biforme DSM 3989]
          Length = 141

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/140 (32%), Positives = 68/140 (48%), Gaps = 4/140 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRF--AHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
              I  +DLG+K  G++I D       A                E+L  +    +   ++
Sbjct: 1   MDRIIGLDLGSKTCGVSICDALHITCRALTTVRFESDDYDACLEEVLKLLQENKVKEVVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP +MNG  G R   +  F   +      +    WDERLTTV+A++IL+  +VSRKKR 
Sbjct: 61  GLPKHMNGDIGIRGEISCEFAKKL--ESSGIKVHLWDERLTTVAAEKILLQGDVSRKKRK 118

Query: 134 QKVDSIAAALILQEVLDRIS 153
           + +D +AA  ILQ  LDR +
Sbjct: 119 KVIDQMAAVQILQSFLDRQN 138


>gi|254383593|ref|ZP_04998943.1| conserved hypothetical protein [Streptomyces sp. Mg1]
 gi|194342488|gb|EDX23454.1| conserved hypothetical protein [Streptomyces sp. Mg1]
          Length = 158

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/136 (30%), Positives = 60/136 (44%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 +ID+G  RIG+A  DP    A P   +  + V      L   +        ++G
Sbjct: 6   RRGRRLAIDVGDARIGVASCDPDGVLATPVETVPGRDVPFAHRRLRQLVEEYEPLEVVVG 65

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP +++G EGP     RAF   +      V     DER+TTV+A Q L     + KK   
Sbjct: 66  LPRSLSGREGPAAVKVRAFAGELAKGIKPVTVRLVDERMTTVTAAQGLRASGKNAKKGRS 125

Query: 135 KVDSIAAALILQEVLD 150
            +D  AA +ILQ  L+
Sbjct: 126 VIDQAAAVVILQNALE 141


>gi|307609381|emb|CBW98869.1| hypothetical protein LPW_06571 [Legionella pneumophila 130b]
          Length = 142

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/137 (29%), Positives = 63/137 (45%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P       D G KRIG+A+       A P   +  K        +   IT  N  A I+G
Sbjct: 5   PRGVYLGFDFGYKRIGVAVGQRLTCSASPLSTIEAKAGIPDWNSIQKVITQWNPQALIVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP  ++  E     + R F    + ++  +P    DERL+TV A+  L +    R+ +  
Sbjct: 65  LPTCIDDRELYTTSAARRFAK-QLHKRFSLPVHLVDERLSTVEARGYLFEQGGYRQIKKA 123

Query: 135 KVDSIAAALILQEVLDR 151
           +VDSIAA +IL++ L +
Sbjct: 124 EVDSIAACVILEQWLQQ 140


>gi|269792642|ref|YP_003317546.1| Holliday junction resolvase YqgF [Thermanaerovibrio acidaminovorans
           DSM 6589]
 gi|269100277|gb|ACZ19264.1| Holliday junction resolvase YqgF [Thermanaerovibrio acidaminovorans
           DSM 6589]
          Length = 142

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 48/140 (34%), Positives = 76/140 (54%), Gaps = 2/140 (1%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
                + ++DLG  RIG+A+SDP R FA P   L  ++     L++   +   ++   ++
Sbjct: 3   SSMGRVMALDLGEVRIGVALSDPSRSFASPLEVLKMEEGWP--LKVKELVERNSVTLIVV 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP+  +GS GP V     ++  +      V  V  DER TT  AQ+ L++ +V R+KR 
Sbjct: 61  GLPIRTDGSSGPEVQRVMGWLEELKAVVQQVEIVTVDERFTTSIAQRFLLEGDVRREKRK 120

Query: 134 QKVDSIAAALILQEVLDRIS 153
            KVD +AAAL+LQ+ L+   
Sbjct: 121 GKVDKVAAALMLQDYLNSRR 140


>gi|307728796|ref|YP_003906020.1| Holliday junction resolvase YqgF [Burkholderia sp. CCGE1003]
 gi|307583331|gb|ADN56729.1| Holliday junction resolvase YqgF [Burkholderia sp. CCGE1003]
          Length = 146

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 67/139 (48%), Gaps = 5/139 (3%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
               + + D G KRIG+A+ +   + A P   +  +       E+   I      A ++G
Sbjct: 7   REATLLAFDYGEKRIGVAVGNSLTKSARPLVIVQNRSREYRFAEVGKLIAEWKPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+        R F +  ++ +  +P  + DER ++V A+  L       K R  
Sbjct: 67  LPMHPDGTPHEMTQLARRFGN-QLNGRFNLPVTWVDERYSSVEAEAGLRA----TKGRAD 121

Query: 135 KVDSIAAALILQEVLDRIS 153
           ++D+ AA++ILQ+ LD +S
Sbjct: 122 RLDAEAASIILQQYLDGLS 140


>gi|326693839|ref|ZP_08230844.1| putative Holliday junction resolvase [Leuconostoc argentinum KCTC
           3773]
          Length = 143

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 50/137 (36%), Positives = 75/137 (54%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G++ +G+A+SDP    A     +     +       L   I  + +   ++G
Sbjct: 1   MRILGLDVGSRTVGVAVSDPMGWTAQGVEIIRINEDEAEFGLERLGEIIKAKQVKGVVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN SEGPR  + R +   + +    +P  F DERLTTV A+++LI+  ++SRKKR 
Sbjct: 61  LPKNMNNSEGPRAEAARRYAKMV-EETFGLPTDFQDERLTTVQAERMLIEEADISRKKRK 119

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D IAA  ILQ  LD
Sbjct: 120 QVIDKIAAEFILQNYLD 136


>gi|269958631|ref|YP_003328418.1| putative Holliday junction resolvase [Anaplasma centrale str.
           Israel]
 gi|269848460|gb|ACZ49104.1| putative Holliday junction resolvase [Anaplasma centrale str.
           Israel]
          Length = 157

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 53/150 (35%), Positives = 78/150 (52%), Gaps = 1/150 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M    IE   + L  N+ I  +D G +++GLAISD     A P    +R+ + Q   EL 
Sbjct: 1   MLCESIEGFFEKLGANKKILGLDFGERKLGLAISDSTGTIAMPHSVYLRRNIRQDLGELN 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + +  E I A ++GLPL ++G EG      RAFV  +I +   +     DER TT  A +
Sbjct: 61  AILKREGIIAAVVGLPLQLDGLEGEMCAVVRAFVRKLIKK-SGIYVYLHDERYTTAMASR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLD 150
               + + RK+  +  D I+A LILQ+VLD
Sbjct: 120 ATESLGLRRKESQKVDDKISAVLILQQVLD 149


>gi|302533384|ref|ZP_07285726.1| Holliday junction resolvase YqgF [Streptomyces sp. C]
 gi|302442279|gb|EFL14095.1| Holliday junction resolvase YqgF [Streptomyces sp. C]
          Length = 158

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 61/136 (44%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 +ID+G  RIG+A  DP    A P   +  + +      L   +        ++G
Sbjct: 6   RRGRRLAIDVGDARIGVASCDPDGVLATPVETVPGRDIPFAHRRLRQLVEEYEPLEVVVG 65

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP +++G EGP     RAF + +      V     DER+TTV+A Q L     + KK   
Sbjct: 66  LPRSLSGREGPAAAKVRAFANELAKGIKPVTVRLVDERMTTVTAAQGLRASGRNAKKGRS 125

Query: 135 KVDSIAAALILQEVLD 150
            +D  AA +ILQ  L+
Sbjct: 126 VIDQAAAVVILQNALE 141


>gi|333029958|ref|ZP_08458019.1| Holliday junction resolvase [Bacteroides coprosuis DSM 18011]
 gi|332740555|gb|EGJ71037.1| Holliday junction resolvase [Bacteroides coprosuis DSM 18011]
          Length = 139

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/140 (27%), Positives = 67/140 (47%), Gaps = 5/140 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A++DP +  A+    +    +     +   +   E++   IIGL
Sbjct: 1   MGRILAIDYGRKRTGIAVTDPMQIIANGLTTVRTHDLMDFLTD---YTQKESVEKIIIGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  M+ +    +     FV N   +   +P  + DER T+V AQ+ +I+  + +K R   
Sbjct: 58  PKQMDNTPSESMKYIEPFVRNFQKKFPDMPLEYVDERFTSVIAQRTIIEAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRIS 153
             VD ++A +ILQ  L+   
Sbjct: 118 ALVDEVSATIILQTYLENKR 137


>gi|289550617|ref|YP_003471521.1| Putative Holliday junction resolvase [Staphylococcus lugdunensis
           HKU09-01]
 gi|315658112|ref|ZP_07910984.1| crossover junction endodeoxyribonuclease [Staphylococcus
           lugdunensis M23590]
 gi|289180149|gb|ADC87394.1| Putative Holliday junction resolvase [Staphylococcus lugdunensis
           HKU09-01]
 gi|315496441|gb|EFU84764.1| crossover junction endodeoxyribonuclease [Staphylococcus
           lugdunensis M23590]
          Length = 142

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/137 (33%), Positives = 78/137 (56%), Gaps = 2/137 (1%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIGL 75
            I  +D+G+K +G+AISD     A     L   +  +     +L + I + N+   +IGL
Sbjct: 5   KILGLDVGSKTVGIAISDLMGWTAQGLDTLRINEEQEEYGIEQLTNIIKSNNVDTIVIGL 64

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN S G R  ++  +   +++    +  + WDERL+T++A++ L++ +VSR+KR + 
Sbjct: 65  PKNMNNSIGFRGEASIHYKELILEAMPDMKVIMWDERLSTMAAERSLLEADVSRQKRKKV 124

Query: 136 VDSIAAALILQEVLDRI 152
           +D +AA  ILQ  LD I
Sbjct: 125 IDKMAAVFILQGYLDSI 141


>gi|295085224|emb|CBK66747.1| conserved hypothetical protein TIGR00250 [Bacteroides xylanisolvens
           XB1A]
          Length = 138

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/141 (29%), Positives = 68/141 (48%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++     E   ++  E +   IIGL
Sbjct: 1   MSRIVAIDYGRKRTGIAVSDTMQLIANGLTTVSTHELLNFIGE---YMAKEPVERIIIGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      + +   FV ++  R   +P  + DER T+V A + +++  + +K R   
Sbjct: 58  PKQMNNEVSENMKNIEPFVRSLKKRYPDLPVEYVDERFTSVLAHRTMLEAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   F
Sbjct: 118 ALVDEISATIILQTYLESKRF 138


>gi|325107974|ref|YP_004269042.1| Holliday junction resolvase [Planctomyces brasiliensis DSM 5305]
 gi|324968242|gb|ADY59020.1| Holliday junction resolvase [Planctomyces brasiliensis DSM 5305]
          Length = 155

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/137 (31%), Positives = 70/137 (51%), Gaps = 1/137 (0%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
                +  ID GTKR+GLAIS P +  A P   + R +  Q + ++        +   ++
Sbjct: 6   PETGTLLGIDFGTKRVGLAISTPDQSIASPLEIIHRSQPAQDSKKICKICNEFRVKGLVV 65

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP++M+GSEG +    R F          +P ++WDER T+  A   L    +S+ KR 
Sbjct: 66  GLPVHMSGSEGGKAKEARVFGDWC-GEITQLPVIYWDERFTSALADNHLRQSTMSQAKRK 124

Query: 134 QKVDSIAAALILQEVLD 150
           + +D +AA ++LQ  L+
Sbjct: 125 KHLDKLAAQVMLQSFLE 141


>gi|322388593|ref|ZP_08062193.1| crossover junction endodeoxyribonuclease [Streptococcus infantis
           ATCC 700779]
 gi|321140513|gb|EFX36018.1| crossover junction endodeoxyribonuclease [Streptococcus infantis
           ATCC 700779]
          Length = 136

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 49/135 (36%), Positives = 79/135 (58%), Gaps = 4/135 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +   +         L   + T  +  F++GLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGFTAQGLEIIQINEDQGEFGFERLKELVDTYKVERFVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN + GPRV +++A+    ++    +P  + DERLTTV+A+++LI+  ++SR KR + +
Sbjct: 61  NMNNTSGPRVEASQAYGA-KLEELFGLPVEYQDERLTTVAAERMLIEQADISRNKRKKVI 119

Query: 137 DSIAAALILQEVLDR 151
           D +AA LILQ  LDR
Sbjct: 120 DKLAAQLILQNYLDR 134


>gi|293374256|ref|ZP_06620584.1| RNAse YqgF [Turicibacter sanguinis PC909]
 gi|325844837|ref|ZP_08168289.1| RNAse H domain protein, YqgF family [Turicibacter sp. HGF1]
 gi|292647089|gb|EFF65071.1| RNAse YqgF [Turicibacter sanguinis PC909]
 gi|325489024|gb|EGC91412.1| RNAse H domain protein, YqgF family [Turicibacter sp. HGF1]
          Length = 143

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 50/137 (36%), Positives = 73/137 (53%), Gaps = 3/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV--TQTALELLSFITTENIAAFIIG 74
             I  +DLGT+  G+AISD     AH       ++    +    +   + T  I+  ++G
Sbjct: 1   MKILGLDLGTRTCGIAISDALGMMAHGVETFRFEENHYKKAIQHVQELVKTHKISKIVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP NMNGS G R   T+ F    ++    V  + WDERLTT+  +++LI  +VSR KR +
Sbjct: 61  LPKNMNGSIGERGQVTQEFAK-KLEEATNVTVILWDERLTTMQVERVLIQADVSRNKRKK 119

Query: 135 KVDSIAAALILQEVLDR 151
            VD +AA +ILQ  LD 
Sbjct: 120 VVDKMAATIILQSYLDS 136


>gi|325568881|ref|ZP_08145174.1| crossover junction endodeoxyribonuclease [Enterococcus
           casseliflavus ATCC 12755]
 gi|325157919|gb|EGC70075.1| crossover junction endodeoxyribonuclease [Enterococcus
           casseliflavus ATCC 12755]
          Length = 143

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/137 (33%), Positives = 78/137 (56%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             I  +D+G++ +G+A+SDP    A     +   +         L   +    ++ F++G
Sbjct: 1   MRIMGLDVGSRTVGVAVSDPMGWTAQGIEIIRINEDEGNFGYDRLAELVKEYEVSRFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPR  ++ A+    I+++  +P V+ DERLTTV A+++L++  N SR KR 
Sbjct: 61  LPKNMNNTIGPRAEASMAYGA-AIEQQFGLPVVYQDERLTTVQAERMLVEQANTSRAKRK 119

Query: 134 QKVDSIAAALILQEVLD 150
           + +D +AA +ILQ  LD
Sbjct: 120 KVIDKLAAVMILQNYLD 136


>gi|319935504|ref|ZP_08009939.1| Holliday junction resolvase [Coprobacillus sp. 29_1]
 gi|319809535|gb|EFW05952.1| Holliday junction resolvase [Coprobacillus sp. 29_1]
          Length = 140

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 48/140 (34%), Positives = 70/140 (50%), Gaps = 3/140 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFII 73
            + I  +DLG++  G+AISDP    A        K       A  + + +   NI   ++
Sbjct: 1   MEKILGLDLGSRTCGIAISDPLGIIAQGVETYRFKDNHYKSAAYHIKTIVQENNIHTIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP +MNG  G R   +  F    +++ + V  +  DERLTTV  +  LI  +VSRKKR 
Sbjct: 61  GLPKHMNGDLGERAQISIDF-KERLEKMMDVEVILVDERLTTVMMENQLIFADVSRKKRK 119

Query: 134 QKVDSIAAALILQEVLDRIS 153
           + +D +AA  ILQ  LD   
Sbjct: 120 EVIDKLAAVQILQGYLDSQR 139


>gi|225028523|ref|ZP_03717715.1| hypothetical protein EUBHAL_02802 [Eubacterium hallii DSM 3353]
 gi|224954166|gb|EEG35375.1| hypothetical protein EUBHAL_02802 [Eubacterium hallii DSM 3353]
          Length = 145

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 48/138 (34%), Positives = 77/138 (55%), Gaps = 4/138 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFI 72
            +    +D GTK +G+A+SD     A     + RK   K+ QT   + + I    ++  +
Sbjct: 2   KERWMGLDYGTKTVGVAVSDALGITAQGVETVTRKSNKKLRQTLARIEALIEEYEVSKIV 61

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLP NMN + G R   T+ F   M+ R+  +  V WDERLTT+ +++IL +  V R+ R
Sbjct: 62  LGLPKNMNNTLGERAEETKEF-QAMLQRRTGLEVVLWDERLTTMESERILQEGGVRRENR 120

Query: 133 IQKVDSIAAALILQEVLD 150
            +++D +AA LILQ  +D
Sbjct: 121 KERIDWMAATLILQSYMD 138


>gi|239637577|ref|ZP_04678549.1| conserved hypothetical protein [Staphylococcus warneri L37603]
 gi|239596795|gb|EEQ79320.1| conserved hypothetical protein [Staphylococcus warneri L37603]
          Length = 142

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/140 (32%), Positives = 74/140 (52%), Gaps = 2/140 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFII 73
              I  +D+G+K +G+AISD     A     L            +L+  I    +   +I
Sbjct: 3   KHKILGLDVGSKTVGIAISDLMGWTAQGLDTLRIDENNNELGIEQLVEIIKQHGVGTVVI 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NMN S G R  ++  +   + +    +  + WDERL+T++A++ L++ +VSR+KR 
Sbjct: 63  GLPKNMNNSIGFRGEASLQYKEKLQEALPSIEIIMWDERLSTMAAEKSLLEADVSRQKRK 122

Query: 134 QKVDSIAAALILQEVLDRIS 153
           + +D +AA  ILQ  LD IS
Sbjct: 123 KVIDKMAAVFILQGYLDSIS 142


>gi|52840824|ref|YP_094623.1| Holliday junction resolvase-like protein [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|296106167|ref|YP_003617867.1| putative ribonuclease [Legionella pneumophila 2300/99 Alcoy]
 gi|52627935|gb|AAU26676.1| YqgF [Legionella pneumophila subsp. pneumophila str. Philadelphia
           1]
 gi|295648068|gb|ADG23915.1| putative ribonuclease [Legionella pneumophila 2300/99 Alcoy]
          Length = 142

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/137 (29%), Positives = 63/137 (45%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P       D G KRIG+A+       A P   +  K        +   IT  N  A I+G
Sbjct: 5   PRGVYLGFDFGYKRIGVAVGQRLTCSASPLSTIEAKAGIPDWNTIQKVITQWNPQALIVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP  ++  E     + R F    + ++  +P    DERL+TV A+  L +    R+ +  
Sbjct: 65  LPTCIDDRELYTTSAARRFAK-QLHKRFSLPVHLVDERLSTVEARGYLFEQGGYRQIKKA 123

Query: 135 KVDSIAAALILQEVLDR 151
           +VDSIAA +IL++ L +
Sbjct: 124 EVDSIAACVILEQWLQQ 140


>gi|21283295|ref|NP_646383.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus MW2]
 gi|49483861|ref|YP_041085.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus MRSA252]
 gi|49486449|ref|YP_043670.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus MSSA476]
 gi|57650498|ref|YP_186511.1| hypothetical protein SACOL1671 [Staphylococcus aureus subsp. aureus
           COL]
 gi|87160105|ref|YP_494268.1| hypothetical protein SAUSA300_1573 [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88195425|ref|YP_500229.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus NCTC 8325]
 gi|148268097|ref|YP_001247040.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus JH9]
 gi|150394165|ref|YP_001316840.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus JH1]
 gi|151221729|ref|YP_001332551.1| hypothetical protein NWMN_1517 [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|161509843|ref|YP_001575502.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus USA300_TCH1516]
 gi|221141114|ref|ZP_03565607.1| hypothetical protein SauraJ_05678 [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|253316599|ref|ZP_04839812.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus str. CF-Marseille]
 gi|253732271|ref|ZP_04866436.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus USA300_TCH959]
 gi|253733133|ref|ZP_04867298.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus TCH130]
 gi|255006401|ref|ZP_05145002.2| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus Mu50-omega]
 gi|257425741|ref|ZP_05602165.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus 55/2053]
 gi|257428401|ref|ZP_05604799.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257431039|ref|ZP_05607418.1| Holliday junction resolvase [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257433725|ref|ZP_05610083.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257436640|ref|ZP_05612684.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|257793691|ref|ZP_05642670.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|258411010|ref|ZP_05681290.1| Holliday junction resolvase [Staphylococcus aureus A9763]
 gi|258420188|ref|ZP_05683143.1| Holliday junction resolvase [Staphylococcus aureus A9719]
 gi|258424042|ref|ZP_05686924.1| conserved hypothetical protein [Staphylococcus aureus A9635]
 gi|258438190|ref|ZP_05689474.1| Holliday junction resolvase YqgF [Staphylococcus aureus A9299]
 gi|258443653|ref|ZP_05691992.1| Holliday junction resolvase YqgF [Staphylococcus aureus A8115]
 gi|258446860|ref|ZP_05695014.1| conserved hypothetical protein [Staphylococcus aureus A6300]
 gi|258448774|ref|ZP_05696886.1| Holliday junction resolvase YqgF [Staphylococcus aureus A6224]
 gi|258450557|ref|ZP_05698619.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|258453593|ref|ZP_05701571.1| Holliday junction resolvase YqgF [Staphylococcus aureus A5937]
 gi|269203242|ref|YP_003282511.1| hypothetical protein SAAV_1608 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282893119|ref|ZP_06301353.1| conserved hypothetical protein [Staphylococcus aureus A8117]
 gi|282904197|ref|ZP_06312085.1| putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus C160]
 gi|282906023|ref|ZP_06313878.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282908935|ref|ZP_06316753.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282911253|ref|ZP_06319055.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282914421|ref|ZP_06322207.1| putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus M899]
 gi|282916885|ref|ZP_06324643.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           D139]
 gi|282919391|ref|ZP_06327126.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C427]
 gi|282920163|ref|ZP_06327888.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|282924716|ref|ZP_06332384.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C101]
 gi|282928250|ref|ZP_06335855.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|283958377|ref|ZP_06375828.1| putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|284024673|ref|ZP_06379071.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus 132]
 gi|293503496|ref|ZP_06667343.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510513|ref|ZP_06669219.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M809]
 gi|293531053|ref|ZP_06671735.1| putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus M1015]
 gi|294848645|ref|ZP_06789391.1| hypothetical protein SKAG_00712 [Staphylococcus aureus A9754]
 gi|295406738|ref|ZP_06816543.1| hypothetical protein SMAG_01910 [Staphylococcus aureus A8819]
 gi|295428193|ref|ZP_06820825.1| hypothetical protein SIAG_00722 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|296276723|ref|ZP_06859230.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           subsp. aureus MR1]
 gi|297207664|ref|ZP_06924099.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|297245680|ref|ZP_06929545.1| hypothetical protein SLAG_01773 [Staphylococcus aureus A8796]
 gi|297590840|ref|ZP_06949478.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus MN8]
 gi|300911746|ref|ZP_07129189.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|304380787|ref|ZP_07363454.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus ATCC BAA-39]
 gi|54039586|sp|P67490|RUVX_STAAN RecName: Full=Putative Holliday junction resolvase
 gi|54039587|sp|P67491|RUVX_STAAW RecName: Full=Putative Holliday junction resolvase
 gi|54042291|sp|P67489|RUVX_STAAM RecName: Full=Putative Holliday junction resolvase
 gi|62900903|sp|Q5HFE6|RUVX_STAAC RecName: Full=Putative Holliday junction resolvase
 gi|62900976|sp|Q6G8V3|RUVX_STAAS RecName: Full=Putative Holliday junction resolvase
 gi|62900977|sp|Q6GG87|RUVX_STAAR RecName: Full=Putative Holliday junction resolvase
 gi|146325609|sp|Q2FGB0|RUVX_STAA3 RecName: Full=Putative Holliday junction resolvase
 gi|146325610|sp|Q2FXW1|RUVX_STAA8 RecName: Full=Putative Holliday junction resolvase
 gi|172048919|sp|A6QHF7|RUVX_STAAE RecName: Full=Putative Holliday junction resolvase
 gi|189046106|sp|A6U285|RUVX_STAA2 RecName: Full=Putative Holliday junction resolvase
 gi|189046107|sp|A5ITE1|RUVX_STAA9 RecName: Full=Putative Holliday junction resolvase
 gi|189046108|sp|A8Z4F4|RUVX_STAAT RecName: Full=Putative Holliday junction resolvase
 gi|21204735|dbj|BAB95431.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49241990|emb|CAG40687.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49244892|emb|CAG43353.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57284684|gb|AAW36778.1| conserved hypothetical protein TIGR00250 [Staphylococcus aureus
           subsp. aureus COL]
 gi|87126079|gb|ABD20593.1| conserved hypothetical protein TIGR00250 [Staphylococcus aureus
           subsp. aureus USA300_FPR3757]
 gi|87202983|gb|ABD30793.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|147741166|gb|ABQ49464.1| Holliday junction resolvase YqgF [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149946617|gb|ABR52553.1| Holliday junction resolvase YqgF [Staphylococcus aureus subsp.
           aureus JH1]
 gi|150374529|dbj|BAF67789.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|160368652|gb|ABX29623.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus USA300_TCH1516]
 gi|253724060|gb|EES92789.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus USA300_TCH959]
 gi|253728889|gb|EES97618.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus TCH130]
 gi|257271435|gb|EEV03581.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus 55/2053]
 gi|257275242|gb|EEV06729.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257278242|gb|EEV08884.1| Holliday junction resolvase [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257281818|gb|EEV11955.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257283991|gb|EEV14114.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|257787663|gb|EEV26003.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|257840160|gb|EEV64624.1| Holliday junction resolvase [Staphylococcus aureus A9763]
 gi|257843899|gb|EEV68293.1| Holliday junction resolvase [Staphylococcus aureus A9719]
 gi|257845663|gb|EEV69695.1| conserved hypothetical protein [Staphylococcus aureus A9635]
 gi|257848234|gb|EEV72225.1| Holliday junction resolvase YqgF [Staphylococcus aureus A9299]
 gi|257851059|gb|EEV75002.1| Holliday junction resolvase YqgF [Staphylococcus aureus A8115]
 gi|257854435|gb|EEV77384.1| conserved hypothetical protein [Staphylococcus aureus A6300]
 gi|257858052|gb|EEV80941.1| Holliday junction resolvase YqgF [Staphylococcus aureus A6224]
 gi|257861715|gb|EEV84514.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|257864324|gb|EEV87074.1| Holliday junction resolvase YqgF [Staphylococcus aureus A5937]
 gi|262075532|gb|ACY11505.1| hypothetical protein SAAV_1608 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269941102|emb|CBI49488.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282313551|gb|EFB43946.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C101]
 gi|282317201|gb|EFB47575.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           C427]
 gi|282319372|gb|EFB49724.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           D139]
 gi|282321602|gb|EFB51927.1| putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus M899]
 gi|282324948|gb|EFB55258.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282327199|gb|EFB57494.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282331315|gb|EFB60829.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282590057|gb|EFB95139.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|282594511|gb|EFB99496.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|282595815|gb|EFC00779.1| putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus C160]
 gi|282764437|gb|EFC04563.1| conserved hypothetical protein [Staphylococcus aureus A8117]
 gi|283470893|emb|CAQ50104.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ST398]
 gi|283790526|gb|EFC29343.1| putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|290920321|gb|EFD97387.1| putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus M1015]
 gi|291095162|gb|EFE25427.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466877|gb|EFF09397.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M809]
 gi|294824671|gb|EFG41094.1| hypothetical protein SKAG_00712 [Staphylococcus aureus A9754]
 gi|294968485|gb|EFG44509.1| hypothetical protein SMAG_01910 [Staphylococcus aureus A8819]
 gi|295128551|gb|EFG58185.1| hypothetical protein SIAG_00722 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|296887681|gb|EFH26579.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|297177331|gb|EFH36583.1| hypothetical protein SLAG_01773 [Staphylococcus aureus A8796]
 gi|297575726|gb|EFH94442.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus MN8]
 gi|298694896|gb|ADI98118.1| probable Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus ED133]
 gi|300885992|gb|EFK81194.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|302333290|gb|ADL23483.1| Holliday junction resolvase [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|302751445|gb|ADL65622.1| Holliday junction resolvase [Staphylococcus aureus subsp. aureus
           str. JKD6008]
 gi|304340663|gb|EFM06596.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus ATCC BAA-39]
 gi|312437916|gb|ADQ76987.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus TCH60]
 gi|312830003|emb|CBX34845.1| uncharacterised protein family (UPF0081) family protein
           [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315129897|gb|EFT85887.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus CGS03]
 gi|315195516|gb|EFU25903.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus CGS00]
 gi|315198687|gb|EFU29015.1| crossover junction endodeoxyribonuclease [Staphylococcus aureus
           subsp. aureus CGS01]
 gi|320140497|gb|EFW32351.1| conserved hypothetical protein TIGR00250 [Staphylococcus aureus
           subsp. aureus MRSA131]
 gi|320144036|gb|EFW35805.1| conserved hypothetical protein TIGR00250 [Staphylococcus aureus
           subsp. aureus MRSA177]
 gi|323439037|gb|EGA96769.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           O11]
 gi|323442820|gb|EGB00445.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           O46]
 gi|329314291|gb|AEB88704.1| Putative Holliday junction resolvase [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329727568|gb|EGG64024.1| RNAse H domain protein, YqgF family [Staphylococcus aureus subsp.
           aureus 21172]
 gi|329728326|gb|EGG64763.1| RNAse H domain protein, YqgF family [Staphylococcus aureus subsp.
           aureus 21189]
 gi|329733081|gb|EGG69418.1| RNAse H domain protein, YqgF family [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 142

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/137 (33%), Positives = 76/137 (55%), Gaps = 2/137 (1%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIGL 75
            I  +D+G++ +G+AISD     A     L    +       +L+  I   N+   +IGL
Sbjct: 5   KILGLDVGSRTVGIAISDIMGWTAQGLDTLRINEENNELGIDQLVDIIKKHNVGTVVIGL 64

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN S G R  ++  +   +++    +  V WDERL+T++A++ L++ +VSR+KR Q 
Sbjct: 65  PKNMNNSIGFRGEASLTYKEKLLEAYPSIEIVMWDERLSTMAAERSLLEADVSRQKRKQV 124

Query: 136 VDSIAAALILQEVLDRI 152
           +D +AA  ILQ  LD +
Sbjct: 125 IDKMAAVFILQGYLDSL 141


>gi|283770690|ref|ZP_06343582.1| Holliday junction resolvase [Staphylococcus aureus subsp. aureus
           H19]
 gi|283460837|gb|EFC07927.1| Holliday junction resolvase [Staphylococcus aureus subsp. aureus
           H19]
          Length = 142

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/137 (33%), Positives = 77/137 (56%), Gaps = 2/137 (1%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIGL 75
            I  +D+G++ +G+AISD     A     L    +       +L+  I   N++  +IGL
Sbjct: 5   KILGLDVGSRTVGIAISDIMGWTAQGLDTLRINEENNELGIDQLVDIIKKHNVSTVVIGL 64

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN S G R  ++  +   +++    +  V WDERL+T++A++ L++ +VSR+KR Q 
Sbjct: 65  PKNMNNSIGFRGEASLTYKEKLLEAYPSIEIVMWDERLSTMAAERSLLEADVSRQKRKQV 124

Query: 136 VDSIAAALILQEVLDRI 152
           +D +AA  ILQ  LD +
Sbjct: 125 IDKMAAVFILQGYLDSL 141


>gi|307711065|ref|ZP_07647487.1| conserved hypothetical protein [Streptococcus mitis SK321]
 gi|307617027|gb|EFN96205.1| conserved hypothetical protein [Streptococcus mitis SK321]
          Length = 136

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 48/135 (35%), Positives = 79/135 (58%), Gaps = 4/135 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +   +         +   + T  +  F++GLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRVKELVDTYKVERFVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN + GPRV +++A+    ++    +P  + DERLTTV+A+++LI+  ++SR KR + +
Sbjct: 61  NMNNTSGPRVEASQAYGA-KLEELFDLPVDYQDERLTTVAAERMLIEQADISRNKRKKVI 119

Query: 137 DSIAAALILQEVLDR 151
           D +AA LILQ  LDR
Sbjct: 120 DKLAAQLILQNYLDR 134


>gi|300173637|ref|YP_003772803.1| putative Holliday junction resolvase [Leuconostoc gasicomitatum LMG
           18811]
 gi|299888016|emb|CBL91984.1| Putative Holliday junction resolvase [Leuconostoc gasicomitatum LMG
           18811]
          Length = 143

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 76/137 (55%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G++ +G+++SDP    A     +     +       L   I  +   + ++G
Sbjct: 1   MRILGLDVGSRTVGVSVSDPMGWTAQGVEIIRINEDENEFGLQRLGEIIKEKQAKSVVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN SEGPR  + R +   + +R   +P  F DERLTTV A+++LI+  +VSRKKR 
Sbjct: 61  LPKNMNNSEGPRAEAARNYAKMVEERF-ELPTDFQDERLTTVQAERMLIEEADVSRKKRK 119

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D IAA  ILQ  LD
Sbjct: 120 QVIDKIAAEFILQNYLD 136


>gi|229822860|ref|ZP_04448930.1| hypothetical protein GCWU000282_00149 [Catonella morbi ATCC 51271]
 gi|229787673|gb|EEP23787.1| hypothetical protein GCWU000282_00149 [Catonella morbi ATCC 51271]
          Length = 142

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 49/140 (35%), Positives = 77/140 (55%), Gaps = 3/140 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
           + I  +D+G+K +G+A+SD     A     +   +         LL  +    +   +IG
Sbjct: 3   KRIMGLDVGSKTVGVAVSDLMGWTAQGLETIRIDEAAGDLGYDRLLELVDQHQVKELVIG 62

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRI 133
           LP NMN S GPR  ++ A+   +   +  +   + DERLTT  A+++L+ + NVSRKKR 
Sbjct: 63  LPKNMNNSLGPRAEASMAYGEGISKLRPELTIHYQDERLTTSQAERMLVTEGNVSRKKRK 122

Query: 134 QKVDSIAAALILQEVLDRIS 153
           Q +D +AA +ILQ  LDRI+
Sbjct: 123 QVIDKLAAVIILQNYLDRIN 142


>gi|300718245|ref|YP_003743048.1| Holliday junction resolvase [Erwinia billingiae Eb661]
 gi|299064081|emb|CAX61201.1| Putative Holliday junction resolvase [Erwinia billingiae Eb661]
          Length = 140

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 63/137 (45%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            +  + + D GTK IG+AI       A P   L  +  T    ++ + +        ++G
Sbjct: 2   SHMTLLAFDFGTKSIGVAIGQQLTGTARPLAALKAQDGTPDWNKIEALLKEWEPDRVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R     
Sbjct: 62  LPLNMDGTEQPLTARARKFAN-RIHGRFGVQVDLHDERLSTVEARAELFERGGFRALSKG 120

Query: 135 KVDSIAAALILQEVLDR 151
            VDS++A +IL+   + 
Sbjct: 121 SVDSLSAVIILESWFEN 137


>gi|271502145|ref|YP_003335171.1| Holliday junction resolvase YqgF [Dickeya dadantii Ech586]
 gi|270345700|gb|ACZ78465.1| Holliday junction resolvase YqgF [Dickeya dadantii Ech586]
          Length = 143

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 62/136 (45%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           N+ + + D GT+ IG+AI       A P   L  +       ++   +     A  I+GL
Sbjct: 3   NRTLLAFDFGTRSIGVAIGQEITGTARPLTSLKAQDGIPDWQKVEKLLNEWQPALIIVGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F    +  +  V     DERL+TV A+  L +    R      
Sbjct: 63  PLNMDGTEQPLTARARKFSQ-RLQGRFGVTVELHDERLSTVEARADLFERGGFRALDKGS 121

Query: 136 VDSIAAALILQEVLDR 151
           VD+ +A +IL+   ++
Sbjct: 122 VDAASAVIILESWFEQ 137


>gi|307704051|ref|ZP_07640982.1| Holliday junction resolvase, putative [Streptococcus mitis SK597]
 gi|307709897|ref|ZP_07646344.1| Holliday junction resolvase, putative [Streptococcus mitis SK564]
 gi|307619268|gb|EFN98397.1| Holliday junction resolvase, putative [Streptococcus mitis SK564]
 gi|307622402|gb|EFO01408.1| Holliday junction resolvase, putative [Streptococcus mitis SK597]
          Length = 136

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 48/135 (35%), Positives = 79/135 (58%), Gaps = 4/135 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +   +         +   + T  +  F++GLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRVKELVDTYKVERFVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN + GPRV +++A+    ++    +P  + DERLTTV+A+++LI+  ++SR KR + +
Sbjct: 61  NMNNTSGPRVEASQAYGA-KLEELFGLPVDYQDERLTTVAAERMLIEQADISRNKRKKVI 119

Query: 137 DSIAAALILQEVLDR 151
           D +AA LILQ  LDR
Sbjct: 120 DKLAAQLILQNYLDR 134


>gi|255008472|ref|ZP_05280598.1| Holliday junction resolvase-like protein [Bacteroides fragilis
           3_1_12]
 gi|313146201|ref|ZP_07808394.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313134968|gb|EFR52328.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 138

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/140 (28%), Positives = 67/140 (47%), Gaps = 5/140 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++        +++  E +   IIGL
Sbjct: 1   MSRIIAIDYGRKRTGIAVSDAMQIIANGLTTVPSHELLDFIT---NYVKQEPVERIIIGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      + +   FV ++  R   +P  + DER T+V A + +I+  + +K R   
Sbjct: 58  PKQMNNEVSENMKNIEPFVRSLRKRLPDIPVEYVDERFTSVLAHRTMIEAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRIS 153
             VD I+A +ILQ  L+   
Sbjct: 118 ALVDEISATIILQSYLESKR 137


>gi|253996010|ref|YP_003048074.1| Holliday junction resolvase-like protein [Methylotenera mobilis
           JLW8]
 gi|253982689|gb|ACT47547.1| Holliday junction resolvase YqgF [Methylotenera mobilis JLW8]
          Length = 156

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 71/154 (46%), Gaps = 2/154 (1%)

Query: 1   MSILLIEDLVK-SLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALEL 59
           M ++  E +   +   +  + + D G +RIG+A+ +     A+P   +  +        +
Sbjct: 1   MQLIDNEKVYNQAHVQSGTVLAFDFGERRIGIAVGEHLLASANPLMTIDNESNEIRFQII 60

Query: 60  LSFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQ 119
              ++       ++GLPL+++GSE       + F    ++ +  +P    DER ++  A 
Sbjct: 61  TKLVSEWQPRLLVVGLPLSLDGSEHGVTQLCKKFAR-RLNGRFNLPVALIDERYSSAEAS 119

Query: 120 QILIDMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
           Q+L +  +  + + + +D +AA  ILQ   D+ S
Sbjct: 120 QLLNEAGIRGRAQKEMLDQVAAQTILQSYFDQAS 153


>gi|262198569|ref|YP_003269778.1| Holliday junction resolvase YqgF [Haliangium ochraceum DSM 14365]
 gi|262081916|gb|ACY17885.1| Holliday junction resolvase YqgF [Haliangium ochraceum DSM 14365]
          Length = 139

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 42/136 (30%), Positives = 67/136 (49%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
                 +D+G K IG+A SD     AHP   + R+        + + ++       ++GL
Sbjct: 1   MTRALGLDVGMKTIGVAGSDELGLAAHPVETIARRGTGPDVARVCALVSEREATDVVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYV-PFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           PL ++G EG R    R  +  +            WDER +T + +++LI+ ++SR+KR Q
Sbjct: 61  PLELSGQEGRRARRVRVLIDALRAALPDEVAVHTWDERFSTAAVERVLIEADMSRRKRKQ 120

Query: 135 KVDSIAAALILQEVLD 150
            +D  AAA ILQ  LD
Sbjct: 121 VIDKQAAAYILQGWLD 136


>gi|77461533|ref|YP_351040.1| Holliday junction resolvase-like protein [Pseudomonas fluorescens
           Pf0-1]
 gi|126352256|sp|Q3K5A5|RUVX_PSEPF RecName: Full=Putative Holliday junction resolvase
 gi|77385536|gb|ABA77049.1| putative holliday junction resolvase [Pseudomonas fluorescens
           Pf0-1]
          Length = 145

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/138 (31%), Positives = 64/138 (46%), Gaps = 2/138 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I   D GTK+IG+A+       A     L  +       ++ + I      A ++GLPLN
Sbjct: 6   ILGFDYGTKQIGVAVGQVITGQARELCTLKAQNGVPDWNQVEALIKEWKPDAVVVGLPLN 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQ-QILIDMNVSRKKRIQKVD 137
           M+G+          F    ++ +  +PF   DERLTT  A+ + L+        R   VD
Sbjct: 66  MDGTPSEMCARAEKFAR-RLNGRFNLPFYTHDERLTTFEAKGERLVRGGQKGSYRDNPVD 124

Query: 138 SIAAALILQEVLDRISFL 155
           +IAAAL+LQ  LD  + L
Sbjct: 125 AIAAALLLQGWLDENTAL 142


>gi|225873782|ref|YP_002755241.1| conserved hypothetical protein TIGR00250 [Acidobacterium capsulatum
           ATCC 51196]
 gi|225794196|gb|ACO34286.1| conserved hypothetical protein TIGR00250 [Acidobacterium capsulatum
           ATCC 51196]
          Length = 146

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/130 (30%), Positives = 60/130 (46%), Gaps = 1/130 (0%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            ++D+G +R+G+A+SD     A P   LVR    Q    L   +        ++G PL M
Sbjct: 1   MALDVGDRRVGVAVSDELGLTAQPVLTLVRTNRKQDMKSLGRLLRRFGCTEVVVGNPLYM 60

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +G   P+    +AF   + +    +P   WDERLTT  A + L        +  + VD +
Sbjct: 61  SGDISPQALKAQAFAAWVREEF-GLPVHLWDERLTTTEAHRHLHAAGRPGSEHREVVDQV 119

Query: 140 AAALILQEVL 149
           AA LIL   L
Sbjct: 120 AAVLILDGFL 129


>gi|108799314|ref|YP_639511.1| Holliday junction resolvase-like protein [Mycobacterium sp. MCS]
 gi|119868430|ref|YP_938382.1| Holliday junction resolvase-like protein [Mycobacterium sp. KMS]
 gi|122977019|sp|Q1B9H9|RUVX_MYCSS RecName: Full=Putative Holliday junction resolvase
 gi|167012737|sp|A1UFI4|RUVX_MYCSK RecName: Full=Putative Holliday junction resolvase
 gi|108769733|gb|ABG08455.1| Holliday junction resolvase YqgF [Mycobacterium sp. MCS]
 gi|119694519|gb|ABL91592.1| Holliday junction resolvase YqgF [Mycobacterium sp. KMS]
          Length = 169

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 45/141 (31%), Positives = 63/141 (44%), Gaps = 1/141 (0%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV-TQTALELLSFITTENIAAFI 72
                   ID+G+ R+G+A SDP    A P   + R+K   +    L   +T       +
Sbjct: 17  PGRGRRIGIDVGSVRVGVATSDPDGVLATPVETVRREKSSDRHVRRLAQLVTELEAVEVV 76

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLP  +    GP  H        +  R   VP    DERLTTVSAQ+ L +  V  K +
Sbjct: 77  VGLPRTLADRTGPAAHDAIDVAEALARRIAPVPVRMADERLTTVSAQRSLREAGVRAKGQ 136

Query: 133 IQKVDSIAAALILQEVLDRIS 153
              +D +AA  ILQ  LD+  
Sbjct: 137 RAMIDQVAAVGILQSWLDQRR 157


>gi|206577149|ref|YP_002236600.1| conserved hypothetical protein TIGR00250 [Klebsiella pneumoniae
           342]
 gi|226730741|sp|B5XUA1|RUVX_KLEP3 RecName: Full=Putative Holliday junction resolvase
 gi|206566207|gb|ACI07983.1| conserved hypothetical protein TIGR00250 [Klebsiella pneumoniae
           342]
          Length = 138

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 42/136 (30%), Positives = 61/136 (44%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +      D GTK IG+A+       A P P L  +        +   +      A I+GL
Sbjct: 2   SGTFLGFDFGTKSIGVAVGQRITATARPLPALKAQDGKPDWNVIEKLLKEWQPEAVIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V  V  DERL+TV A+  L +    R      
Sbjct: 62  PLNMDGTEQPLTARARNFAN-KIHGRFGVAIVLHDERLSTVEARAGLFEHGGYRALNKGS 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVVILESYFEQ 136


>gi|67923975|ref|ZP_00517429.1| Conserved hypothetical protein 250 [Crocosphaera watsonii WH 8501]
 gi|67854195|gb|EAM49500.1| Conserved hypothetical protein 250 [Crocosphaera watsonii WH 8501]
          Length = 143

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/140 (30%), Positives = 68/140 (48%), Gaps = 3/140 (2%)

Query: 16  NQPI--ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
            + I    +D+G KRIG+A  D     A     + RK   Q   +L + +T  N+   ++
Sbjct: 1   MERISALGLDVGKKRIGVAGCDGTGLIATGLTTIERKSFPQDVQQLQALVTERNVQLLVV 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP  M+GS G +    + F    I + + +P  + DERLT+V A+  L       +   
Sbjct: 61  GLPYCMDGSIGFQAKQVQKFAK-RISKALELPVEYMDERLTSVEAETHLKAQKKYSRHNK 119

Query: 134 QKVDSIAAALILQEVLDRIS 153
             VD +AA +ILQ+ LD+  
Sbjct: 120 GLVDRLAATIILQQWLDQRR 139


>gi|70726304|ref|YP_253218.1| Holliday junction resolvase-like protein [Staphylococcus
           haemolyticus JCSC1435]
 gi|146291068|sp|Q4L6W3|RUVX_STAHJ RecName: Full=Putative Holliday junction resolvase
 gi|68447028|dbj|BAE04612.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 142

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 46/137 (33%), Positives = 77/137 (56%), Gaps = 2/137 (1%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV--TQTALELLSFITTENIAAFIIGL 75
            I  +D+G+K +G+AISD     A     L   +        +L++ I   N+ + +IGL
Sbjct: 5   KILGLDVGSKTVGVAISDLMGWTAQGLDTLRINEELEDYGIEQLVTIIKENNVGSVVIGL 64

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN S G R  ++  +   + +    +  + WDERL+T++A++ L++ +VSR+KR + 
Sbjct: 65  PKNMNNSIGFRGEASLRYKELLKESLPDIEIIMWDERLSTMAAERSLLEADVSRQKRKKV 124

Query: 136 VDSIAAALILQEVLDRI 152
           +D +AA  ILQ  LD I
Sbjct: 125 IDKMAAVFILQGYLDSI 141


>gi|123443623|ref|YP_001007595.1| Holliday junction resolvase-like protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|332162807|ref|YP_004299384.1| Holliday junction resolvase-like protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|167016517|sp|A1JPT6|RUVX_YERE8 RecName: Full=Putative Holliday junction resolvase
 gi|122090584|emb|CAL13453.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318604352|emb|CBY25850.1| putative Holliday junction resolvase [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|325667037|gb|ADZ43681.1| Holliday junction resolvase-like protein [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330858997|emb|CBX69355.1| putative Holliday junction resolvase [Yersinia enterocolitica
           W22703]
          Length = 140

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 60/136 (44%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           N+ I + D GTK IG+AI       A        +  T    ++   +        ++GL
Sbjct: 3   NRTIVAFDFGTKSIGVAIGQEVTGTARALTSFKAQDGTPDWQKVEKLLKEWQPDLVVVGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  +  +  V     DERL+TV A+  L D    R      
Sbjct: 63  PLNMDGTEQPLTARARRFAN-RLHGRFGVQIALQDERLSTVEARANLFDSGGYRALDKGS 121

Query: 136 VDSIAAALILQEVLDR 151
           VD+ +A +IL+   D 
Sbjct: 122 VDAASAVIILESWFDE 137


>gi|188534953|ref|YP_001908750.1| Putative Holliday junction resolvase [Erwinia tasmaniensis Et1/99]
 gi|188029995|emb|CAO97879.1| Putative Holliday junction resolvase [Erwinia tasmaniensis Et1/99]
          Length = 140

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 41/137 (29%), Positives = 61/137 (44%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            +Q   S D GTK IG+AI       A P   L  +        + + +        ++G
Sbjct: 2   SSQTFLSFDFGTKSIGVAIGQRLTGTARPLNALKAQDGIPDWNRIEALLKEWQPERVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPLNM+GSE P     R F +  +  +  V     DERL+TV A+  L +    R     
Sbjct: 62  LPLNMDGSEQPLTARARKFAN-RLHGRFGVQVDLHDERLSTVEARAELFERGGFRALSKG 120

Query: 135 KVDSIAAALILQEVLDR 151
            VDS++A +IL+   + 
Sbjct: 121 NVDSLSAVIILESWFEN 137


>gi|22127199|ref|NP_670622.1| Holliday junction resolvase-like protein [Yersinia pestis KIM 10]
 gi|45443243|ref|NP_994782.1| Holliday junction resolvase-like protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|108806325|ref|YP_650241.1| Holliday junction resolvase-like protein [Yersinia pestis Antiqua]
 gi|108813294|ref|YP_649061.1| Holliday junction resolvase-like protein [Yersinia pestis Nepal516]
 gi|145597885|ref|YP_001161961.1| Holliday junction resolvase-like protein [Yersinia pestis Pestoides
           F]
 gi|149367054|ref|ZP_01889087.1| putative Holliday junction resolvase [Yersinia pestis CA88-4125]
 gi|153949472|ref|YP_001399818.1| Holliday junction resolvase-like protein [Yersinia
           pseudotuberculosis IP 31758]
 gi|162421693|ref|YP_001607683.1| Holliday junction resolvase-like protein [Yersinia pestis Angola]
 gi|165924969|ref|ZP_02220801.1| conserved hypothetical protein TIGR00250 [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165937369|ref|ZP_02225933.1| conserved hypothetical protein TIGR00250 [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166010339|ref|ZP_02231237.1| conserved hypothetical protein TIGR00250 [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166212701|ref|ZP_02238736.1| conserved hypothetical protein TIGR00250 [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167400030|ref|ZP_02305548.1| conserved hypothetical protein TIGR00250 [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167422013|ref|ZP_02313766.1| conserved hypothetical protein TIGR00250 [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167426704|ref|ZP_02318457.1| conserved hypothetical protein TIGR00250 [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167468156|ref|ZP_02332860.1| hypothetical protein YpesF_09714 [Yersinia pestis FV-1]
 gi|170023085|ref|YP_001719590.1| Holliday junction resolvase-like protein [Yersinia
           pseudotuberculosis YPIII]
 gi|218928109|ref|YP_002345984.1| Holliday junction resolvase-like protein [Yersinia pestis CO92]
 gi|229837629|ref|ZP_04457791.1| predicted Holliday junction resolvase [Yersinia pestis Pestoides A]
 gi|229840856|ref|ZP_04461015.1| predicted Holliday junction resolvase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229842584|ref|ZP_04462739.1| predicted Holliday junction resolvase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229903757|ref|ZP_04518870.1| predicted Holliday junction resolvase [Yersinia pestis Nepal516]
 gi|270487535|ref|ZP_06204609.1| RNAse H-fold protein YqgF [Yersinia pestis KIM D27]
 gi|294502900|ref|YP_003566962.1| Holliday junction resolvase-like protein [Yersinia pestis Z176003]
 gi|32130051|sp|Q8ZHG2|RUVX_YERPE RecName: Full=Putative Holliday junction resolvase
 gi|124107446|sp|Q1CB76|RUVX_YERPA RecName: Full=Putative Holliday junction resolvase
 gi|124107447|sp|Q1CEW9|RUVX_YERPN RecName: Full=Putative Holliday junction resolvase
 gi|167016518|sp|A7FEZ0|RUVX_YERP3 RecName: Full=Putative Holliday junction resolvase
 gi|167016519|sp|A4TI76|RUVX_YERPP RecName: Full=Putative Holliday junction resolvase
 gi|226695321|sp|A9R307|RUVX_YERPG RecName: Full=Putative Holliday junction resolvase
 gi|226695322|sp|B1JNP5|RUVX_YERPY RecName: Full=Putative Holliday junction resolvase
 gi|21960265|gb|AAM86873.1|AE013933_10 hypothetical protein y3323 [Yersinia pestis KIM 10]
 gi|45438111|gb|AAS63659.1| Predicted endonuclease involved in recombination (possible Holliday
           junction resolvase in Mycoplasmas and B. subtilis)
           [Yersinia pestis biovar Microtus str. 91001]
 gi|108776942|gb|ABG19461.1| hypothetical protein YPN_3134 [Yersinia pestis Nepal516]
 gi|108778238|gb|ABG12296.1| hypothetical protein YPA_0328 [Yersinia pestis Antiqua]
 gi|115346720|emb|CAL19603.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145209581|gb|ABP38988.1| hypothetical protein YPDSF_0578 [Yersinia pestis Pestoides F]
 gi|149290668|gb|EDM40744.1| putative Holliday junction resolvase [Yersinia pestis CA88-4125]
 gi|152960967|gb|ABS48428.1| conserved hypothetical protein TIGR00250 [Yersinia
           pseudotuberculosis IP 31758]
 gi|162354508|gb|ABX88456.1| conserved hypothetical protein TIGR00250 [Yersinia pestis Angola]
 gi|165914843|gb|EDR33456.1| conserved hypothetical protein TIGR00250 [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165923169|gb|EDR40320.1| conserved hypothetical protein TIGR00250 [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165990825|gb|EDR43126.1| conserved hypothetical protein TIGR00250 [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166205993|gb|EDR50473.1| conserved hypothetical protein TIGR00250 [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166960150|gb|EDR56171.1| conserved hypothetical protein TIGR00250 [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167050738|gb|EDR62146.1| conserved hypothetical protein TIGR00250 [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167054307|gb|EDR64126.1| conserved hypothetical protein TIGR00250 [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169749619|gb|ACA67137.1| Holliday junction resolvase YqgF [Yersinia pseudotuberculosis
           YPIII]
 gi|229679527|gb|EEO75630.1| predicted Holliday junction resolvase [Yersinia pestis Nepal516]
 gi|229690894|gb|EEO82948.1| predicted Holliday junction resolvase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229697222|gb|EEO87269.1| predicted Holliday junction resolvase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229704317|gb|EEO91328.1| predicted Holliday junction resolvase [Yersinia pestis Pestoides A]
 gi|262360935|gb|ACY57656.1| Holliday junction resolvase-like protein [Yersinia pestis D106004]
 gi|262364875|gb|ACY61432.1| Holliday junction resolvase-like protein [Yersinia pestis D182038]
 gi|270336039|gb|EFA46816.1| RNAse H-fold protein YqgF [Yersinia pestis KIM D27]
 gi|294353359|gb|ADE63700.1| Holliday junction resolvase-like protein [Yersinia pestis Z176003]
 gi|320013981|gb|ADV97552.1| putative Holliday junction resolvase [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 140

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 60/136 (44%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           N+ I + D GTK IG+AI       A        +  T    ++   +        ++GL
Sbjct: 3   NRTIIAFDFGTKSIGVAIGQEVTGTARALTAFKAQDGTPDWQQVEKLLKEWQPNLVVVGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  +  +  V     DERL+TV A+  L D    R      
Sbjct: 63  PLNMDGTEQPLTARARRFAN-RLHGRFGVQVALQDERLSTVEARANLFDRGGYRALDKGS 121

Query: 136 VDSIAAALILQEVLDR 151
           VD+ +A +IL+   D 
Sbjct: 122 VDAASAVIILESWFDE 137


>gi|116491182|ref|YP_810726.1| RNase H-like ribonuclease [Oenococcus oeni PSU-1]
 gi|118587361|ref|ZP_01544787.1| Hollyday junction resolvase [Oenococcus oeni ATCC BAA-1163]
 gi|290890698|ref|ZP_06553768.1| hypothetical protein AWRIB429_1158 [Oenococcus oeni AWRIB429]
 gi|122276636|sp|Q04ER1|RUVX_OENOB RecName: Full=Putative Holliday junction resolvase
 gi|116091907|gb|ABJ57061.1| RNase H-like ribonuclease [Oenococcus oeni PSU-1]
 gi|118432185|gb|EAV38925.1| Hollyday junction resolvase [Oenococcus oeni ATCC BAA-1163]
 gi|290479673|gb|EFD88327.1| hypothetical protein AWRIB429_1158 [Oenococcus oeni AWRIB429]
          Length = 144

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 50/145 (34%), Positives = 82/145 (56%), Gaps = 4/145 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+A SDP    A     +   +         L   I+ + ++  +IG
Sbjct: 1   MRLLGLDVGSKTVGVAQSDPLGWTASSIEIIRINEAQGEFGLDRLGQIISEKKVSGIVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN +EGPRV ++R +   + +R   +P  + DERLT+V A ++LI+  ++SR KR 
Sbjct: 61  LPKNMNNTEGPRVEASRNYGKMVSERF-GLPIDYQDERLTSVEANRMLIEEADLSRAKRK 119

Query: 134 QKVDSIAAALILQEVLDRISFLESS 158
           + +DS+AA LILQ  LD+   L + 
Sbjct: 120 KVIDSLAAQLILQNYLDKKGRLTNG 144


>gi|226328801|ref|ZP_03804319.1| hypothetical protein PROPEN_02701 [Proteus penneri ATCC 35198]
 gi|225201987|gb|EEG84341.1| hypothetical protein PROPEN_02701 [Proteus penneri ATCC 35198]
          Length = 139

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/137 (27%), Positives = 59/137 (43%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            N+ +   D GTK IG+AI       A P      K       ++   I        ++G
Sbjct: 2   SNKTVMGFDFGTKSIGVAIGQEITGTARPLASFKAKDGIPDWAQIEKIIKEWQPDLVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPLNM+G+E       + F +  +  +  V     DERL+TV A+  L +    R     
Sbjct: 62  LPLNMDGTEQLVTAQAKKFAN-RLHGRFGVQIALHDERLSTVEARAHLFERGGYRSLDKG 120

Query: 135 KVDSIAAALILQEVLDR 151
            VD+ +A +IL+   ++
Sbjct: 121 SVDAASAVIILESWFEQ 137


>gi|118470819|ref|YP_887343.1| Holliday junction resolvase-like protein [Mycobacterium smegmatis
           str. MC2 155]
 gi|226731631|sp|A0QWQ5|RUVX_MYCS2 RecName: Full=Putative Holliday junction resolvase
 gi|118172106|gb|ABK73002.1| conserved hypothetical protein [Mycobacterium smegmatis str. MC2
           155]
          Length = 170

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/141 (30%), Positives = 59/141 (41%), Gaps = 3/141 (2%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFL---VRKKVTQTALELLSFITTENIAA 70
                   ID+GT RIG+A SDP    A P   +    R K  +    L + +       
Sbjct: 16  PGRGRRIGIDVGTVRIGVASSDPDGILATPVETVARDKRDKTGKHVRRLAALVKEYEAVE 75

Query: 71  FIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRK 130
            I+GLP  +        H        +  R    P    DERLTTVSAQ+ L +  V  +
Sbjct: 76  VIVGLPRTLGDRASASAHDAVDVAEQLARRIAPTPVRLADERLTTVSAQRSLREAGVRAR 135

Query: 131 KRIQKVDSIAAALILQEVLDR 151
            +   +D +AA  ILQ  LD+
Sbjct: 136 GQKAVIDQVAAVGILQGWLDQ 156


>gi|53712972|ref|YP_098964.1| Holliday junction resolvase-like protein [Bacteroides fragilis
           YCH46]
 gi|60681184|ref|YP_211328.1| Holliday junction resolvase-like protein [Bacteroides fragilis NCTC
           9343]
 gi|253563050|ref|ZP_04840507.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|265763069|ref|ZP_06091637.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|62900958|sp|Q64VP6|RUVX_BACFR RecName: Full=Putative Holliday junction resolvase
 gi|81315746|sp|Q5LER0|RUVX_BACFN RecName: Full=Putative Holliday junction resolvase
 gi|52215837|dbj|BAD48430.1| putative endonuclease [Bacteroides fragilis YCH46]
 gi|60492618|emb|CAH07390.1| putative Holliday junction resolvase [Bacteroides fragilis NCTC
           9343]
 gi|251946826|gb|EES87108.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|263255677|gb|EEZ27023.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|301162673|emb|CBW22220.1| putative Holliday junction resolvase [Bacteroides fragilis 638R]
          Length = 138

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/137 (28%), Positives = 68/137 (49%), Gaps = 5/137 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SD  +  A+    +   ++        +++  E++   IIGL
Sbjct: 1   MSRIVAIDYGRKRTGIAVSDTMQIIANGLTTVPTHELLDFIT---NYVKQESVERIIIGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      + +   FV ++  R   +P  + DER T+V A + +++  + +K R   
Sbjct: 58  PKQMNNEVSENMKNIEPFVRSLKKRLPDMPVEYVDERFTSVLAHRTMLEAGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLD 150
             VD I+A +ILQ  L+
Sbjct: 118 ALVDEISATIILQSYLE 134


>gi|328954563|ref|YP_004371897.1| Holliday junction resolvase [Desulfobacca acetoxidans DSM 11109]
 gi|328454887|gb|AEB10716.1| Holliday junction resolvase [Desulfobacca acetoxidans DSM 11109]
          Length = 144

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 46/143 (32%), Positives = 75/143 (52%), Gaps = 1/143 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I  +DLG+KRIG+A+SD     A     + R    +    +L  +    +   +IGLP
Sbjct: 1   MRILGLDLGSKRIGIALSDALGWTAQGLTVIHRAGRARDLARVLELVKKYEVQEIVIGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            +++G  G       A     +   +++P   WDERLTT+ A+++L+  ++SR+KR Q +
Sbjct: 61  RHLDGRLGEGAEEALA-WAAELREHLHIPVHTWDERLTTLQAERVLLQADLSRRKRRQVI 119

Query: 137 DSIAAALILQEVLDRISFLESSK 159
           D +AA LILQ  LD     ++ K
Sbjct: 120 DKLAAGLILQAFLDNRRQTQAEK 142


>gi|152971900|ref|YP_001337009.1| Holliday junction resolvase-like protein [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238896479|ref|YP_002921217.1| Holliday junction resolvase-like protein [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262042599|ref|ZP_06015755.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|167012731|sp|A6TDV8|RUVX_KLEP7 RecName: Full=Putative Holliday junction resolvase
 gi|150956749|gb|ABR78779.1| Holliday junction resolvase-like protein [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238548799|dbj|BAH65150.1| Holliday junction resolvase-like protein [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|259040033|gb|EEW41148.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 138

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 61/136 (44%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +      D GTK IG+A+       A P P L  +        +   +      A I+GL
Sbjct: 2   SGTFLGFDFGTKSIGVAVGQRITATARPLPALKAQDGKPDWNVIEKLLKEWQPEAVIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V  +  DERL+TV A+  L +    R      
Sbjct: 62  PLNMDGTEQPLTARARNFAN-KIHGRFGVAILLHDERLSTVEARAGLFEHGGYRALNKGS 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVVILESYFEQ 136


>gi|226306473|ref|YP_002766433.1| Holliday junction resolvase [Rhodococcus erythropolis PR4]
 gi|229493502|ref|ZP_04387287.1| conserved hypothetical protein [Rhodococcus erythropolis SK121]
 gi|259495711|sp|C0ZZA9|RUVX_RHOE4 RecName: Full=Putative Holliday junction resolvase
 gi|226185590|dbj|BAH33694.1| putative Holliday junction resolvase [Rhodococcus erythropolis PR4]
 gi|229319463|gb|EEN85299.1| conserved hypothetical protein [Rhodococcus erythropolis SK121]
          Length = 177

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 42/144 (29%), Positives = 63/144 (43%), Gaps = 4/144 (2%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVT----QTALELLSFITTENIA 69
                  +ID+G+ RIG+A SDP    A P   + R K           +++ ++     
Sbjct: 16  PGRGRRIAIDVGSVRIGVASSDPDGILATPVETVPRSKERGPDAPDIRRIIAIVSEYEAV 75

Query: 70  AFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR 129
             I+GLP  + G +G       AF   +      +P    DERLTTV+A + L +  V  
Sbjct: 76  EVIVGLPQTLRGEQGKAAGIATAFAKRLQRAVEPIPVRLSDERLTTVTAARNLRESGVKA 135

Query: 130 KKRIQKVDSIAAALILQEVLDRIS 153
           + +   +D  AA  ILQ  LD  S
Sbjct: 136 RGQRPMIDQAAAVEILQGWLDERS 159


>gi|251788140|ref|YP_003002861.1| Holliday junction resolvase-like protein [Dickeya zeae Ech1591]
 gi|247536761|gb|ACT05382.1| Holliday junction resolvase YqgF [Dickeya zeae Ech1591]
          Length = 143

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 62/136 (45%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           N+ + + D GT+ IG+AI       A P   L  +       ++   +     A  I+GL
Sbjct: 3   NRTLLAFDFGTRSIGVAIGQEITGTARPLTSLKAQDGIPDWQKVEKLLNEWQPALVIVGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F    +  +  V     DERL+TV A+  L +    R      
Sbjct: 63  PLNMDGTEQPLTARARKFSQ-RLHGRFGVNVELHDERLSTVEARADLFERGGFRALDKGS 121

Query: 136 VDSIAAALILQEVLDR 151
           VD+ +A +IL+   ++
Sbjct: 122 VDAASAVIILESWFEQ 137


>gi|227552124|ref|ZP_03982173.1| crossover junction endodeoxyribonuclease [Enterococcus faecium
           TX1330]
 gi|257882634|ref|ZP_05662287.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|257886706|ref|ZP_05666359.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257894866|ref|ZP_05674519.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
 gi|257895281|ref|ZP_05674934.1| conserved hypothetical protein [Enterococcus faecium Com12]
 gi|257897895|ref|ZP_05677548.1| conserved hypothetical protein [Enterococcus faecium Com15]
 gi|293553141|ref|ZP_06673779.1| conserved hypothetical protein [Enterococcus faecium E1039]
 gi|293568771|ref|ZP_06680085.1| conserved hypothetical protein [Enterococcus faecium E1071]
 gi|293571039|ref|ZP_06682081.1| conserved hypothetical protein [Enterococcus faecium E980]
 gi|227178706|gb|EEI59678.1| crossover junction endodeoxyribonuclease [Enterococcus faecium
           TX1330]
 gi|257818292|gb|EEV45620.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|257822760|gb|EEV49692.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257831245|gb|EEV57852.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
 gi|257831846|gb|EEV58267.1| conserved hypothetical protein [Enterococcus faecium Com12]
 gi|257835807|gb|EEV60881.1| conserved hypothetical protein [Enterococcus faecium Com15]
 gi|291588488|gb|EFF20322.1| conserved hypothetical protein [Enterococcus faecium E1071]
 gi|291602732|gb|EFF32946.1| conserved hypothetical protein [Enterococcus faecium E1039]
 gi|291608879|gb|EFF38159.1| conserved hypothetical protein [Enterococcus faecium E980]
          Length = 143

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 45/137 (32%), Positives = 74/137 (54%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             +  +D+G+K +G+A+SDP    A     +   +  +      L   +    +  F++G
Sbjct: 1   MRVMGLDVGSKTVGVAVSDPFGWTAQGVEIIRINEAEEEFGFDRLKELVAQYEVDRFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN S GPR  ++ ++    I     +P  + DERLTTV A+++L++  N SR KR 
Sbjct: 61  LPKNMNNSIGPRAEASMSYGE-KIKELFSLPVDYQDERLTTVQAERMLVEQANTSRAKRK 119

Query: 134 QKVDSIAAALILQEVLD 150
           + +D +AA +ILQ  LD
Sbjct: 120 KVIDKLAAVMILQNYLD 136


>gi|85060002|ref|YP_455704.1| Holliday junction resolvase-like protein [Sodalis glossinidius str.
           'morsitans']
 gi|146325608|sp|Q2NRC6|RUVX_SODGM RecName: Full=Putative Holliday junction resolvase
 gi|84780522|dbj|BAE75299.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 141

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 42/142 (29%), Positives = 63/142 (44%), Gaps = 1/142 (0%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           +     I + D GT+ IG+AI       A P      +       ++   +        +
Sbjct: 1   MAAAGSIMAFDFGTRSIGVAIGQRVTCTARPLTAFKARDGVPDWQQIEKLLKEWRPETVV 60

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLPLNM+GSE P     R F + M  R   V  V  DERL+TV A+  L +    R   
Sbjct: 61  VGLPLNMDGSEQPLTARVRKFANRMHGR-FGVQVVLHDERLSTVEARAGLFERGGYRALE 119

Query: 133 IQKVDSIAAALILQEVLDRISF 154
             KVD+ +A +IL+  L++   
Sbjct: 120 KGKVDAGSAVIILESWLEQFPE 141


>gi|220929652|ref|YP_002506561.1| Holliday junction resolvase-like protein [Clostridium
           cellulolyticum H10]
 gi|254767508|sp|B8I4S7|RUVX_CLOCE RecName: Full=Putative Holliday junction resolvase
 gi|219999980|gb|ACL76581.1| Holliday junction resolvase YqgF [Clostridium cellulolyticum H10]
          Length = 142

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 74/138 (53%), Gaps = 2/138 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK-VTQTALELLSFITTENIAAFIIGL 75
             I  ID G  RIG+AISDP    A     +  K  + +  L L   I   ++   +IG 
Sbjct: 1   MRILGIDYGDSRIGVAISDPMGWTAQGLEMIKSKDSLKKAVLRLSEIINEYSVTDIVIGY 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P+NMNG++GPR   T  F+   I        + WDERLTTVSA + + ++ +   K+   
Sbjct: 61  PINMNGTKGPRTERTEEFIK-KISDLGQFNIIKWDERLTTVSAHRTMNELGIKASKKKGI 119

Query: 136 VDSIAAALILQEVLDRIS 153
           VD+++A LILQ  LDRI+
Sbjct: 120 VDTMSAVLILQGYLDRIA 137


>gi|288933582|ref|YP_003437641.1| Holliday junction resolvase YqgF [Klebsiella variicola At-22]
 gi|290511351|ref|ZP_06550720.1| conserved hypothetical protein [Klebsiella sp. 1_1_55]
 gi|288888311|gb|ADC56629.1| Holliday junction resolvase YqgF [Klebsiella variicola At-22]
 gi|289776344|gb|EFD84343.1| conserved hypothetical protein [Klebsiella sp. 1_1_55]
          Length = 139

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 42/136 (30%), Positives = 61/136 (44%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +      D GTK IG+A+       A P P L  +        +   +      A I+GL
Sbjct: 3   SGTFLGFDFGTKSIGVAVGQRITATARPLPALKAQDGKPDWNVIEKLLKEWQPEAVIVGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V  V  DERL+TV A+  L +    R      
Sbjct: 63  PLNMDGTEQPLTARARNFAN-KIHGRFGVAIVLHDERLSTVEARAGLFEHGGYRALNKGS 121

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 122 VDSASAVVILESYFEQ 137


>gi|284040266|ref|YP_003390196.1| Holliday junction resolvase YqgF [Spirosoma linguale DSM 74]
 gi|283819559|gb|ADB41397.1| Holliday junction resolvase YqgF [Spirosoma linguale DSM 74]
          Length = 142

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/140 (28%), Positives = 74/140 (52%), Gaps = 5/140 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              + +ID G KR G+A++DP +  A     +   +V +      +++  E + AF++GL
Sbjct: 1   MARLLAIDYGMKRTGIAVTDPLQLIASALETVPSHEVLKFL---KAYLVREPVEAFVVGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P  ++G +       R FV ++ +    +P  + DER T+V A Q +I    ++K R +K
Sbjct: 58  PKGLDGEDTDNTPRVRKFVTHLQNAFPDIPVYWHDERFTSVMALQAMIAGGSTKKDRREK 117

Query: 136 --VDSIAAALILQEVLDRIS 153
             +D ++AA+ILQ  ++R  
Sbjct: 118 GNIDKVSAAIILQSYMERNR 137


>gi|293378151|ref|ZP_06624320.1| RNAse YqgF [Enterococcus faecium PC4.1]
 gi|292643015|gb|EFF61156.1| RNAse YqgF [Enterococcus faecium PC4.1]
          Length = 143

 Score =  131 bits (329), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 45/137 (32%), Positives = 73/137 (53%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             +  +D+G+K +G+A+SDP    A     +   +  +      L   +    +  F++G
Sbjct: 1   MRVMGLDVGSKTVGVAVSDPFGWTAQGVEIIRINEAEEEFGFDRLKELVAQYEVDRFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN S GPR  ++  +    I     +P  + DERLTTV A+++L++  N SR KR 
Sbjct: 61  LPKNMNNSIGPRAEASMLYGE-KIKELFSLPVDYQDERLTTVQAERMLVEQANTSRAKRK 119

Query: 134 QKVDSIAAALILQEVLD 150
           + +D +AA +ILQ  LD
Sbjct: 120 KVIDKLAAVMILQNYLD 136


>gi|307132696|ref|YP_003884712.1| putative Holliday junction resolvase [Dickeya dadantii 3937]
 gi|306530225|gb|ADN00156.1| predicted Holliday junction resolvase [Dickeya dadantii 3937]
          Length = 143

 Score =  131 bits (329), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 62/136 (45%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           N+ + + D GT+ IG+AI       A P   L  +       ++   +     A  I+GL
Sbjct: 3   NRTLLAFDFGTRSIGVAIGQEITGTARPLTSLKAQDGVPDWQKVEKLLNEWQPALVIVGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F    +  +  V     DERL+TV A+  L +    R      
Sbjct: 63  PLNMDGTEQPLTARARKFSQ-RLHGRFGVKVDLHDERLSTVEARADLFERGGFRALDKGS 121

Query: 136 VDSIAAALILQEVLDR 151
           VD+ +A +IL+   ++
Sbjct: 122 VDAASAVIILESWFEQ 137


>gi|296104613|ref|YP_003614759.1| putative holliday junction resolvase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295059072|gb|ADF63810.1| putative holliday junction resolvase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295097488|emb|CBK86578.1| conserved hypothetical protein TIGR00250 [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 138

 Score =  131 bits (329), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 60/136 (44%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P   L     T     +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAVGQRITGTARPLTALKANDGTPDWNLIERLLKEWQPDDVIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R      
Sbjct: 62  PLNMDGTEQPLTARARKFAN-KIHGRFGVSVKLHDERLSTVEARAGLFEHGGFRALNKGS 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYFEQ 136


>gi|330718936|ref|ZP_08313536.1| Holliday junction resolvase-like protein [Leuconostoc fallax KCTC
           3537]
          Length = 143

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 49/138 (35%), Positives = 73/138 (52%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIG 74
             I  +D+G++ +G+A+SDP    A     +   +         L   I        ++G
Sbjct: 1   MRILGLDVGSRTVGVAVSDPMGWTAQGVEIIRIDEAAKEFGLERLGEIIQETKAKGVVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN +EGPR  + R +   + +    +   F DERLTTV A+++LI+  +VSRKKR 
Sbjct: 61  LPKNMNNTEGPRAQAARDYAKMV-EDNFGLSTDFQDERLTTVQAERMLIEEADVSRKKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D IAA  ILQ  LDR
Sbjct: 120 KVIDKIAAEFILQNYLDR 137


>gi|157964411|ref|YP_001499235.1| Holliday junction resolvase-like protein [Rickettsia massiliae
           MTU5]
 gi|157844187|gb|ABV84688.1| Putative endonuclease involved in recombination [Rickettsia
           massiliae MTU5]
          Length = 165

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 50/155 (32%), Positives = 81/155 (52%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I  +++  + L PN P+ +ID G+K++G+A+S+  R  A P   +           LL
Sbjct: 12  MIIKNLQEFYRLLIPNAPLIAIDYGSKKLGIALSNQERSIAMPLNTITEINTKIVITSLL 71

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + I    +   IIGLP+NM+G+   + +    F    + + + +P    DERLTT +A  
Sbjct: 72  NIIEKYKVCGVIIGLPINMSGAVTEQTNIVMQFAE-ELAKSINLPIYLQDERLTTKAANN 130

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            L    V RK R    D++AA++IL+ VLD I  +
Sbjct: 131 FLKSFGVKRKDRNNNDDAVAASMILETVLDSIKNI 165


>gi|159900150|ref|YP_001546397.1| Holliday junction resolvase YqgF [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159893189|gb|ABX06269.1| Holliday junction resolvase YqgF [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 158

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 46/140 (32%), Positives = 77/140 (55%), Gaps = 1/140 (0%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
             +  I ++D+G KRIG+A+ DP R  A  +P L  +   +   +LL  IT   +   +I
Sbjct: 5   PTHGRIIALDVGNKRIGVAMCDPDRIIASGQPTLPAQPTDKAYAQLLHMITEHEVVEVVI 64

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLPL + G  G +  + +AF    ++++  +P   +DER T+V A++ L  M + + K  
Sbjct: 65  GLPLTLRGEVGAQAKAVQAFSR-GLEKRTKIPITLYDERFTSVEAERSLEAMGIKKSKHR 123

Query: 134 QKVDSIAAALILQEVLDRIS 153
             VD +AA LILQ+ +  I+
Sbjct: 124 DHVDELAAILILQDYMSSIA 143


>gi|154500404|ref|ZP_02038442.1| hypothetical protein BACCAP_04071 [Bacteroides capillosus ATCC
           29799]
 gi|150270909|gb|EDM98192.1| hypothetical protein BACCAP_04071 [Bacteroides capillosus ATCC
           29799]
          Length = 139

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 65/137 (47%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I +ID G  R G+AISDP    A     +  +K    A E+   +    +   ++G P
Sbjct: 1   MRIMAIDYGDARTGIAISDPTGLLAGYTTVIHSRKSEVVAEEIARLVKEHGVEELVMGFP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NM+G+EGPR    RAF   +       P   WDER TTV A  IL       K+  + V
Sbjct: 61  RNMDGTEGPRAELYRAFAQQVGQVTGLTPV-LWDERRTTVEAHNILHASGKRMKQHKKTV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D++AA LIL+  L R  
Sbjct: 120 DAVAATLILEGYLTRRR 136


>gi|186477077|ref|YP_001858547.1| Holliday junction resolvase-like protein [Burkholderia phymatum
           STM815]
 gi|226725497|sp|B2JFD3|RUVX_BURP8 RecName: Full=Putative Holliday junction resolvase
 gi|184193536|gb|ACC71501.1| Holliday junction resolvase YqgF [Burkholderia phymatum STM815]
          Length = 151

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 66/139 (47%), Gaps = 5/139 (3%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
               + + D G KRIG+A+ +   R A P   L  +        +   I      A ++G
Sbjct: 7   REATLLAFDYGEKRIGVAVGNSLTRSARPLVVLQNRNREYRFEAVGKLIDEWKPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+   R    + F +  ++ +  +P  + DER ++V A+  +     S  ++  
Sbjct: 67  LPMHPDGTPHERTQLAKRFGN-QLNGRFNLPVTWIDERYSSVEAEAGIR----SGTRQAG 121

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D+ AA +ILQ+ LD +S
Sbjct: 122 MLDAEAACIILQQYLDGLS 140


>gi|260599276|ref|YP_003211847.1| Holliday junction resolvase-like protein [Cronobacter turicensis
           z3032]
 gi|260218453|emb|CBA33583.1| Putative Holliday junction resolvase [Cronobacter turicensis z3032]
          Length = 138

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 60/136 (44%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+AI       A P   +  +        +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAIGQRVTATARPLNAIKAQNGNPDWTIIERLLKEWQPDDVIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  +  +  +     DERL+TV A+  L +    R      
Sbjct: 62  PLNMDGTEQPLTSRARTFAN-RLHGRFGIKVTLHDERLSTVEARAGLFERGGFRALNKGS 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVVILESYFEQ 136


>gi|283781683|ref|YP_003372438.1| Holliday junction resolvase YqgF [Pirellula staleyi DSM 6068]
 gi|283440136|gb|ADB18578.1| Holliday junction resolvase YqgF [Pirellula staleyi DSM 6068]
          Length = 153

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 44/134 (32%), Positives = 70/134 (52%), Gaps = 1/134 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              +  +D GT RIGLAI+DP ++FA P     R+     A         E  AA+++GL
Sbjct: 7   RGRLIGVDYGTVRIGLAITDPEQKFASPLDNYTRRGGQADARYFQRVAQEERAAAWVVGL 66

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P++  GSE  +    R F    ++    +P   +DER T+  A+++LI   +SRK+R   
Sbjct: 67  PVHTTGSESQKSTEARQFAK-QLEELTKLPVFLFDERFTSADAEEMLIAAGMSRKERKSH 125

Query: 136 VDSIAAALILQEVL 149
           +D +AA ++L   L
Sbjct: 126 LDKLAAQILLSAFL 139


>gi|260438499|ref|ZP_05792315.1| putative holliday junction resolvase [Butyrivibrio crossotus DSM
           2876]
 gi|292809088|gb|EFF68293.1| putative holliday junction resolvase [Butyrivibrio crossotus DSM
           2876]
          Length = 144

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G++ +G+A+ DP    A     + RK   K+ QT   +       N    ++
Sbjct: 1   MRIIGLDFGSRTVGVAVCDPLMITAQGVEIIRRKEENKLRQTYARIEELCAEYNAERIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NMN + G RV  T  F    ++R+  +  V WDERLTTV+A   +++  + R+ R 
Sbjct: 61  GLPKNMNNTSGDRVDKTMDF-KAALERRTGLEVVMWDERLTTVAADNAMMEAGIRRENRK 119

Query: 134 QKVDSIAAALILQEVLDRIS 153
           + VD IAA LILQ  LD ++
Sbjct: 120 EYVDMIAAQLILQGYLDSLA 139


>gi|330446902|ref|ZP_08310553.1| uncharacterised family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491093|dbj|GAA05050.1| uncharacterised family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 142

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 33/140 (23%), Positives = 56/140 (40%), Gaps = 2/140 (1%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           +  ++ +   D GTK IG+AI       A P   +           +   +        +
Sbjct: 1   MSQSRTVLGFDYGTKSIGVAIGQELTGTATPLAAIKANDGVPNWDNIEKLLKEWQPNLVV 60

Query: 73  IGLPLNMNGSEGPR-VHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           +GLPL++ G E        + F + +  R         DERL+TV A+  L +    R  
Sbjct: 61  VGLPLDLEGKELETITPRAKKFANRVHGR-FGCQVELHDERLSTVEARAELFERGGYRSL 119

Query: 132 RIQKVDSIAAALILQEVLDR 151
               +DS +A +IL+   +R
Sbjct: 120 SKGNIDSQSAVVILESWFER 139


>gi|156932611|ref|YP_001436527.1| Holliday junction resolvase-like protein [Cronobacter sakazakii
           ATCC BAA-894]
 gi|167012722|sp|A7MJR8|RUVX_ENTS8 RecName: Full=Putative Holliday junction resolvase
 gi|156530865|gb|ABU75691.1| hypothetical protein ESA_00393 [Cronobacter sakazakii ATCC BAA-894]
          Length = 138

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 60/136 (44%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+AI       A P   +  +        +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAIGQRVTATARPLTAIKAQNGNPDWTLIEKLLKEWQPDDVIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  +  +  +     DERL+TV A+  L +    R      
Sbjct: 62  PLNMDGTEQPLTARARTFAN-RLHGRFGIKVTLHDERLSTVEARAGLFERGGFRALNKGS 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVVILESYFEQ 136


>gi|331701290|ref|YP_004398249.1| Holliday junction resolvase [Lactobacillus buchneri NRRL B-30929]
 gi|329128633|gb|AEB73186.1| Holliday junction resolvase [Lactobacillus buchneri NRRL B-30929]
          Length = 144

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 46/138 (33%), Positives = 74/138 (53%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+A+SD     +     +             +   +    +  F++G
Sbjct: 1   MRLMGLDVGSKTVGVAVSDQLGWTSQGVEIIRIDEDNKEFGLDRVSELVKKYQVDGFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL-IDMNVSRKKRI 133
           LP NMN S GPR  +++ +    ++ K  +P  F DERLTTV AQ++L  + +VSR KR 
Sbjct: 61  LPKNMNNSLGPRAEASQQYGK-RLEDKFNLPVDFEDERLTTVEAQRMLTEEADVSRAKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA LILQ  LDR
Sbjct: 120 KVIDKLAAGLILQNYLDR 137


>gi|118595162|ref|ZP_01552509.1| Holliday junction resolvase-like protein [Methylophilales bacterium
           HTCC2181]
 gi|118440940|gb|EAV47567.1| Holliday junction resolvase-like protein [Methylophilales bacterium
           HTCC2181]
          Length = 148

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 43/141 (30%), Positives = 72/141 (51%), Gaps = 1/141 (0%)

Query: 11  KSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAA 70
            +++PN  + + D G K+IG+AI +   + AHP   + + K ++    + + +       
Sbjct: 8   SNIRPNTNVIAFDFGEKKIGVAIGNSITKTAHPLETIRKVKKSERIEIIENLLNEWEPGI 67

Query: 71  FIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRK 130
            ++GLPLN +G+E       + F    I  +  VP V  DER T+V A+ +L +   S K
Sbjct: 68  VVVGLPLNEDGTESRLTLLAQNFAK-KIKNRFQVPIVMVDERYTSVEAKILLNENVKSIK 126

Query: 131 KRIQKVDSIAAALILQEVLDR 151
           K  Q +D +AA +IL    DR
Sbjct: 127 KGNQVIDQVAAQIILGSYFDR 147


>gi|54310237|ref|YP_131257.1| Holliday junction resolvase-like protein [Photobacterium profundum
           SS9]
 gi|62900980|sp|Q6LMM2|RUVX_PHOPR RecName: Full=Putative Holliday junction resolvase
 gi|46914678|emb|CAG21455.1| conserved hypothetical protein [Photobacterium profundum SS9]
          Length = 142

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 36/140 (25%), Positives = 60/140 (42%), Gaps = 2/140 (1%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           +  ++ + + D GTK IG+AI       A+P   L  K       ++   +        +
Sbjct: 1   MSNSRSVLAFDYGTKSIGVAIGQELTGTANPLAALKAKDGIPNWDDIGKILKEWQPDLVV 60

Query: 73  IGLPLNMNGSEGP-RVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           +GLPLN+ G E        + F +  I  +        DERL+TV A+  L +    R  
Sbjct: 61  VGLPLNLEGGELESITPRAKKFAN-RIHGRFGCVVELHDERLSTVEAKAELFEHGGYRAL 119

Query: 132 RIQKVDSIAAALILQEVLDR 151
               +DS +A +IL+   +R
Sbjct: 120 SKGNIDSQSAVVILESWFER 139


>gi|89074104|ref|ZP_01160603.1| Holliday junction resolvase-like protein [Photobacterium sp. SKA34]
 gi|89050040|gb|EAR55566.1| Holliday junction resolvase-like protein [Photobacterium sp. SKA34]
          Length = 143

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 34/140 (24%), Positives = 58/140 (41%), Gaps = 2/140 (1%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           +  ++ +   D GTK IG+AI       A P   L  K       ++   +        +
Sbjct: 1   MSQSRSVLGFDYGTKSIGVAIGQELTGIATPLAALKAKDGIPNWDDIEKILKEWLPDLVV 60

Query: 73  IGLPLNMNGSEGP-RVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           +GLPL++ G E        + F +  +  +        DERL+TV A+  L +    R  
Sbjct: 61  VGLPLDLKGKELESITPRAKKFAN-RLHGRFGCQVELHDERLSTVEAKAELFERGGYRSL 119

Query: 132 RIQKVDSIAAALILQEVLDR 151
               +DS +A +IL+   +R
Sbjct: 120 SKGNIDSQSAVVILESWFER 139


>gi|332686781|ref|YP_004456555.1| putative holliday junction resolvase [Melissococcus plutonius ATCC
           35311]
 gi|332370790|dbj|BAK21746.1| putative holliday junction resolvase [Melissococcus plutonius ATCC
           35311]
          Length = 140

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 49/141 (34%), Positives = 73/141 (51%), Gaps = 4/141 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+A+SD     A     +    +K       L        I  F+IGLP 
Sbjct: 1   MGLDVGSKTVGVAVSDLLGWTAQGIEIIRINEEKGQFGFDRLEELAEEYEITKFVIGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN S GPR  ++ AF    +     +P V+ DERLTTV A+++LI+  + SR KR + +
Sbjct: 61  NMNNSIGPRAEASLAFGE-KLQELFQLPVVYQDERLTTVQAERMLIEQADTSRAKRKKVI 119

Query: 137 DSIAAALILQEVLDRISFLES 157
           D +AA +ILQ  LD      +
Sbjct: 120 DKLAAVMILQNYLDSQKHRAN 140


>gi|219871133|ref|YP_002475508.1| Holliday junction resolvase-like protein [Haemophilus parasuis
           SH0165]
 gi|254767517|sp|B8F5F8|RUVX_HAEPS RecName: Full=Putative Holliday junction resolvase
 gi|219691337|gb|ACL32560.1| holliday junction resolvase-like protein/crossover junction
           endodeoxyribonuclease [Haemophilus parasuis SH0165]
          Length = 138

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 38/138 (27%), Positives = 64/138 (46%), Gaps = 1/138 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +Q + + D GT  IG A+       A   P    +       ++   I        ++GL
Sbjct: 2   SQTVLAFDFGTNSIGCAVGQSITGTAQGLPAFKAQDGIPNWEQIGKVIAQWQPDLLVVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     + F +  ++ +  +P    DERLTTV A+  +      +  +  K
Sbjct: 62  PLNMDGTEQPLTQRAKKFAN-RLNGRFNLPVELQDERLTTVEAKSEIFARGGFKALKKGK 120

Query: 136 VDSIAAALILQEVLDRIS 153
           VD+I+A LIL+   ++ S
Sbjct: 121 VDAISACLILESWFEQQS 138


>gi|170692129|ref|ZP_02883293.1| Holliday junction resolvase YqgF [Burkholderia graminis C4D1M]
 gi|170143413|gb|EDT11577.1| Holliday junction resolvase YqgF [Burkholderia graminis C4D1M]
          Length = 146

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 65/139 (46%), Gaps = 5/139 (3%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
               + + D G KRIG+A+ +   R A P   +  +       E+   I      A ++G
Sbjct: 7   REATLLAFDYGEKRIGVAVGNSLTRSARPLVIVQNRSREYRFAEVGKLIAEWKPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+        + F +  ++ +  +P  + DER ++V A+          K R  
Sbjct: 67  LPMHPDGTPHEMTQLAKRFGN-QLNGRFNLPVTWVDERYSSVEAEATTRAN----KGRAD 121

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D+ AA++ILQ+ LD +S
Sbjct: 122 MLDAEAASIILQQYLDGLS 140


>gi|51597519|ref|YP_071710.1| Holliday junction resolvase-like protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|186896642|ref|YP_001873754.1| Holliday junction resolvase-like protein [Yersinia
           pseudotuberculosis PB1/+]
 gi|62900961|sp|Q666N9|RUVX_YERPS RecName: Full=Putative Holliday junction resolvase
 gi|226695320|sp|B2K0T4|RUVX_YERPB RecName: Full=Putative Holliday junction resolvase
 gi|51590801|emb|CAH22447.1| Putative endonuclease involved in recombination [Yersinia
           pseudotuberculosis IP 32953]
 gi|186699668|gb|ACC90297.1| Holliday junction resolvase YqgF [Yersinia pseudotuberculosis
           PB1/+]
          Length = 140

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 60/136 (44%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           N+ I + D GTK IG+AI       A        +  T    ++   +        ++GL
Sbjct: 3   NRTIIAFDFGTKSIGVAIGQEVTGTARALTAFKAQDGTPDWQQVEKLLKEWQPNLVVVGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  +  +  V     DERL+TV A+  L D    R      
Sbjct: 63  PLNMDGTEQPLTARARRFAN-RLHGRFGVQIALQDERLSTVEARANLFDRGGYRALDKGS 121

Query: 136 VDSIAAALILQEVLDR 151
           VD+ +A +IL+   D 
Sbjct: 122 VDAASAVIILESWFDE 137


>gi|240949410|ref|ZP_04753751.1| Holliday junction resolvase-like protein [Actinobacillus minor
           NM305]
 gi|240296159|gb|EER46815.1| Holliday junction resolvase-like protein [Actinobacillus minor
           NM305]
          Length = 140

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 37/137 (27%), Positives = 62/137 (45%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + + + D GT  IG A+       A   P    +       ++   I        ++GLP
Sbjct: 3   KTVLAFDFGTYSIGCAVGQSITGTAQGLPAFKAQDGIPDWTQIEKVIQEWQPDVLVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+G+E P     + F +  ++ +  +P    DERLTTV A+  +      +  +  KV
Sbjct: 63  LNMDGTEQPLTQRAKKFAN-RLNGRFNLPVELQDERLTTVEAKAEIFSRGGYKALKKGKV 121

Query: 137 DSIAAALILQEVLDRIS 153
           D+I+A LIL+   +  S
Sbjct: 122 DAISACLILESWFENQS 138


>gi|69245163|ref|ZP_00603287.1| Conserved hypothetical protein 250 [Enterococcus faecium DO]
 gi|257879617|ref|ZP_05659270.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257883923|ref|ZP_05663576.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
 gi|257890284|ref|ZP_05669937.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
 gi|258616772|ref|ZP_05714542.1| Holliday junction resolvase-like protein [Enterococcus faecium DO]
 gi|260559720|ref|ZP_05831900.1| conserved hypothetical protein [Enterococcus faecium C68]
 gi|261208764|ref|ZP_05923201.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289565552|ref|ZP_06445999.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|293560123|ref|ZP_06676627.1| conserved hypothetical protein [Enterococcus faecium E1162]
 gi|294614420|ref|ZP_06694336.1| hypothetical protein EfmE1636_0526 [Enterococcus faecium E1636]
 gi|294617987|ref|ZP_06697592.1| conserved hypothetical protein [Enterococcus faecium E1679]
 gi|314939503|ref|ZP_07846735.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133a04]
 gi|314944177|ref|ZP_07850822.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133C]
 gi|314949753|ref|ZP_07853063.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0082]
 gi|314951904|ref|ZP_07854936.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133A]
 gi|314994470|ref|ZP_07859749.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133B]
 gi|314997874|ref|ZP_07862775.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133a01]
 gi|68196006|gb|EAN10439.1| Conserved hypothetical protein 250 [Enterococcus faecium DO]
 gi|257813845|gb|EEV42603.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257819761|gb|EEV46909.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
 gi|257826644|gb|EEV53270.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
 gi|260074388|gb|EEW62710.1| conserved hypothetical protein [Enterococcus faecium C68]
 gi|260077266|gb|EEW64986.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289162634|gb|EFD10487.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|291592728|gb|EFF24321.1| hypothetical protein EfmE1636_0526 [Enterococcus faecium E1636]
 gi|291595796|gb|EFF27084.1| conserved hypothetical protein [Enterococcus faecium E1679]
 gi|291605990|gb|EFF35420.1| conserved hypothetical protein [Enterococcus faecium E1162]
 gi|313588099|gb|EFR66944.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133a01]
 gi|313591125|gb|EFR69970.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133B]
 gi|313595938|gb|EFR74783.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133A]
 gi|313597239|gb|EFR76084.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133C]
 gi|313641204|gb|EFS05784.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0133a04]
 gi|313643826|gb|EFS08406.1| conserved hypothetical protein TIGR00250 [Enterococcus faecium
           TX0082]
          Length = 143

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 46/137 (33%), Positives = 74/137 (54%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             +  +D+G+K +G+AISDP    A     +   +  +      L   +    +  F++G
Sbjct: 1   MRVMGLDVGSKTVGVAISDPFGWTAQGVEIIRINEAEEEFGFDRLKELVAQYEVDRFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN S GPR  ++ ++    I     +P  + DERLTTV A+++L++  N SR KR 
Sbjct: 61  LPKNMNNSIGPRAEASMSYGE-KIKELFSLPVDYQDERLTTVQAERMLVEQANTSRAKRK 119

Query: 134 QKVDSIAAALILQEVLD 150
           + +D +AA +ILQ  LD
Sbjct: 120 KVIDKLAAVMILQNYLD 136


>gi|325479225|gb|EGC82321.1| RNAse H domain protein, YqgF family [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 139

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 52/137 (37%), Positives = 78/137 (56%), Gaps = 1/137 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I  +D+G K IG+A+SDP    A  +  + RKK +     LL  I   ++   ++GL
Sbjct: 1   MSRIMGLDVGDKTIGVALSDPMFLLAQAKETIKRKKASLDIQRLLEIIDENDVNLIVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + GP+     +FV  ++ ++  V  V+ DER+TT+ ++ +LIDM V R+ R Q 
Sbjct: 61  PKNMNNTIGPQSMKVMSFVD-LLKKQTDVEIVYEDERMTTIQSESVLIDMKVRRENRKQY 119

Query: 136 VDSIAAALILQEVLDRI 152
           +D IAA  ILQ  LDR 
Sbjct: 120 IDKIAATFILQTYLDRR 136


>gi|309775358|ref|ZP_07670363.1| putative Holliday junction resolvase [Erysipelotrichaceae bacterium
           3_1_53]
 gi|308916875|gb|EFP62610.1| putative Holliday junction resolvase [Erysipelotrichaceae bacterium
           3_1_53]
          Length = 137

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 47/139 (33%), Positives = 74/139 (53%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK--KVTQTALELLSFITTENIAAFIIG 74
             I  +DLG+K +G+++SD     A P   +  +         ++  +I    +   ++G
Sbjct: 1   MRILGLDLGSKTLGVSVSDALGMIARPVETIRFESDDYDAAFEQVQKYIKEFQVTTAVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP +MNG  G R   +  F   +    + +  V WDERLTTV+A++ILI  +VSRKKR +
Sbjct: 61  LPKHMNGDVGIRGEISVMFKEKL--ETLGLEVVLWDERLTTVAAEKILISADVSRKKRKK 118

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA  ILQ  LD  +
Sbjct: 119 IIDQMAAVQILQSYLDSKN 137


>gi|301793470|emb|CBW35843.1| putative Holliday junction resolvase [Streptococcus pneumoniae
           INV104]
          Length = 136

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 48/135 (35%), Positives = 79/135 (58%), Gaps = 4/135 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +   +         +   + T  +  F++GLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRVKELVDTYKVERFVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN + GPRV +++A+    ++    +P  + DERLTTV+A+++LI+  ++SR KR + +
Sbjct: 61  NMNNTSGPRVEASQAYGA-KLEEFFGLPLDYQDERLTTVAAERMLIEQADISRNKRKKVI 119

Query: 137 DSIAAALILQEVLDR 151
           D +AA LILQ  LDR
Sbjct: 120 DKLAAQLILQNYLDR 134


>gi|242237995|ref|YP_002986176.1| Holliday junction resolvase-like protein [Dickeya dadantii Ech703]
 gi|242130052|gb|ACS84354.1| Holliday junction resolvase YqgF [Dickeya dadantii Ech703]
          Length = 139

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/139 (28%), Positives = 64/139 (46%), Gaps = 1/139 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            N+ + + D GT+ IG+AI       A P   L  +  T    ++ + +        I+G
Sbjct: 2   SNRTVMAFDFGTRSIGVAIGQEITGTARPLLSLKAQDGTPDWQKIEALLNEWQPDLVIVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPLNM+G+E P     R F    +  +  V     DERL+TV A+  L +    R     
Sbjct: 62  LPLNMDGTEQPITARARKFAQ-RLHGRFGVAIQLHDERLSTVEARADLFERGGFRALDKG 120

Query: 135 KVDSIAAALILQEVLDRIS 153
            VD+ +A +IL+   ++ S
Sbjct: 121 SVDAASAVIILESWFEQQS 139


>gi|82751216|ref|YP_416957.1| Holliday junction resolvase-like protein [Staphylococcus aureus
           RF122]
 gi|146325611|sp|Q2YT62|RUVX_STAAB RecName: Full=Putative Holliday junction resolvase
 gi|82656747|emb|CAI81176.1| probable Holliday junction resolvase [Staphylococcus aureus RF122]
          Length = 142

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 46/137 (33%), Positives = 76/137 (55%), Gaps = 2/137 (1%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIGL 75
            I  +D+G++ +G+AISD     A     L    +       +L+  I   N+   +IGL
Sbjct: 5   KILGLDVGSRTVGIAISDIMGWTAQGLDTLRINEENNELGIDQLVDIIKKHNVGTVVIGL 64

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN S G R  ++  +   +++    +  V WDERL+T++A++ L++ +VSR+KR Q 
Sbjct: 65  PKNMNNSIGFRGEASLTYKEKLLEAYPSIEIVMWDERLSTMAAERSLLEADVSRQKRKQL 124

Query: 136 VDSIAAALILQEVLDRI 152
           +D +AA  ILQ  LD +
Sbjct: 125 IDKMAAVFILQGYLDSL 141


>gi|163849371|ref|YP_001637415.1| Holliday junction resolvase YqgF [Chloroflexus aurantiacus J-10-fl]
 gi|222527368|ref|YP_002571839.1| Holliday junction resolvase YqgF [Chloroflexus sp. Y-400-fl]
 gi|189046090|sp|A9WCR4|RUVX_CHLAA RecName: Full=Putative Holliday junction resolvase
 gi|254767506|sp|B9LH40|RUVX_CHLSY RecName: Full=Putative Holliday junction resolvase
 gi|163670660|gb|ABY37026.1| Holliday junction resolvase YqgF [Chloroflexus aurantiacus J-10-fl]
 gi|222451247|gb|ACM55513.1| Holliday junction resolvase YqgF [Chloroflexus sp. Y-400-fl]
          Length = 153

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 42/139 (30%), Positives = 76/139 (54%), Gaps = 1/139 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            +Q I ++D+G +RIG+AISD   R A P   +      +   +++  +    ++  ++G
Sbjct: 2   NDQIILALDVGERRIGVAISDADARIAAPLTTINAHPPERAIAQIVRLVQERGVSRVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPL M G  GP+    + F    +   +  P   +DERLT+V+A+Q+L ++ +   K   
Sbjct: 62  LPLTMRGERGPQAEVVQRFAD-TLSSALSCPVEMFDERLTSVAAEQMLRNLGLKPAKIKA 120

Query: 135 KVDSIAAALILQEVLDRIS 153
           ++D +AA++ILQ+ LD   
Sbjct: 121 QIDQVAASIILQDYLDARR 139


>gi|224542878|ref|ZP_03683417.1| hypothetical protein CATMIT_02072 [Catenibacterium mitsuokai DSM
           15897]
 gi|224524208|gb|EEF93313.1| hypothetical protein CATMIT_02072 [Catenibacterium mitsuokai DSM
           15897]
          Length = 140

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 51/140 (36%), Positives = 73/140 (52%), Gaps = 3/140 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV--TQTALELLSFITTENIAAFII 73
            + I  +DLG++  G+AISD     AH        +    + A  + + +   NI   ++
Sbjct: 1   MEKILGLDLGSRTCGVAISDTLGMLAHGVETYHFSENAYKKCAYHIKNIVEENNIHTIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP +MNG  G R   +  F    +++ + V  +  DERLTTV A   LI  +VSRKKR 
Sbjct: 61  GLPKHMNGDLGERAQISIDF-KERLEKMMDVEVILEDERLTTVIATNNLIFGDVSRKKRK 119

Query: 134 QKVDSIAAALILQEVLDRIS 153
           Q VD +AA  ILQ  LD+I 
Sbjct: 120 QVVDKMAAVEILQGYLDKIR 139


>gi|281490614|ref|YP_003352594.1| YqgF family resolvase [Lactococcus lactis subsp. lactis KF147]
 gi|161702205|gb|ABX75666.1| Resolvase, YqgF family [Lactococcus lactis subsp. lactis KF147]
          Length = 143

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 45/135 (33%), Positives = 68/135 (50%), Gaps = 3/135 (2%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGL 75
            I  +D+GTK +G+++SD     A P   +             L   I        ++GL
Sbjct: 4   RILGLDVGTKTVGVSVSDLLGMTAQPVETIKIDSEAGELGFERLGVLIKEYKPEKVVLGL 63

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MNG EG R  ++R +    +  +  +   + DERLTT  A+++LID  V RK R + 
Sbjct: 64  PKHMNGDEGVRAEASRDYG-TKLANEFGLEVAYQDERLTTAQAEKVLIDGGVRRKDRKKS 122

Query: 136 VDSIAAALILQEVLD 150
           +D +AA LILQ  LD
Sbjct: 123 IDKLAAVLILQNYLD 137


>gi|261380468|ref|ZP_05985041.1| putative Holliday junction resolvase [Neisseria subflava NJ9703]
 gi|284796710|gb|EFC52057.1| putative Holliday junction resolvase [Neisseria subflava NJ9703]
          Length = 151

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 32/136 (23%), Positives = 61/136 (44%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P   + + D G  RIG+A  D      HP   +      +    +   +       F++G
Sbjct: 5   PKGTVLAFDFGEARIGVAQGDAELGMTHPLATITGNSNDEKFEAIAKLVKEWQPKYFVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP + +G+E      +R F    +  +  +P  + DER++++ A+ +L +  V  +K+  
Sbjct: 65  LPTHTDGTEHELTRLSRKFGR-RLHGRFNLPVYWVDERMSSLYAESLLAEAQVFGRKQKS 123

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA  ILQ   +
Sbjct: 124 VLDQVAAQAILQGFFE 139


>gi|306826005|ref|ZP_07459341.1| crossover junction endodeoxyribonuclease [Streptococcus sp. oral
           taxon 071 str. 73H25AP]
 gi|306828767|ref|ZP_07461959.1| crossover junction endodeoxyribonuclease [Streptococcus mitis ATCC
           6249]
 gi|315612311|ref|ZP_07887225.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           ATCC 49296]
 gi|331267155|ref|YP_004326785.1| Holliday junction resolvase-like protein,putative ribonuclease
           [Streptococcus oralis Uo5]
 gi|304428945|gb|EFM32033.1| crossover junction endodeoxyribonuclease [Streptococcus mitis ATCC
           6249]
 gi|304431721|gb|EFM34701.1| crossover junction endodeoxyribonuclease [Streptococcus sp. oral
           taxon 071 str. 73H25AP]
 gi|315315704|gb|EFU63742.1| crossover junction endodeoxyribonuclease [Streptococcus sanguinis
           ATCC 49296]
 gi|326683827|emb|CBZ01445.1| Holliday junction resolvase-like protein,putative ribonuclease
           [Streptococcus oralis Uo5]
          Length = 136

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 47/135 (34%), Positives = 79/135 (58%), Gaps = 4/135 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +   +         +   + +  +  F++GLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGFTAQGLEIIQINEDQGQFGFDRIKELVDSYKVERFVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN + GPRV +++A+    ++    +P  + DERLTTV+A+++LI+  ++SR KR + +
Sbjct: 61  NMNNTSGPRVEASQAYGA-KLEELFGLPVDYQDERLTTVAAERMLIEQADISRNKRKKVI 119

Query: 137 DSIAAALILQEVLDR 151
           D +AA LILQ  LDR
Sbjct: 120 DKLAAQLILQNYLDR 134


>gi|312195531|ref|YP_004015592.1| Holliday junction resolvase YqgF [Frankia sp. EuI1c]
 gi|311226867|gb|ADP79722.1| Holliday junction resolvase YqgF [Frankia sp. EuI1c]
          Length = 197

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 43/137 (31%), Positives = 65/137 (47%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK-KVTQTALELLSFITTENIAAFII 73
           P      +D+GT RIG+++SDP    A P   L R         +L   +      A ++
Sbjct: 43  PVGVWLGVDVGTVRIGVSVSDPDGVLALPIGTLRRDVSDNSDLAQLAELVHERRAVAVVV 102

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP+ ++G EG      R +  ++  R   +P    DERLTT +A + + +  +S + R 
Sbjct: 103 GLPMTLSGEEGLAAQRIRQYAQSLSARVAPIPVRLVDERLTTAAAHRRMAERGLSSRARR 162

Query: 134 QKVDSIAAALILQEVLD 150
             VD  AA  ILQ  LD
Sbjct: 163 GLVDQEAAVQILQHALD 179


>gi|332830441|gb|EGK03069.1| Holliday junction resolvase [Dysgonomonas gadei ATCC BAA-286]
          Length = 141

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/140 (27%), Positives = 67/140 (47%), Gaps = 5/140 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
                ++D GTKR G+A+SD  +  A+    +    +        +++  E++   I+GL
Sbjct: 1   MGRFLALDYGTKRTGIAVSDTLKIIANGLTTVPTHTLFDYL---KTYLEREDVECIIVGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      +   R FV  + +    +P   +DER T+  AQ+ +ID  + +K R   
Sbjct: 58  PKQMNNEYSENMKHIRPFVKKLQNLYPDIPVEMYDERFTSALAQKTMIDAGLRKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRIS 153
             VD I+A +ILQ  ++ + 
Sbjct: 118 ALVDEISAVIILQSYMESLR 137


>gi|225076223|ref|ZP_03719422.1| hypothetical protein NEIFLAOT_01260 [Neisseria flavescens
           NRL30031/H210]
 gi|224952347|gb|EEG33556.1| hypothetical protein NEIFLAOT_01260 [Neisseria flavescens
           NRL30031/H210]
          Length = 151

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 32/136 (23%), Positives = 61/136 (44%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P   + + D G  RIG+A  D      HP   +      +    +   +       F++G
Sbjct: 5   PKGTVLAFDFGEARIGVAQGDAELGMTHPLATVTGNSNDEKFEAIAKLVKEWQPKYFVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP + +G+E      +R F    +  +  +P  + DER++++ A+ +L +  V  +K+  
Sbjct: 65  LPTHTDGTEHELTRLSRKFGR-RLHGRFNLPVYWVDERMSSLYAESLLAEAQVFGRKQKS 123

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA  ILQ   +
Sbjct: 124 VLDQVAAQAILQGFFE 139


>gi|330995382|ref|ZP_08319292.1| RNAse H domain protein, YqgF family [Paraprevotella xylaniphila YIT
           11841]
 gi|329575877|gb|EGG57401.1| RNAse H domain protein, YqgF family [Paraprevotella xylaniphila YIT
           11841]
          Length = 141

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/143 (26%), Positives = 70/143 (48%), Gaps = 5/143 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              + +ID G KR G+A++DP +  A+    +    V    +    ++  E++   ++G 
Sbjct: 1   MGRVLAIDYGKKRTGVAVTDPLQLIANGLTTVSTSSVMDFIVS---YVQQEHVERIVVGQ 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P   NG +   +    +FV  + +R   +P  F+DER T+V A Q ++   + +K R   
Sbjct: 58  PKQANGEDSENMGRINSFVRRLHERLPEIPVEFFDERYTSVLAHQAMLQGGLRKKARQNK 117

Query: 134 QKVDSIAAALILQEVLDRISFLE 156
             VD I+A +ILQ  ++    L+
Sbjct: 118 ALVDEISATIILQGWMESRMMLK 140


>gi|309378826|emb|CBX22531.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 142

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 62/131 (47%), Gaps = 1/131 (0%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            + D G  RIG+A  D     +HP   +      +    +   +       F++GLP++ 
Sbjct: 1   MAFDFGEARIGVAQGDAELGLSHPLSTVTGSSNDEKFAAIAKLVQEWQPRYFVVGLPVHT 60

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +G+E    H +R F    +  +  +P  + DERL++V A+ +L +  V  KKR   +D +
Sbjct: 61  DGTEHEMTHLSRKFGR-RLHGRFGLPVYWVDERLSSVYAESLLSEARVFGKKRKSVLDQV 119

Query: 140 AAALILQEVLD 150
           AA  ILQ   +
Sbjct: 120 AAQAILQSFFE 130


>gi|167756782|ref|ZP_02428909.1| hypothetical protein CLORAM_02331 [Clostridium ramosum DSM 1402]
 gi|237734500|ref|ZP_04564981.1| conserved hypothetical protein [Mollicutes bacterium D7]
 gi|167702957|gb|EDS17536.1| hypothetical protein CLORAM_02331 [Clostridium ramosum DSM 1402]
 gi|229382320|gb|EEO32411.1| conserved hypothetical protein [Coprobacillus sp. D7]
          Length = 139

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 67/137 (48%), Gaps = 2/137 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFII 73
            + I  +DLG++  G+AISD     AH       +       A  +++ I    I   ++
Sbjct: 1   MERILGLDLGSRTCGIAISDTLGMLAHGIETYRFRDDDYDRAAKHVVALINEHQIKTVVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP +MNG  G R   +  F   +      +  V  DERLTT  AQ  LI  +VSRKKR 
Sbjct: 61  GLPKHMNGDLGERAQISIMFKEMLEKEVPGLNVVLIDERLTTKVAQDQLIFADVSRKKRK 120

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D +AA  ILQ  LD
Sbjct: 121 QVIDKMAAVAILQGYLD 137


>gi|330684841|gb|EGG96531.1| RNAse H domain protein, YqgF family [Staphylococcus epidermidis
           VCU121]
          Length = 142

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 46/140 (32%), Positives = 74/140 (52%), Gaps = 2/140 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFII 73
              I  +D+G+K +G+AISD     A     L            +L+  I    +   +I
Sbjct: 3   KHKILGLDVGSKTVGIAISDLMGWTAQGLDTLRIDENNNELGIDQLVDIIKKHGVGTVVI 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NMN S G R  ++  +   + +    +  + WDERL+T++A++ L++ +VSR+KR 
Sbjct: 63  GLPKNMNNSIGFRGEASLQYKEKLQEALPSIEIIMWDERLSTMAAEKSLLEADVSRQKRK 122

Query: 134 QKVDSIAAALILQEVLDRIS 153
           + +D +AA  ILQ  LD IS
Sbjct: 123 KVIDKMAAVFILQGYLDSIS 142


>gi|189461817|ref|ZP_03010602.1| hypothetical protein BACCOP_02483 [Bacteroides coprocola DSM 17136]
 gi|189431411|gb|EDV00396.1| hypothetical protein BACCOP_02483 [Bacteroides coprocola DSM 17136]
          Length = 138

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 39/140 (27%), Positives = 65/140 (46%), Gaps = 5/140 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A+SDP +  A     +   ++    L   ++I  E +   IIG 
Sbjct: 1   MSRILAIDYGRKRTGIAVSDPLQIIASGLTTVPTHQLMDFLL---NYIKQEQVECIIIGH 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  +N  +   + +   F++ +      +P    DER T+V A Q ++   + +K R   
Sbjct: 58  PKQLNNEDSENMKNIIPFINRLKKILPDMPVQLVDERFTSVLAHQTMLAGGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRIS 153
             VD I+A +ILQ  L+   
Sbjct: 118 ALVDEISATIILQSYLESRR 137


>gi|261363738|ref|ZP_05976621.1| putative Holliday junction resolvase [Neisseria mucosa ATCC 25996]
 gi|288568309|gb|EFC89869.1| putative Holliday junction resolvase [Neisseria mucosa ATCC 25996]
          Length = 158

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 33/136 (24%), Positives = 61/136 (44%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P   + + D G  RIG+A  D     +HP   +      +    +   I        ++G
Sbjct: 5   PVGTVLAFDFGEARIGVAQGDAELGLSHPLATVTGNSNDEKFNAIAKLIREWQPKHLVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP + +G+E      +R F    +  +  +P  + DER++++ A+ +L +  V  +K+  
Sbjct: 65  LPTHADGTEHELTRLSRKFGR-RLHGRFNLPIYWVDERMSSLYAESLLAEAQVFGRKQKA 123

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA  ILQ   D
Sbjct: 124 VLDQVAAQAILQGFFD 139


>gi|239947537|ref|ZP_04699290.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921813|gb|EER21837.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 156

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 49/156 (31%), Positives = 80/156 (51%), Gaps = 1/156 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I  +++  + L PN P+ +ID G+K++G+A+S+  R  A P   +           LL
Sbjct: 1   MIIKNLQEFYRLLIPNAPLIAIDYGSKKLGIALSNQERSIAMPLNTITEINKKIVITSLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKV-YVPFVFWDERLTTVSAQ 119
           + I    +   +IGLP++M+G+   + +    F   + +     +P    DERLTT +A 
Sbjct: 61  NIIEKYKVCGVVIGLPIDMSGAVTEQTNIVMKFAEELAESINLPIPVYLQDERLTTKAAN 120

Query: 120 QILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
             L    V RK R    D++AA++IL+ VLD I  L
Sbjct: 121 NFLKSFGVKRKDRNNNDDAVAASMILETVLDSIKKL 156


>gi|253690074|ref|YP_003019264.1| Holliday junction resolvase YqgF [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259495709|sp|C6DFI9|RUVX_PECCP RecName: Full=Putative Holliday junction resolvase
 gi|251756652|gb|ACT14728.1| Holliday junction resolvase YqgF [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 139

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 62/136 (45%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            ++ I + D GTK IG+AI       A P      ++      ++   ++       ++G
Sbjct: 2   KSRTILAFDFGTKSIGVAIGQEITGTARPLTSFKAQEGIPDWQKVEKLLSEWQPDLVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPLNM+G+E P     R F +  +  +  V     DERL+TV A+  L +    +     
Sbjct: 62  LPLNMDGTEQPLTARARKFAN-RLHGRFGVAIALHDERLSTVEARADLFERGGFKALDKG 120

Query: 135 KVDSIAAALILQEVLD 150
            VD+ +A +IL+   +
Sbjct: 121 SVDAASAVIILESWFE 136


>gi|114327615|ref|YP_744771.1| endonuclease involved in recombination [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315789|gb|ABI61849.1| endonuclease involved in recombination [Granulibacter bethesdensis
           CGDNIH1]
          Length = 168

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 55/154 (35%), Positives = 81/154 (52%), Gaps = 2/154 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           MS+  + DL   L  NQ +  ID G++ IG+A+SD     A P   + R K+   A E+ 
Sbjct: 3   MSLFNVPDLQSRLSRNQRLLGIDPGSRIIGIALSDVLLGIASPYGSIRRGKLRVNAEEIA 62

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +    E     IIGLPL+M+GS GP   + R +    +     +P   WDER T+    Q
Sbjct: 63  AIARKEEAGGMIIGLPLSMDGSFGPAAQAARDWA-IALSDATGLPAALWDERETSSRVHQ 121

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLDRIS 153
           +LI   ++ RK+R   VD +AAA++LQ  LD + 
Sbjct: 122 LLISSADLGRKRRAAVVDKMAAAVMLQSALDALP 155


>gi|145224344|ref|YP_001135022.1| Holliday junction resolvase YqgF [Mycobacterium gilvum PYR-GCK]
 gi|315444676|ref|YP_004077555.1| hypothetical protein Mspyr1_31030 [Mycobacterium sp. Spyr1]
 gi|145216830|gb|ABP46234.1| Holliday junction resolvase YqgF [Mycobacterium gilvum PYR-GCK]
 gi|315262979|gb|ADT99720.1| conserved hypothetical protein TIGR00250 [Mycobacterium sp. Spyr1]
          Length = 175

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 60/141 (42%), Gaps = 1/141 (0%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVT-QTALELLSFITTENIAAFI 72
                   ID+G+ RIG+A+SDP    A P   + R + + +    L + +        +
Sbjct: 23  PGRGRRLGIDVGSVRIGVAVSDPDAVLATPVETVTRDRRSGRHLRRLTTLVGEYEAVEVV 82

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           IGLP  +    G            +  R   VP    DER TTV+AQ+ L +  V  + +
Sbjct: 83  IGLPRTLGNRAGSSAQDATEVADQLAARIAPVPVRLADERFTTVTAQRELREAGVRARGQ 142

Query: 133 IQKVDSIAAALILQEVLDRIS 153
              +D  AA  ILQ  LD+  
Sbjct: 143 KSMIDQAAAVGILQNWLDQRR 163


>gi|67458927|ref|YP_246551.1| Holliday junction resolvase-like protein [Rickettsia felis
           URRWXCal2]
 gi|75536635|sp|Q4UM37|RUVX_RICFE RecName: Full=Putative Holliday junction resolvase
 gi|67004460|gb|AAY61386.1| Conserved hypothetical protein [Rickettsia felis URRWXCal2]
          Length = 154

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 49/155 (31%), Positives = 81/155 (52%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I  +++    L PN P+ +ID G+K++G+A+S+  R  A P   ++          LL
Sbjct: 1   MIIKNLQEFYPLLIPNAPLIAIDYGSKKLGIALSNQERNIAMPLNTIIEINKKIVITSLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           S I    +   +IGLP++M+G+   + +    F    + + + +P    DERLTT +A  
Sbjct: 61  SIIEKYKVCGVVIGLPIDMSGAVTEQTNIVMKFAE-ELAKSINLPIYLQDERLTTKAANN 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
            L    V RK R    D++AA++IL+ VLD +  L
Sbjct: 120 FLKSFGVKRKDRNNNDDAVAASMILETVLDSMKKL 154


>gi|199598089|ref|ZP_03211512.1| Holliday junction resolvase-like protein [Lactobacillus rhamnosus
           HN001]
 gi|258507765|ref|YP_003170516.1| Holliday junction resolvase-like protein [Lactobacillus rhamnosus
           GG]
 gi|199591015|gb|EDY99098.1| Holliday junction resolvase-like protein [Lactobacillus rhamnosus
           HN001]
 gi|257147692|emb|CAR86665.1| Holliday junction resolvase [Lactobacillus rhamnosus GG]
 gi|259649112|dbj|BAI41274.1| holliday junction resolvase-like protein [Lactobacillus rhamnosus
           GG]
          Length = 144

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIG 74
             +  +D+G++ +G+A+SDP    A     +   +  Q      L   +T   + AF++G
Sbjct: 1   MRLMGLDVGSRTVGVAVSDPLGWTAQGLEIIRINEDKQQFGLKRLKELVTQYEVTAFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN S GPR   ++A+   ++     +P  F DERLTTV A ++LI+  + SRK++ 
Sbjct: 61  LPKNMNNSIGPRAEKSQAYGD-LLKETFGLPVDFIDERLTTVEASRMLIEEADASRKRQK 119

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D +AA +ILQ  LD
Sbjct: 120 QVIDKLAAQMILQNYLD 136


>gi|258538956|ref|YP_003173455.1| Holliday junction resolvase-like protein [Lactobacillus rhamnosus
           Lc 705]
 gi|257150632|emb|CAR89604.1| Holliday junction resolvase [Lactobacillus rhamnosus Lc 705]
 gi|328469825|gb|EGF40739.1| Holliday junction resolvase-like protein [Lactobacillus rhamnosus
           MTCC 5462]
          Length = 144

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIG 74
             +  +D+G++ +G+A+SDP    A     +   +  Q      L   +T   + AF++G
Sbjct: 1   MRLMGLDVGSRTVGVAVSDPLGWTAQGLEIIRINEDKQQFGLKRLKELVTQYEVTAFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN S GPR   ++A+   ++     +P  F DERLTTV A ++LI+  + SRK++ 
Sbjct: 61  LPKNMNNSIGPRAEKSQAYGD-LLKETFGLPVDFIDERLTTVEASRMLIEEADASRKRQK 119

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D +AA +ILQ  LD
Sbjct: 120 QVIDKLAAQMILQNYLD 136


>gi|258511991|ref|YP_003185425.1| Holliday junction resolvase YqgF [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257478717|gb|ACV59036.1| Holliday junction resolvase YqgF [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 144

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 46/130 (35%), Positives = 72/130 (55%), Gaps = 1/130 (0%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            +ID G +RIG+A+SDP    A P   + R+   Q A E+      E +   ++G PL+M
Sbjct: 1   MAIDFGERRIGVALSDPMGLIAQPYGVIERQSDRQAADEVADLARREEVGRIVVGRPLHM 60

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +G           F    +  +  +P   +DERLTTVSA++ILI+ NV R++R   VD+ 
Sbjct: 61  SGQPSEMTSRAEKFARM-LAARTGLPVDLYDERLTTVSAERILIEQNVRRRERRATVDAA 119

Query: 140 AAALILQEVL 149
           AA ++L++ L
Sbjct: 120 AAQVLLEDYL 129


>gi|125623030|ref|YP_001031513.1| putative Hollyday junction resolvase [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|167012732|sp|A2RHM2|RUVX_LACLM RecName: Full=Putative Holliday junction resolvase
 gi|124491838|emb|CAL96758.1| putative Hollyday junction resolvase [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|300069777|gb|ADJ59177.1| Holliday junction resolvase-like protein [Lactococcus lactis subsp.
           cremoris NZ9000]
          Length = 143

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 46/135 (34%), Positives = 68/135 (50%), Gaps = 3/135 (2%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGL 75
            I  +D+GTK +G+++SD     A P   +             L   I        ++GL
Sbjct: 4   RILGLDVGTKTVGVSVSDLLGMTAQPVETIKIDSEAGELGFDRLAVLIKEYKPEKVVLGL 63

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MNG EG R  ++R +    +  K  +   + DERLTT  A+++LID  V RK R + 
Sbjct: 64  PKHMNGDEGIRAEASRDYG-TKLANKFGLEVAYQDERLTTAQAEKVLIDGGVRRKDRKKS 122

Query: 136 VDSIAAALILQEVLD 150
           +D +AA LILQ  LD
Sbjct: 123 IDKLAAVLILQNYLD 137


>gi|229553800|ref|ZP_04442525.1| crossover junction endodeoxyribonuclease [Lactobacillus rhamnosus
           LMS2-1]
 gi|229312823|gb|EEN78796.1| crossover junction endodeoxyribonuclease [Lactobacillus rhamnosus
           LMS2-1]
          Length = 144

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 48/137 (35%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIG 74
             +  +D+G++ +G+A+SDP    A     +   +  Q      L   +T   + AF++G
Sbjct: 1   MRLMGLDVGSRTVGVAVSDPLGWTAQGLEIIRINEDKQQFGLTRLKELVTQYEVTAFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN S GPR   ++A+   ++     +P  F DERLTTV A ++LI+  + SRK++ 
Sbjct: 61  LPKNMNNSIGPRAEKSQAYGD-LLKETFGLPVDFIDERLTTVEASRMLIEEADASRKRQK 119

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D +AA +ILQ  LD
Sbjct: 120 QVIDKLAAQMILQNYLD 136


>gi|90580288|ref|ZP_01236095.1| Holliday junction resolvase-like protein [Vibrio angustum S14]
 gi|90438590|gb|EAS63774.1| Holliday junction resolvase-like protein [Vibrio angustum S14]
          Length = 143

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 34/140 (24%), Positives = 58/140 (41%), Gaps = 2/140 (1%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           +  ++ +   D GTK IG+AI       A P   L  K       ++   +        +
Sbjct: 1   MSQSRSVLGFDYGTKSIGVAIGQELTGTATPLAALKAKDGIPNWDDIEKILKEWLPDLVV 60

Query: 73  IGLPLNMNGSEGP-RVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           +GLPL++ G E        + F +  +  +        DERL+TV A+  L +    R  
Sbjct: 61  VGLPLDLEGKELESITPRAKKFAN-RLHGRFGYQVELHDERLSTVEAKAELFERGGYRSL 119

Query: 132 RIQKVDSIAAALILQEVLDR 151
               +DS +A +IL+   +R
Sbjct: 120 SKGNIDSQSAVVILESWFER 139


>gi|15604198|ref|NP_220713.1| Holliday junction resolvase-like protein [Rickettsia prowazekii
           str. Madrid E]
 gi|6226362|sp|Q9ZDJ8|RUVX_RICPR RecName: Full=Putative Holliday junction resolvase
 gi|3860890|emb|CAA14790.1| unknown [Rickettsia prowazekii]
 gi|292571936|gb|ADE29851.1| Putative endonuclease involved in recombination [Rickettsia
           prowazekii Rp22]
          Length = 156

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 48/152 (31%), Positives = 79/152 (51%), Gaps = 1/152 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I  +++  + L PN+P+ +ID G+K+IG+A+SD     A P   +           LL
Sbjct: 1   MIIKNLQEFYRLLIPNKPLIAIDYGSKKIGVALSDQELSIAMPFNTITAVNKKVVITSLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + I    +   +IGLP++M+G    + +    F    + + + +P    DERLTT SA  
Sbjct: 61  NIIKKYKVCGIVIGLPIDMSGGVTQQTNIVMKFAE-KLKQSLGLPIYLQDERLTTKSANN 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRI 152
            L    + RK R    D++AA++IL+ VL+ I
Sbjct: 120 FLKSFGIKRKDRNHNDDAVAASMILEIVLNAI 151


>gi|157828326|ref|YP_001494568.1| Holliday junction resolvase-like protein [Rickettsia rickettsii
           str. 'Sheila Smith']
 gi|165933035|ref|YP_001649824.1| Holliday junction resolvase-like protein [Rickettsia rickettsii
           str. Iowa]
 gi|167012757|sp|A8GRN5|RUVX_RICRS RecName: Full=Putative Holliday junction resolvase
 gi|189046103|sp|B0BX42|RUVX_RICRO RecName: Full=Putative Holliday junction resolvase
 gi|157800807|gb|ABV76060.1| Holliday junction resolvase-like protein [Rickettsia rickettsii
           str. 'Sheila Smith']
 gi|165908122|gb|ABY72418.1| hypothetical cytosolic protein [Rickettsia rickettsii str. Iowa]
          Length = 154

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 48/155 (30%), Positives = 81/155 (52%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I  +++  + L PN P+ +ID G+K++G+A+S+     A P   +           LL
Sbjct: 1   MIIKNLQEFYRLLIPNAPLIAIDYGSKKLGIALSNQELSIAMPLNTITEINTKIVITVLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + I    +   IIGLP++M+G+   + +    F    + + + +P    DERLTT +A  
Sbjct: 61  NIIEKYKVCGVIIGLPIDMSGAVTEQTNIVMKFAE-ELAKSINLPIYLQDERLTTKAANN 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           +L    V RK R    D++AA++IL+ VLD I  +
Sbjct: 120 LLKSFGVKRKDRNNNDDAVAASMILETVLDSIKNI 154


>gi|73662454|ref|YP_301235.1| Holliday junction resolvase-like protein [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
 gi|146291069|sp|Q49Y54|RUVX_STAS1 RecName: Full=Putative Holliday junction resolvase
 gi|72494969|dbj|BAE18290.1| putative endonuclease involved in recombination [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
          Length = 142

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 45/139 (32%), Positives = 75/139 (53%), Gaps = 2/139 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFII 73
              I  +D+G+K +G+AISD     A     L    +        L+  I  +N+   +I
Sbjct: 3   KHKIIGLDVGSKTVGIAISDLMGWTAQGLDTLRIDEENNELGIEALVKIIKRDNVGTVVI 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NMN S G R  ++  +   + +    +  + WDERL+T++A++ L++ +VSR+KR 
Sbjct: 63  GLPKNMNNSIGFRGEASLQYKEQLQEALPSLEIIMWDERLSTMAAERSLLEADVSRQKRK 122

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA  ILQ  LD +
Sbjct: 123 KVIDKMAAVFILQGYLDSL 141


>gi|261346262|ref|ZP_05973906.1| putative Holliday junction resolvase [Providencia rustigianii DSM
           4541]
 gi|282565570|gb|EFB71105.1| putative Holliday junction resolvase [Providencia rustigianii DSM
           4541]
          Length = 139

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 59/135 (43%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + + + D GTK IG+A+       A     L          ++   +        I+GLP
Sbjct: 4   RTLLAFDFGTKSIGVAVGQEITGTARALTSLKANDGRPDWQQIEKLLKEWQPQLVIVGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+G+E       R F +  I  +  V     DERL+TV A+  L +    R     KV
Sbjct: 64  LNMDGTEQLVTSQARNFAN-RIHGRFGVQVKLHDERLSTVEAKAGLFEQGGYRALSKGKV 122

Query: 137 DSIAAALILQEVLDR 151
           DS +A +IL+   ++
Sbjct: 123 DSASAVVILESWFEQ 137


>gi|32130063|sp|Q9CJ63|RUVX_LACLA RecName: Full=Putative Holliday junction resolvase
          Length = 143

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 45/135 (33%), Positives = 69/135 (51%), Gaps = 3/135 (2%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGL 75
            I  +D+GTK +G+++SD     A P   +             L   I        ++GL
Sbjct: 4   RILGLDVGTKTVGVSVSDLLGMTAQPVETIKIDSEAGELGFERLGVLIKEYKPEKVVLGL 63

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MNG EG R  ++R +    +  +  +   + DERLTT  A+++LID  V RK+R + 
Sbjct: 64  PKHMNGDEGIRAEASRDYG-TKLANEFGLEVAYQDERLTTAQAEKVLIDGGVRRKERKKS 122

Query: 136 VDSIAAALILQEVLD 150
           +D +AA LILQ  LD
Sbjct: 123 IDKLAAVLILQNYLD 137


>gi|261342366|ref|ZP_05970224.1| putative Holliday junction resolvase [Enterobacter cancerogenus
           ATCC 35316]
 gi|288315001|gb|EFC53939.1| putative Holliday junction resolvase [Enterobacter cancerogenus
           ATCC 35316]
          Length = 138

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 60/136 (44%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P   L     T     +   +        I+GL
Sbjct: 2   SGTLIAFDFGTKSIGVAVGQRITGTARPLTALKANDGTPDWNLIERLLKEWQPDDVIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L +    R      
Sbjct: 62  PLNMDGTEQPLTARARKFAN-KIHGRFGVSVKLHDERLSTVEARAGLFEHGGFRALNKGS 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYFEQ 136


>gi|160872335|ref|ZP_02062467.1| conserved hypothetical protein [Rickettsiella grylli]
 gi|159121134|gb|EDP46472.1| conserved hypothetical protein [Rickettsiella grylli]
          Length = 139

 Score =  130 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 40/139 (28%), Positives = 65/139 (46%), Gaps = 1/139 (0%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           +   + +   D G K IG+AI       A P   L  KK      E+   +   +    +
Sbjct: 1   MPETKTVIGFDFGLKYIGVAIGQTSPSLAQPLTNLSVKKGNLPWEEIAQLLKMWSPDVIV 60

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +G+P NM+G+E P     R F+   +  +  +P    DERLTTV A+  L  +   +  +
Sbjct: 61  VGVPFNMDGTEQPITREARNFL-MELKNRFEIPVFPVDERLTTVEARSRLFALGGYKALK 119

Query: 133 IQKVDSIAAALILQEVLDR 151
            + +DSIAA LI++  L+ 
Sbjct: 120 KKSIDSIAAQLIVEIWLEN 138


>gi|212709356|ref|ZP_03317484.1| hypothetical protein PROVALCAL_00392 [Providencia alcalifaciens DSM
           30120]
 gi|212688268|gb|EEB47796.1| hypothetical protein PROVALCAL_00392 [Providencia alcalifaciens DSM
           30120]
          Length = 139

 Score =  130 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 59/135 (43%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + + + D GTK IG+A+       A     L          ++   +        I+GLP
Sbjct: 4   RTLLAFDFGTKSIGVAVGQEITGTARALTSLKASDGRPDWSQIEKLLKEWQPQLVIVGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+G+E       R F +  I  +  V     DERL+TV A+  L +    R     KV
Sbjct: 64  LNMDGTEQLVTSQARNFAN-RIHGRFGVQVQLHDERLSTVEAKAGLFEQGGYRALSKGKV 122

Query: 137 DSIAAALILQEVLDR 151
           DS +A +IL+   ++
Sbjct: 123 DSASAVVILESWFEQ 137


>gi|326201373|ref|ZP_08191245.1| Holliday junction resolvase YqgF [Clostridium papyrosolvens DSM
           2782]
 gi|325988941|gb|EGD49765.1| Holliday junction resolvase YqgF [Clostridium papyrosolvens DSM
           2782]
          Length = 142

 Score =  130 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 50/138 (36%), Positives = 73/138 (52%), Gaps = 2/138 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHP-RPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
             I  ID G  RIG+AISDP    A        ++ + +  L L   I    +   +IG 
Sbjct: 1   MRILGIDYGDSRIGVAISDPMGWTAQGLEMIKSKESLKKAVLRLSEIIKEYGVTDIVIGY 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P+NMNG++GPR   T  F+   I        + WDERLTTVSA + + ++ +   K+   
Sbjct: 61  PINMNGTKGPRTERTEEFIK-KISDFGEFNIIKWDERLTTVSAHRTMNELGIKASKKKDI 119

Query: 136 VDSIAAALILQEVLDRIS 153
           VD+++A LILQ  LDR++
Sbjct: 120 VDTMSAVLILQGYLDRMA 137


>gi|326405717|gb|ADZ62788.1| YqgF family resolvase [Lactococcus lactis subsp. lactis CV56]
          Length = 143

 Score =  130 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 45/135 (33%), Positives = 68/135 (50%), Gaps = 3/135 (2%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGL 75
            I  +D+GTK +G+++SD     A P   +             L   I        ++GL
Sbjct: 4   RILGLDVGTKTVGVSVSDLLGMTAQPVETIKIDSEAGELGFERLGVLIKEYKPEKVVLGL 63

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MNG EG R  ++R +    +  +  +   + DERLTT  A+++LID  V RK R + 
Sbjct: 64  PKHMNGDEGIRAEASRDYG-TKLANEFGLEVAYQDERLTTAQAEKVLIDGGVRRKDRKKS 122

Query: 136 VDSIAAALILQEVLD 150
           +D +AA LILQ  LD
Sbjct: 123 IDKLAAVLILQNYLD 137


>gi|229586597|ref|YP_002845098.1| Holliday junction resolvase-like protein [Rickettsia africae ESF-5]
 gi|259495712|sp|C3PN45|RUVX_RICAE RecName: Full=Putative Holliday junction resolvase
 gi|228021647|gb|ACP53355.1| Putative endonuclease involved in recombination [Rickettsia africae
           ESF-5]
          Length = 154

 Score =  130 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 48/155 (30%), Positives = 81/155 (52%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I  +++  + L PN P+ +ID G+K++G+A+S+     A P   +           LL
Sbjct: 1   MIIKNLQEFYRLLIPNAPLIAIDYGSKKLGIALSNQELSIAMPLNTITEINKKIVITSLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + I    +   IIGLP++M+G+   + +    F    + + + +P    DERLTT +A  
Sbjct: 61  NIIEKYKVCGVIIGLPIDMSGAVTEQTNIVMKFAE-ELAKSINLPIYLQDERLTTKAANN 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           +L    V RK R    D++AA++IL+ VLD I  +
Sbjct: 120 LLKSFGVKRKDRNNNDDAVAASMILETVLDSIKNI 154


>gi|255066197|ref|ZP_05318052.1| putative Holliday junction resolvase [Neisseria sicca ATCC 29256]
 gi|255049407|gb|EET44871.1| putative Holliday junction resolvase [Neisseria sicca ATCC 29256]
          Length = 155

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 33/136 (24%), Positives = 61/136 (44%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P   + + D G  RIG+A  D     +HP   +      +    +   I        ++G
Sbjct: 5   PAGTVLAFDFGETRIGVAQGDAELGLSHPLATVTGNSNDEKFNAIAKLIREWQPKHLVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP + +G+E      +R F    +  +  +P  + DER++++ A+ +L +  V  +K+  
Sbjct: 65  LPTHADGTEHELTRLSRKFGR-RLHGRFNLPIYWVDERMSSLYAESLLAEAQVFGRKQKA 123

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA  ILQ   D
Sbjct: 124 VLDQVAAQAILQGFFD 139


>gi|34580618|ref|ZP_00142098.1| hypothetical protein [Rickettsia sibirica 246]
 gi|238651062|ref|YP_002916919.1| Holliday junction resolvase-like protein [Rickettsia peacockii str.
           Rustic]
 gi|259495713|sp|C4K2S0|RUVX_RICPU RecName: Full=Putative Holliday junction resolvase
 gi|28262003|gb|EAA25507.1| unknown [Rickettsia sibirica 246]
 gi|238625160|gb|ACR47866.1| Holliday junction resolvase-like protein [Rickettsia peacockii str.
           Rustic]
          Length = 154

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 49/155 (31%), Positives = 82/155 (52%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I  +++  + L PN P+ +ID G+K++G+A+S+  R  A P   +           LL
Sbjct: 1   MIIKNLQEFYRLLIPNAPLIAIDYGSKKLGIALSNQERSIAMPLNTITEINKKIVITSLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + I    +   IIGLP++M+G+   + +    F    + + + +P    DERLTT +A  
Sbjct: 61  NIIEKYKVCGVIIGLPIDMSGAVTEQTNIVMKFAE-ELAKSINLPIYLQDERLTTKAANN 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           +L    V RK R    D++AA++IL+ VLD I  +
Sbjct: 120 LLKSFGVKRKDRNNNDDAVAASMILETVLDSIKNI 154


>gi|157148498|ref|YP_001455817.1| Holliday junction resolvase-like protein [Citrobacter koseri ATCC
           BAA-895]
 gi|167012710|sp|A8APG8|RUVX_CITK8 RecName: Full=Putative Holliday junction resolvase
 gi|157085703|gb|ABV15381.1| hypothetical protein CKO_04324 [Citrobacter koseri ATCC BAA-895]
          Length = 138

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 62/136 (45%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+AI       A   P +  +  T     +   +        I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAIGQRITGTARALPAIKAQDGTPDWNIIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+T+ A+  L +    R     K
Sbjct: 62  PLNMDGTEQPLTARARKFAN-RIHGRFGVLVTLHDERLSTIEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYFEQ 136


>gi|288928224|ref|ZP_06422071.1| Holliday junction resolvase [Prevotella sp. oral taxon 317 str.
           F0108]
 gi|288331058|gb|EFC69642.1| Holliday junction resolvase [Prevotella sp. oral taxon 317 str.
           F0108]
          Length = 138

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 39/140 (27%), Positives = 64/140 (45%), Gaps = 5/140 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I S+D G KR G+A++DP +   +    +    +    L+   +   E +   ++G 
Sbjct: 1   MARILSVDYGQKRTGIAVTDPLQIICNGLVTVSSSTLVDFLLD---YTKREEVELIVVGE 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P   NG     +   R FV         +P V++DER T+V A + +ID  + +K R   
Sbjct: 58  PKQTNGQPSENLERVRQFVARWKKACPTIPVVYYDERFTSVLAHRAMIDGGLKKKARQDK 117

Query: 134 QKVDSIAAALILQEVLDRIS 153
             VD I+A +ILQ  L+   
Sbjct: 118 ALVDEISATIILQSYLESKR 137


>gi|313157066|gb|EFR56496.1| RNAse H domain protein, YqgF family [Alistipes sp. HGB5]
          Length = 137

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 36/137 (26%), Positives = 62/137 (45%), Gaps = 5/137 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID GTKR G+A+SDP R  A     +  K +         +   E++   ++G 
Sbjct: 1   MGRILAIDYGTKRTGIAVSDPLRLIAGGLETVETKGLEAWL---AKYFAAEDVTTIVVGK 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR--KKRI 133
           P  M+G+              +         VF+DER T+V A + +++  + R  ++  
Sbjct: 58  PTQMDGTPSETWRFVEPLAARLRRAYPDKEVVFYDERFTSVLAHRTMLESGIGRMARRNK 117

Query: 134 QKVDSIAAALILQEVLD 150
             VD I+A +ILQ  ++
Sbjct: 118 ALVDKISATIILQSYME 134


>gi|71909503|ref|YP_287090.1| Holliday junction resolvase-like protein [Dechloromonas aromatica
           RCB]
 gi|146325566|sp|Q478W1|RUVX_DECAR RecName: Full=Putative Holliday junction resolvase
 gi|71849124|gb|AAZ48620.1| Holliday junction resolvase YqgF [Dechloromonas aromatica RCB]
          Length = 146

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 33/136 (24%), Positives = 58/136 (42%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              + + D G KRIG+A  +     AHP   +  +        +   +        ++GL
Sbjct: 1   MGTVLAFDFGEKRIGVATGETMLCSAHPLTTIHAESNEDRFAAIGKLVAEWQPEQLVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P + +G+          F    + R+  +P  F DERLT++ A+  L +   + K     
Sbjct: 61  PTHADGTPHEMTRLATKFGE-RLARRFNLPVSFADERLTSLDAEARLRETGRNSKSAKPL 119

Query: 136 VDSIAAALILQEVLDR 151
           +D++AA LILQ   + 
Sbjct: 120 LDAVAAQLILQTWFES 135


>gi|17230592|ref|NP_487140.1| Holliday junction resolvase-like protein [Nostoc sp. PCC 7120]
 gi|75910008|ref|YP_324304.1| Holliday junction resolvase-like protein [Anabaena variabilis ATCC
           29413]
 gi|32130049|sp|Q8YSI5|RUVX_ANASP RecName: Full=Putative Holliday junction resolvase
 gi|146325551|sp|Q3M6H7|RUVX_ANAVT RecName: Full=Putative Holliday junction resolvase
 gi|17132194|dbj|BAB74799.1| alr3100 [Nostoc sp. PCC 7120]
 gi|75703733|gb|ABA23409.1| Holliday junction resolvase YqgF [Anabaena variabilis ATCC 29413]
          Length = 151

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 40/131 (30%), Positives = 68/131 (51%), Gaps = 1/131 (0%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
             +D+G KR+G+A  D     A     + R    +   ++ + +    +   ++GLP +M
Sbjct: 8   LGLDVGRKRVGVAGCDRTGLIATGITTVERTSFDRDVQQIQNIVNERQVQVLVVGLPYSM 67

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +GS G +    + F    + + + +P  + DERLT+  A+Q+LI  NVS  +    +D  
Sbjct: 68  DGSLGFQARQVQKFTS-RLAKALQLPVEYVDERLTSFQAEQMLIAENVSPSRNKGLIDRK 126

Query: 140 AAALILQEVLD 150
           AAALILQ+ LD
Sbjct: 127 AAALILQQWLD 137


>gi|293400452|ref|ZP_06644597.1| putative Holliday junction resolvase [Erysipelotrichaceae bacterium
           5_2_54FAA]
 gi|291305478|gb|EFE46722.1| putative Holliday junction resolvase [Erysipelotrichaceae bacterium
           5_2_54FAA]
          Length = 140

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 74/137 (54%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK--KVTQTALELLSFITTENIAAFIIG 74
             I  +DLG++ +G+++SD     A P   +  +         ++  +I    +   ++G
Sbjct: 1   MRILGLDLGSRTLGVSVSDALGMIARPVETIRFEQDDYDSALTQIKKYIDEFQVKKAVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP +MNG  G R   +  F   +    + V  + WDERLTTV+A++ILI  +VSRKKR +
Sbjct: 61  LPKHMNGDVGIRGEISIMFKEKL--ETLGVEVILWDERLTTVAAERILISADVSRKKRKK 118

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA  ILQ  LDR
Sbjct: 119 VIDQMAAVQILQGYLDR 135


>gi|260912123|ref|ZP_05918679.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260633729|gb|EEX51863.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 138

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/140 (27%), Positives = 65/140 (46%), Gaps = 5/140 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I S+D G KR G+A++DP +   +    +    +    L+   +I  E +   ++G 
Sbjct: 1   MARILSVDYGKKRTGIAVTDPLQIICNGLVTVSSSTLVDFLLD---YIQKEEVELIVVGE 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P   NG     +   + FV         +P V++DER T+V A + +ID  + +K R   
Sbjct: 58  PKQTNGQPSENLERVKQFVARWKKVCPTIPIVYYDERFTSVLAHRAMIDGGLKKKARQDK 117

Query: 134 QKVDSIAAALILQEVLDRIS 153
             VD I+A +ILQ  L+   
Sbjct: 118 ALVDEISATIILQSYLESKR 137


>gi|126434972|ref|YP_001070663.1| Holliday junction resolvase-like protein [Mycobacterium sp. JLS]
 gi|167012736|sp|A3PZ45|RUVX_MYCSJ RecName: Full=Putative Holliday junction resolvase
 gi|126234772|gb|ABN98172.1| Holliday junction resolvase YqgF [Mycobacterium sp. JLS]
          Length = 169

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/141 (31%), Positives = 62/141 (43%), Gaps = 1/141 (0%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV-TQTALELLSFITTENIAAFI 72
                   ID+G  R+G+A SDP    A P   + R+K   +    L   +T       +
Sbjct: 17  PGRGRRIGIDVGCVRVGVATSDPDGVLATPVETVRREKSSDRHVRRLAQLVTELEAVEVV 76

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLP  +    GP  H        +  R   VP    DERLTTVSAQ+ L +  V  K +
Sbjct: 77  VGLPRTLADRTGPAAHDAIDVAEALARRIAPVPVRMADERLTTVSAQRSLREAGVRAKGQ 136

Query: 133 IQKVDSIAAALILQEVLDRIS 153
              +D +AA  ILQ  LD+  
Sbjct: 137 RAMIDQVAAVGILQSWLDQRR 157


>gi|70733116|ref|YP_262889.1| Holliday junction resolvase-like protein [Pseudomonas fluorescens
           Pf-5]
 gi|146325591|sp|Q4K4E4|RUVX_PSEF5 RecName: Full=Putative Holliday junction resolvase
 gi|68347415|gb|AAY95021.1| conserved hypothetical protein TIGR00250 [Pseudomonas fluorescens
           Pf-5]
          Length = 145

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/138 (32%), Positives = 63/138 (45%), Gaps = 2/138 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I   D GTK+IG+A+       A     L  +       ++ + I      A ++GLPLN
Sbjct: 6   ILGFDYGTKQIGVAVGQAITGQARELCTLKAQNGVPDWNQVEALIKEWKPDAVVVGLPLN 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQ-QILIDMNVSRKKRIQKVD 137
           M+GS          F    ++ +  VPF   DERLTT  A+ + L         R   VD
Sbjct: 66  MDGSPSDMCVRAEKFAR-RLNGRFNVPFYTHDERLTTFEAKGERLARGGQKGSYRDNPVD 124

Query: 138 SIAAALILQEVLDRISFL 155
           +IAAAL+LQ  LD  + L
Sbjct: 125 AIAAALLLQGWLDENAGL 142


>gi|167855791|ref|ZP_02478544.1| Holliday junction resolvase-like protein [Haemophilus parasuis
           29755]
 gi|167853070|gb|EDS24331.1| Holliday junction resolvase-like protein [Haemophilus parasuis
           29755]
          Length = 138

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/138 (26%), Positives = 62/138 (44%), Gaps = 1/138 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +Q + + D GT  IG A+       A        +       ++   I        ++GL
Sbjct: 2   SQTVLAFDFGTNSIGCAVGQSITGTAQGLSAFKAQDGIPNWEQIGKVIAQWQPDLLVVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     + F    ++ +  +P    DERLTTV A+  +      +  +  K
Sbjct: 62  PLNMDGTEQPLTQRAKKFAK-RLNGRFNLPVELQDERLTTVEAKSEIFTRGGFKALKKGK 120

Query: 136 VDSIAAALILQEVLDRIS 153
           VD+I+A LIL+   ++ S
Sbjct: 121 VDAISACLILESWFEQQS 138


>gi|116494331|ref|YP_806065.1| Holliday junction resolvase-like protein [Lactobacillus casei ATCC
           334]
 gi|191637663|ref|YP_001986829.1| Holliday junction resolvase-like protein [Lactobacillus casei BL23]
 gi|227534480|ref|ZP_03964529.1| crossover junction endodeoxyribonuclease [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
 gi|239629714|ref|ZP_04672745.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|301065842|ref|YP_003787865.1| RNase H-like ribonuclease [Lactobacillus casei str. Zhang]
 gi|122264241|sp|Q03AZ9|RUVX_LACC3 RecName: Full=Putative Holliday junction resolvase
 gi|226731624|sp|B3WC70|RUVX_LACCB RecName: Full=Putative Holliday junction resolvase
 gi|116104481|gb|ABJ69623.1| RNase H-like ribonuclease [Lactobacillus casei ATCC 334]
 gi|190711965|emb|CAQ65971.1| Putative Holliday junction resolvase [Lactobacillus casei BL23]
 gi|227187879|gb|EEI67946.1| crossover junction endodeoxyribonuclease [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
 gi|239528400|gb|EEQ67401.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|300438249|gb|ADK18015.1| RNase H-like ribonuclease [Lactobacillus casei str. Zhang]
 gi|327381721|gb|AEA53197.1| Putative Holliday junction resolvase [Lactobacillus casei LC2W]
 gi|327384886|gb|AEA56360.1| Putative Holliday junction resolvase [Lactobacillus casei BD-II]
          Length = 144

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 46/137 (33%), Positives = 76/137 (55%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIG 74
             +  +D+G++ +G+A+SDP    A     +   +  +      L   +    + AF++G
Sbjct: 1   MRLMGLDVGSRTVGVAVSDPLGWTAQGLEIIRINEDKEQFGIARLKELVKQYEVTAFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN S GPR   ++A+   ++     +P  F DERLTTV A ++LI+  + SRK++ 
Sbjct: 61  LPKNMNNSIGPRAEKSQAYGE-LLKTTFGLPVDFIDERLTTVEASRMLIEEADASRKRQK 119

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D +AA +ILQ  LD
Sbjct: 120 QVIDKLAAQMILQNYLD 136


>gi|116510965|ref|YP_808181.1| RNase H-like ribonuclease [Lactococcus lactis subsp. cremoris SK11]
 gi|123125957|sp|Q032W3|RUVX_LACLS RecName: Full=Putative Holliday junction resolvase
 gi|116106619|gb|ABJ71759.1| RNase H-like ribonuclease [Lactococcus lactis subsp. cremoris SK11]
          Length = 143

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/135 (33%), Positives = 68/135 (50%), Gaps = 3/135 (2%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGL 75
            I  +D+GTK +G+++SD     A P   +             L   I        ++GL
Sbjct: 4   RILGLDVGTKTVGVSVSDLLGMTAQPVETIKIDSEAGELGFDRLAVLIKEYKPEKVVLGL 63

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P +MNG EG R  ++R +    +  +  +   + DERLTT  A+++LID  V RK R + 
Sbjct: 64  PKHMNGDEGIRAEASRDYG-TKLANEFSLEVAYQDERLTTAQAEKVLIDGGVRRKDRKKS 122

Query: 136 VDSIAAALILQEVLD 150
           +D +AA LILQ  LD
Sbjct: 123 IDKLAAVLILQNYLD 137


>gi|307702671|ref|ZP_07639623.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037]
 gi|307623787|gb|EFO02772.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037]
          Length = 136

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 47/135 (34%), Positives = 78/135 (57%), Gaps = 4/135 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIGLPL 77
             +D+G+K +G+AISDP    A     +   +         +   +    +  F++GLP 
Sbjct: 1   MGLDVGSKTVGVAISDPLGFTAQGLEIIQINEDQGQFGFDRIKELVDIYKVERFVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN + GPRV +++A+    ++    +P  + DERLTTV+A+++LI+  ++SR KR + +
Sbjct: 61  NMNNTSGPRVEASQAYGA-KLEELFGLPVDYQDERLTTVAAERMLIEQADISRNKRKKVI 119

Query: 137 DSIAAALILQEVLDR 151
           D +AA LILQ  LDR
Sbjct: 120 DKLAAQLILQNYLDR 134


>gi|46014949|pdb|1NU0|A Chain A, Structure Of The Double Mutant (L6m; F134m, Semet Form) Of
           Yqgf From Escherichia Coli, A Hypothetical Protein
 gi|46014950|pdb|1NU0|B Chain B, Structure Of The Double Mutant (L6m; F134m, Semet Form) Of
           Yqgf From Escherichia Coli, A Hypothetical Protein
          Length = 138

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 62/136 (45%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+A+       A P P +  +  T     +   +        I+GL
Sbjct: 2   SGTLXAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLN +G+E P     R F +  I  +  V     DERL+TV A+  L +    R     K
Sbjct: 62  PLNXDGTEQPLTARARKFAN-RIHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGK 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESYXEQ 136


>gi|167770376|ref|ZP_02442429.1| hypothetical protein ANACOL_01719 [Anaerotruncus colihominis DSM
           17241]
 gi|167667383|gb|EDS11513.1| hypothetical protein ANACOL_01719 [Anaerotruncus colihominis DSM
           17241]
          Length = 142

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 47/138 (34%), Positives = 66/138 (47%), Gaps = 1/138 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I ++D G  R GLA  D     A P   L  K       ++ +  +  ++   I+G P
Sbjct: 1   MKILAVDFGDARTGLACCDRTEYLASPIGVLHDKDFGSVLQKVAAAASEYDVQEIIVGHP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           +NMNG+EGPR      F    + + V VP   WDER TTVSA   L   N   KKR + +
Sbjct: 61  INMNGTEGPRAQLCADFAG-QLAKLVTVPVRLWDERGTTVSATGFLNATNTRGKKRKEVI 119

Query: 137 DSIAAALILQEVLDRISF 154
           D +AA +IL+  L+    
Sbjct: 120 DEVAATIILESYLNYRRN 137


>gi|317122056|ref|YP_004102059.1| Holliday junction resolvase YqgF [Thermaerobacter marianensis DSM
           12885]
 gi|315592036|gb|ADU51332.1| Holliday junction resolvase YqgF [Thermaerobacter marianensis DSM
           12885]
          Length = 326

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 44/144 (30%), Positives = 72/144 (50%), Gaps = 1/144 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
                +DLG++ IG+AISDP    A P   L R+   + A ++   +        ++G P
Sbjct: 1   MRWLGLDLGSRVIGVAISDPEGIVARPLGSLPRRTDAENAAQVADLVRRHGAGGVVVGWP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
             ++G+ GP   +   F   + +  V      WDERL+TV A+++LI  ++SR++R Q +
Sbjct: 61  RRLDGTRGPEAEAAERFADALREAGVPR-VTLWDERLSTVEAERVLIAADLSRRRRKQII 119

Query: 137 DSIAAALILQEVLDRISFLESSKG 160
           D +AA +ILQ  L          G
Sbjct: 120 DRMAATVILQAFLQSQRRQRDGGG 143


>gi|257465328|ref|ZP_05629699.1| Holliday junction resolvase-like protein [Actinobacillus minor 202]
 gi|257450988|gb|EEV25031.1| Holliday junction resolvase-like protein [Actinobacillus minor 202]
          Length = 140

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/135 (26%), Positives = 61/135 (45%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + + + D GT  IG A+       A   P    +       ++   I        ++GLP
Sbjct: 3   KTVLAFDFGTYSIGCAVGQSITGTAQGLPAFKAQDGIPDWAQIEKVIQEWQPDVLVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+G+E P     + F +  ++ +  +P    DERLTTV A+  +      +  +  KV
Sbjct: 63  LNMDGTEQPLTQRAKKFAN-RLNGRFNLPVELQDERLTTVEAKAEIFSRGGYKALKKGKV 121

Query: 137 DSIAAALILQEVLDR 151
           D+I+A LIL+   + 
Sbjct: 122 DAISACLILESWFEN 136


>gi|270290966|ref|ZP_06197189.1| conserved hypothetical protein [Pediococcus acidilactici 7_4]
 gi|304385235|ref|ZP_07367580.1| crossover junction endodeoxyribonuclease [Pediococcus acidilactici
           DSM 20284]
 gi|270280362|gb|EFA26197.1| conserved hypothetical protein [Pediococcus acidilactici 7_4]
 gi|304328442|gb|EFL95663.1| crossover junction endodeoxyribonuclease [Pediococcus acidilactici
           DSM 20284]
          Length = 146

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/137 (32%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             +  +D+G++ +G+A+SD     A     +     +       +   ++   +A F+IG
Sbjct: 1   MRLMGMDVGSRTVGIAVSDQLGWTAQGVEIIPINEDEGEFGISRVKELVSQYEVAGFVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN +EGPRV + R +   ++     +P  F DERLTTV A+++LI+  + SR KR 
Sbjct: 61  LPKNMNNTEGPRVEAARNYGK-LLTETFGLPIDFQDERLTTVEAERMLIEQADTSRSKRK 119

Query: 134 QKVDSIAAALILQEVLD 150
           + +D +AA+LIL+  L+
Sbjct: 120 KVIDKLAASLILENYLN 136


>gi|317049426|ref|YP_004117074.1| Holliday junction resolvase YqgF [Pantoea sp. At-9b]
 gi|316951043|gb|ADU70518.1| Holliday junction resolvase YqgF [Pantoea sp. At-9b]
          Length = 138

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 38/133 (28%), Positives = 59/133 (44%), Gaps = 1/133 (0%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPL 77
            +   D GTK IG+A+       A     L  +  T    ++   +        ++GLPL
Sbjct: 5   TLLGFDFGTKSIGVAVGQQLTGTARALTALKAQDGTPDWGQIERLLKEWQPDYVVVGLPL 64

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NM+GSE       R F +  +  +  V     DERL+TV A+  L +    R  +   VD
Sbjct: 65  NMDGSEQELTARARKFAN-RLHGRFGVRVELQDERLSTVEARAGLFERGGYRALQKGAVD 123

Query: 138 SIAAALILQEVLD 150
           S +A +IL++  D
Sbjct: 124 SQSAVIILEDWFD 136


>gi|188582759|ref|YP_001926204.1| Holliday junction resolvase YqgF [Methylobacterium populi BJ001]
 gi|179346257|gb|ACB81669.1| Holliday junction resolvase YqgF [Methylobacterium populi BJ001]
          Length = 165

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 87/150 (58%), Gaps = 1/150 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+   I    ++ +    +  +DLGTK IG+A+SD GR+ A P   + R K T  A  ++
Sbjct: 1   MNRDEIAAFAEASRGAPRLIGLDLGTKTIGIALSDVGRQIASPLETIRRVKFTPDAGRIV 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           +      +   +IGLPLNM+GSEGPR  S+R+F  N+         +F+DERL+T +  +
Sbjct: 61  ALCAAHGVGGLVIGLPLNMDGSEGPRAQSSRSFARNLRPLLPLP-VLFFDERLSTAAVTR 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLD 150
            L++ + SR +R + VD +AAA ILQ  LD
Sbjct: 120 TLLEADASRARRGEVVDKLAAAYILQSCLD 149


>gi|314936268|ref|ZP_07843615.1| putative Holliday junction resolvase [Staphylococcus hominis subsp.
           hominis C80]
 gi|313654887|gb|EFS18632.1| putative Holliday junction resolvase [Staphylococcus hominis subsp.
           hominis C80]
          Length = 142

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 46/139 (33%), Positives = 76/139 (54%), Gaps = 2/139 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFII 73
              I  +D+G++ +G+AISD     A     L    +        L+S I   N+ + +I
Sbjct: 3   RHKILGLDVGSRTVGIAISDLMGWTAQGLDTLRINEENEEFGIDRLVSIIKDNNVGSVVI 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NMN S G R  ++  +   + +    +  + WDERL+T++A++ L++ +VSR+KR 
Sbjct: 63  GLPKNMNNSIGFRGEASLKYKELLQEALPNIEIIMWDERLSTMAAERSLLEADVSRQKRK 122

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA  ILQ  LD I
Sbjct: 123 KVIDKMAAVFILQGYLDSI 141


>gi|194098916|ref|YP_002001981.1| Holliday junction resolvase-like protein [Neisseria gonorrhoeae
           NCCP11945]
 gi|239999198|ref|ZP_04719122.1| Holliday junction resolvase-like protein [Neisseria gonorrhoeae
           35/02]
 gi|240013895|ref|ZP_04720808.1| Holliday junction resolvase-like protein [Neisseria gonorrhoeae
           DGI18]
 gi|240016336|ref|ZP_04722876.1| Holliday junction resolvase-like protein [Neisseria gonorrhoeae
           FA6140]
 gi|240080456|ref|ZP_04724999.1| Holliday junction resolvase-like protein [Neisseria gonorrhoeae
           FA19]
 gi|240113174|ref|ZP_04727664.1| Holliday junction resolvase-like protein [Neisseria gonorrhoeae
           MS11]
 gi|240115933|ref|ZP_04729995.1| Holliday junction resolvase-like protein [Neisseria gonorrhoeae
           PID18]
 gi|240118230|ref|ZP_04732292.1| Holliday junction resolvase-like protein [Neisseria gonorrhoeae
           PID1]
 gi|240121464|ref|ZP_04734426.1| Holliday junction resolvase-like protein [Neisseria gonorrhoeae
           PID24-1]
 gi|240123779|ref|ZP_04736735.1| Holliday junction resolvase-like protein [Neisseria gonorrhoeae
           PID332]
 gi|240125968|ref|ZP_04738854.1| Holliday junction resolvase-like protein [Neisseria gonorrhoeae
           SK-92-679]
 gi|240128482|ref|ZP_04741143.1| Holliday junction resolvase-like protein [Neisseria gonorrhoeae
           SK-93-1035]
 gi|254493967|ref|ZP_05107138.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|260440253|ref|ZP_05794069.1| Holliday junction resolvase-like protein [Neisseria gonorrhoeae
           DGI2]
 gi|268595026|ref|ZP_06129193.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268596594|ref|ZP_06130761.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268599255|ref|ZP_06133422.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268601602|ref|ZP_06135769.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268603941|ref|ZP_06138108.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268682404|ref|ZP_06149266.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268684562|ref|ZP_06151424.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268686872|ref|ZP_06153734.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291043546|ref|ZP_06569262.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|193934206|gb|ACF30030.1| Putative Holliday junction resolvase [Neisseria gonorrhoeae
           NCCP11945]
 gi|226513007|gb|EEH62352.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268548415|gb|EEZ43833.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268550382|gb|EEZ45401.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268583386|gb|EEZ48062.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268585733|gb|EEZ50409.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268588072|gb|EEZ52748.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268622688|gb|EEZ55088.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268624846|gb|EEZ57246.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268627156|gb|EEZ59556.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291012009|gb|EFE03998.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|317164485|gb|ADV08026.1| Holliday junction resolvase-like protein [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 151

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 64/136 (47%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P     + D G  RIG+A  D     +HP   +      +    +   +       F++G
Sbjct: 5   PKGTALAFDFGEARIGVAQGDAELGLSHPLATVTGGSNDEKFAAIAKLVQEWQPRYFVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+E    H +R F    ++ +  +P  + DERL++V A+ +L +  V  KKR  
Sbjct: 65  LPVHADGTEHEMTHLSRKFGR-RLNGRFNLPVYWVDERLSSVYAESLLSEAQVLGKKRKS 123

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA  IL   L+
Sbjct: 124 VLDQVAAQAILHGFLE 139


>gi|317131029|ref|YP_004090343.1| Holliday junction resolvase YqgF [Ethanoligenens harbinense YUAN-3]
 gi|315469008|gb|ADU25612.1| Holliday junction resolvase YqgF [Ethanoligenens harbinense YUAN-3]
          Length = 143

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 46/143 (32%), Positives = 70/143 (48%), Gaps = 1/143 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             + ++D G  R G+A+SDP    A P   +     TQ   +    +        ++GLP
Sbjct: 1   MKVMAVDYGDARTGIALSDPSGFLASPVCVIHETDETQILAKTAEQVARTGAERVVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR    +AF    ++    VP + +DER TT++AQ      N   KKR   +
Sbjct: 61  KNMNGTLGPRAEKAQAFAK-ALEAACGVPVLLFDERRTTLTAQVYFNATNTRGKKRKNSI 119

Query: 137 DSIAAALILQEVLDRISFLESSK 159
           D+ AA +ILQ+ LD +    + K
Sbjct: 120 DAAAATIILQDYLDSVRNTPNGK 142


>gi|323525007|ref|YP_004227160.1| Holliday junction resolvase YqgF [Burkholderia sp. CCGE1001]
 gi|323382009|gb|ADX54100.1| Holliday junction resolvase YqgF [Burkholderia sp. CCGE1001]
          Length = 146

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 65/139 (46%), Gaps = 5/139 (3%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
               + + D G KRIG+A+ +   R A     +  +       EL   I      A ++G
Sbjct: 7   REATLLAFDYGEKRIGVAVGNSLTRSARALVVVQNRSREYRFAELGKLIAQWKPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+        + F +  ++ +  +P  + DER ++V A+  L       K R  
Sbjct: 67  LPMHPDGTPHEMTQLAKRFGN-QLNGRFNLPVTWVDERYSSVEAEATLRAN----KGRAD 121

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D+ AA++ILQ+ LD +S
Sbjct: 122 MLDAEAASVILQQYLDGLS 140


>gi|221632739|ref|YP_002521960.1| hypothetical protein trd_0729 [Thermomicrobium roseum DSM 5159]
 gi|221156262|gb|ACM05389.1| conserved hypothetical protein TIGR00250 [Thermomicrobium roseum
           DSM 5159]
          Length = 161

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 49/144 (34%), Positives = 77/144 (53%), Gaps = 3/144 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
                +D+G +R+G+AISD     A P   +   +       L+  I+  +    ++GLP
Sbjct: 7   GRTMGLDVGGRRVGVAISDEMGMIASPLATIDLDRDG--LERLVELISRYDPVLIVVGLP 64

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           + M G EG +   T+AF    +  ++  P VFWDERLT+ +A+++L D  V RK+R + V
Sbjct: 65  VTMRGREGSQAVETKAFAA-RLAERIDRPIVFWDERLTSSAAERLLTDAGVGRKRRRELV 123

Query: 137 DSIAAALILQEVLDRISFLESSKG 160
           D++AAAL+LQ  LD         G
Sbjct: 124 DAVAAALLLQSYLDAQRSQRGRHG 147


>gi|225848600|ref|YP_002728763.1| hypothetical protein SULAZ_0781 [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644154|gb|ACN99204.1| conserved hypothetical protein [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 138

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 47/141 (33%), Positives = 75/141 (53%), Gaps = 3/141 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I ++D+GTKRIG+A+SDP    A P  ++  K        + S I ++N++  +IGL
Sbjct: 1   MSRILALDIGTKRIGVAVSDPLGITAKPLDYI--KNDDNVFQNIKSLIESQNVSTVVIGL 58

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P+ + G +G +V  T+ F   +     ++  VF DER TT  A++ L      +K     
Sbjct: 59  PITLKGLQGQQVEYTKEFAEKLKHYIPHINIVFIDERFTTSLAEKHLSQT-KKKKNIKDY 117

Query: 136 VDSIAAALILQEVLDRISFLE 156
           +DS++A  ILQ  LD +SF  
Sbjct: 118 IDSLSAVFILQTYLDSLSFGR 138


>gi|217967412|ref|YP_002352918.1| Holliday junction resolvase YqgF [Dictyoglomus turgidum DSM 6724]
 gi|226725514|sp|B8E227|RUVX_DICTD RecName: Full=Putative Holliday junction resolvase
 gi|217336511|gb|ACK42304.1| Holliday junction resolvase YqgF [Dictyoglomus turgidum DSM 6724]
          Length = 141

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 43/137 (31%), Positives = 67/137 (48%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             + +ID G K IGLAISDP R  A        K        L   I   N++  ++G P
Sbjct: 1   MRVLAIDWGEKYIGLAISDPLRIIAQGLDVWEIKDEEDFVNRLKKLIKEYNVSEIVLGYP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           +++ G E  +           I   V +P  F DER TT+ A+++L++ ++ R+ R    
Sbjct: 61  ISLRGHENEKTKKIEYVAE-RIKTVVNLPIKFVDERFTTMEAERVLLEGDIKRRDRKLLK 119

Query: 137 DSIAAALILQEVLDRIS 153
           +  AA +ILQ+ LD +S
Sbjct: 120 NKQAAVIILQKYLDSLS 136


>gi|227538919|ref|ZP_03968968.1| Holliday junction resolvase family protein [Sphingobacterium
           spiritivorum ATCC 33300]
 gi|227241122|gb|EEI91137.1| Holliday junction resolvase family protein [Sphingobacterium
           spiritivorum ATCC 33300]
          Length = 138

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 70/141 (49%), Gaps = 5/141 (3%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             + + D GTKRIG+A++DP +  A+    +      +    L +++ TE +  F++G P
Sbjct: 1   MRLMAFDYGTKRIGIAVTDPLQIVANALTTVH---PNEIFDFLKNYLQTEQVETFVVGKP 57

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--IQ 134
             M+GS+         F+  +  +   +P    DER T+  A  ++    + + KR    
Sbjct: 58  RQMDGSDSESASHVVGFIRLLKKQFPTIPVAEVDERFTSKMASAVIAQSGMKKGKRQQKG 117

Query: 135 KVDSIAAALILQEVLDRISFL 155
            VD+I+A +ILQ  +D  SFL
Sbjct: 118 LVDTISATIILQSYMDSRSFL 138


>gi|90962084|ref|YP_536000.1| Holliday junction resolvase-like protein [Lactobacillus salivarius
           UCC118]
 gi|90821278|gb|ABD99917.1| Endonuclease involved in recombination [Lactobacillus salivarius
           UCC118]
          Length = 143

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 46/134 (34%), Positives = 78/134 (58%), Gaps = 4/134 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIGLPL 77
             +D+G++ +G+A+SD     A     +   +  Q      +   +    +  F++GLP 
Sbjct: 1   MGLDVGSRTVGVAVSDMLGWTAQGVEIVQINEDEQEFGLDRIAELVKENEVVGFVLGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN + GPRV + +A+   +++ K  +P  F DERLTTV A+++L++  + SRKKR + +
Sbjct: 61  NMNNTSGPRVEAAKAYGE-LLEEKFNLPIDFIDERLTTVEAERMLVEQADASRKKRKKVI 119

Query: 137 DSIAAALILQEVLD 150
           D +AA+LILQ  LD
Sbjct: 120 DKLAASLILQNYLD 133


>gi|260591630|ref|ZP_05857088.1| putative Holliday junction resolvase [Prevotella veroralis F0319]
 gi|260536430|gb|EEX19047.1| putative Holliday junction resolvase [Prevotella veroralis F0319]
          Length = 139

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 63/137 (45%), Gaps = 6/137 (4%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR GLA++DP R  A+    +    +         ++  E +   +IG 
Sbjct: 1   MGRILAIDYGKKRTGLAVTDPLRIIANGLATIPTSDIFDYLT---QYVAKEPVDQLVIGK 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--- 132
           P+  NG     +     FV+        +P  ++DER T+V A Q +I   V +K R   
Sbjct: 58  PIQPNGQPSENLARVENFVNRWRKLHPEMPIDYYDERFTSVIAHQAMIAGGVKKKTRRED 117

Query: 133 IQKVDSIAAALILQEVL 149
              VD I+A +ILQ+ +
Sbjct: 118 KGLVDEISATIILQDYM 134


>gi|242373916|ref|ZP_04819490.1| crossover junction endodeoxyribonuclease [Staphylococcus
           epidermidis M23864:W1]
 gi|242348470|gb|EES40072.1| crossover junction endodeoxyribonuclease [Staphylococcus
           epidermidis M23864:W1]
          Length = 142

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/139 (32%), Positives = 74/139 (53%), Gaps = 2/139 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFII 73
              I  +D+G+K +G+AISD     A     L   +        +L+  I    +   +I
Sbjct: 3   KHKIIGLDVGSKTVGIAISDLMGWTAQGLDTLRINEEQNELGIEKLVEIIQDNQVGTVVI 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NMN S G R  ++  +   + +    +  + WDERL+T++A++ L++ +VSR+KR 
Sbjct: 63  GLPKNMNNSIGFRGEASLQYKEKLQEALPSIEIIMWDERLSTMAAERSLLEADVSRQKRK 122

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA  ILQ  LD I
Sbjct: 123 KVIDKMAAVFILQGYLDSI 141


>gi|59801001|ref|YP_207713.1| Holliday junction resolvase-like protein [Neisseria gonorrhoeae FA
           1090]
 gi|293398863|ref|ZP_06643028.1| conserved hypothetical protein [Neisseria gonorrhoeae F62]
 gi|62900896|sp|Q5F936|RUVX_NEIG1 RecName: Full=Putative Holliday junction resolvase
 gi|59717896|gb|AAW89301.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|291610277|gb|EFF39387.1| conserved hypothetical protein [Neisseria gonorrhoeae F62]
          Length = 151

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 64/136 (47%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P     + D G  RIG+A  D     +HP   +      +    +   +       F++G
Sbjct: 5   PKGTALAFDFGEARIGVAQGDAELGLSHPLATVTGGSNDEKFAAIAKLVQEWQPRYFVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+E    H +R F    ++ +  +P  + DERL++V A+ +L +  V  KKR  
Sbjct: 65  LPVHADGTEHEMTHLSRKFGR-RLNGRFNLPVYWVDERLSSVCAESLLSEAQVLGKKRKS 123

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA  IL   L+
Sbjct: 124 VLDQVAAQAILHGFLE 139


>gi|242242890|ref|ZP_04797335.1| crossover junction endodeoxyribonuclease [Staphylococcus
           epidermidis W23144]
 gi|242233665|gb|EES35977.1| crossover junction endodeoxyribonuclease [Staphylococcus
           epidermidis W23144]
          Length = 142

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 46/139 (33%), Positives = 75/139 (53%), Gaps = 2/139 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFII 73
              I  +D+G+K +G+AISD     A     L   +  +     +L+  I    +   +I
Sbjct: 3   KHKILGLDVGSKTVGIAISDLMGWTAQGLDTLRINEEQEDLGIDQLVKIIKDNQVGTVVI 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NMN S G R  ++  +   + +    +  V WDERL+T++A++ L++ +VSR+KR 
Sbjct: 63  GLPKNMNNSIGFRGEASIKYKEKLQESVPSIDIVMWDERLSTMAAERSLLEADVSRQKRK 122

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA  ILQ  LD I
Sbjct: 123 KVIDKMAAVFILQGYLDSI 141


>gi|163785970|ref|ZP_02180418.1| Holliday junction resolvase-like protein [Flavobacteriales
           bacterium ALC-1]
 gi|159877830|gb|EDP71886.1| Holliday junction resolvase-like protein [Flavobacteriales
           bacterium ALC-1]
          Length = 137

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/140 (29%), Positives = 69/140 (49%), Gaps = 5/140 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID GTKR GLA++D  +  A     +  K++        +++ TE++  F++GL
Sbjct: 1   MGRILAIDYGTKRTGLAVTDEMQIIASGLTTVETKELVPFL---KNYVDTESVEKFVVGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  M+ +        + F+  +     ++P    DER T+  A Q +ID  + +K+R   
Sbjct: 58  PKQMDNTASESEVYIKKFLEILTKAIPHIPIERVDERFTSKMAFQTMIDSGLKKKQRQNK 117

Query: 134 QKVDSIAAALILQEVLDRIS 153
             +D I+A LILQ  L   S
Sbjct: 118 ALIDEISATLILQSYLTSQS 137


>gi|319892670|ref|YP_004149545.1| Putative Holliday junction resolvase [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317162366|gb|ADV05909.1| Putative Holliday junction resolvase [Staphylococcus
           pseudintermedius HKU10-03]
 gi|323464292|gb|ADX76445.1| Holliday junction resolvase, putative [Staphylococcus
           pseudintermedius ED99]
          Length = 142

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/140 (32%), Positives = 77/140 (55%), Gaps = 2/140 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPF--LVRKKVTQTALELLSFITTENIAAFII 73
              I  +D+G++ +G+AISD     A       +  ++       L+  I  EN+   +I
Sbjct: 3   KHKIIGLDVGSRTVGIAISDLMGWTAQGLDTLQINEEENELGIDALIDIIQKENVGTVVI 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NMN S G R  ++  +   + +R   +  + WDERL+T++A++ L++ +VSR KR 
Sbjct: 63  GLPKNMNNSIGFRGEASLKYKDALAERMPNLEIIMWDERLSTMAAERSLLEADVSRAKRK 122

Query: 134 QKVDSIAAALILQEVLDRIS 153
           + +D +AA  ILQ  LD ++
Sbjct: 123 KVIDKMAAVFILQGYLDGLN 142


>gi|28378868|ref|NP_785760.1| Holliday junction resolvase-like protein [Lactobacillus plantarum
           WCFS1]
 gi|254557074|ref|YP_003063491.1| Holliday junction resolvase-like protein [Lactobacillus plantarum
           JDM1]
 gi|300768026|ref|ZP_07077932.1| crossover junction endodeoxyribonuclease [Lactobacillus plantarum
           subsp. plantarum ATCC 14917]
 gi|308181068|ref|YP_003925196.1| Holliday junction resolvase-like protein [Lactobacillus plantarum
           subsp. plantarum ST-III]
 gi|32130018|sp|Q88V13|RUVX_LACPL RecName: Full=Putative Holliday junction resolvase
 gi|28271705|emb|CAD64611.1| endonuclease involved in recombination (putative) [Lactobacillus
           plantarum WCFS1]
 gi|254046001|gb|ACT62794.1| Holliday junction resolvase-like protein [Lactobacillus plantarum
           JDM1]
 gi|300494375|gb|EFK29537.1| crossover junction endodeoxyribonuclease [Lactobacillus plantarum
           subsp. plantarum ATCC 14917]
 gi|308046559|gb|ADN99102.1| Holliday junction resolvase-like protein [Lactobacillus plantarum
           subsp. plantarum ST-III]
          Length = 144

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/138 (32%), Positives = 77/138 (55%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKV--TQTALELLSFITTENIAAFIIG 74
             +  +D+G++ +G+AISD     A     +   +         +   +   +   F++G
Sbjct: 1   MKLMGLDVGSRTVGVAISDAFGWTAQGVEIIRINEDAEEFGIDRVAELVEELDAGGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPR  + + +   ++  + ++P  F DERLTTV A+++L++  N SRKKR 
Sbjct: 61  LPKNMNNTLGPRAEAAQHYGE-LLTARFHLPVDFEDERLTTVEAERMLVEEANTSRKKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA+LILQ  LDR
Sbjct: 120 KVIDKLAASLILQNYLDR 137


>gi|254414995|ref|ZP_05028758.1| conserved hypothetical protein TIGR00250 [Microcoleus
           chthonoplastes PCC 7420]
 gi|196178142|gb|EDX73143.1| conserved hypothetical protein TIGR00250 [Microcoleus
           chthonoplastes PCC 7420]
          Length = 136

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 65/134 (48%), Gaps = 1/134 (0%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
             +D+G+KRIG+A  D     A     + R    Q   +    +   ++   ++GLP +M
Sbjct: 1   MGLDVGSKRIGVAGCDGTGLIATGLTTIKRTSFEQDVSQFRELVEQRDVQVLVVGLPYSM 60

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           NG+ G +    + +    +   + +P  + DERLT+  A+Q+L    +S  +    +D  
Sbjct: 61  NGTLGFQARQVQKYAR-RLSAALQLPVEYVDERLTSFEAEQLLHAEKLSPSRHKALIDRK 119

Query: 140 AAALILQEVLDRIS 153
           AAA+ILQ+ LD   
Sbjct: 120 AAAIILQQWLDTRR 133


>gi|324999313|ref|ZP_08120425.1| Holliday junction resolvase-like protein [Pseudonocardia sp. P1]
          Length = 142

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/139 (28%), Positives = 64/139 (46%), Gaps = 2/139 (1%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK-KVTQTALELLSFITTENIAAFI 72
           +       +D+G  R+G+A+ DP    A P   + R  +       +   +   ++   +
Sbjct: 3   RTRGRRLGVDVGAVRVGVAMCDPDGILATPVETVPRDAEHGADVRRIAELVAEHDVVGVV 62

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLP N+ G +GP   + R F    +   + VP    DER+TTV A + L    V  +K+
Sbjct: 63  LGLPRNLRGEDGPAARAAREFAD-ALQAGLDVPVELTDERMTTVVAARQLSGRGVKGRKQ 121

Query: 133 IQKVDSIAAALILQEVLDR 151
              VD  AA  ILQ  LD+
Sbjct: 122 RSVVDQAAAVQILQGWLDQ 140


>gi|332535114|ref|ZP_08410924.1| putative holliday junction resolvase [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332035432|gb|EGI71930.1| putative holliday junction resolvase [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 149

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/144 (25%), Positives = 59/144 (40%), Gaps = 3/144 (2%)

Query: 10  VKSLKPNQ--PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTEN 67
            KSLKP     +   D GTK IG+AI       A     +  +        +   +    
Sbjct: 3   KKSLKPQGERTVMGFDFGTKSIGIAIGQELTGSASSLKAVKAQDGIPNWDHIAVQVAEWQ 62

Query: 68  IAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV 127
               ++GLPLNM+G+        + F +  +     +P    DERLTT  A+  L +   
Sbjct: 63  PDLMVVGLPLNMDGTSQEVTFKAKKFAN-RLHNHYGIPVQTQDERLTTADAKARLFESGG 121

Query: 128 SRKKRIQKVDSIAAALILQEVLDR 151
            +      VD+++A +IL+   + 
Sbjct: 122 YKNLGKGNVDNMSAVIILESFFES 145


>gi|313203125|ref|YP_004041782.1| holliday junction resolvase yqgf [Paludibacter propionicigenes WB4]
 gi|312442441|gb|ADQ78797.1| Holliday junction resolvase YqgF [Paludibacter propionicigenes WB4]
          Length = 139

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 43/142 (30%), Positives = 70/142 (49%), Gaps = 5/142 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR+GLA++D     A+    +   +V         +I  E +  F+IGL
Sbjct: 1   MGRILAIDYGQKRVGLAVTDMLHISANGLDTVSAHEVLTYLE---KYIAKEPVEKFVIGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MNG +   +   R F   +  +   +  V+ DER T+V A + +++  + +K R   
Sbjct: 58  PKQMNGQDSDSMQYIRPFATALQRKFPEIELVYVDERFTSVLAHKAMLEGGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISFL 155
           + VD I+A +ILQ  L+ I  L
Sbjct: 118 ELVDKISATIILQSYLESIYNL 139


>gi|94501646|ref|ZP_01308162.1| Holliday junction resolvase-like protein [Oceanobacter sp. RED65]
 gi|94426222|gb|EAT11214.1| Holliday junction resolvase-like protein [Oceanobacter sp. RED65]
          Length = 154

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 38/143 (26%), Positives = 59/143 (41%), Gaps = 1/143 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + +   D GTKR+G+A+     + A     +  K       +L + +       F++GLP
Sbjct: 11  KRVMGFDFGTKRMGVAMGQRLTQQAQGISCINAKDGKPNWEQLDALVEEWQPDGFVVGLP 70

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NM+GSE         F    +  +  +P    DERLTT  A+ I          +   V
Sbjct: 71  FNMDGSESDMSRRANKFSK-RLHGRYGLPSYTIDERLTTFEAKHIARQQGHKGHYKSDPV 129

Query: 137 DSIAAALILQEVLDRISFLESSK 159
           D +AA  IL+  L      E S+
Sbjct: 130 DELAAQFILETWLSEFPLSEQSQ 152


>gi|332972979|gb|EGK10919.1| crossover junction endodeoxyribonuclease [Kingella kingae ATCC
           23330]
          Length = 151

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/142 (25%), Positives = 64/142 (45%), Gaps = 1/142 (0%)

Query: 10  VKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIA 69
           +          + D G +RIG+A  +     AHP   +  +       ++   I     +
Sbjct: 1   MHKPPTQGSALAFDFGEQRIGVAQGEASIGIAHPLITITGQSNDDKFAQIAKQIQAWQPS 60

Query: 70  AFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR 129
             ++GLP +++G+E       R F   +  R   +P  + DERL++V A+++L    V  
Sbjct: 61  CLVVGLPSHLDGTEHEITQLARKFGRRLHGRFA-LPVYWVDERLSSVYAEELLRQAQVFG 119

Query: 130 KKRIQKVDSIAAALILQEVLDR 151
           +K+  K+D +AA  ILQ   D 
Sbjct: 120 RKQKAKLDQVAAQAILQSFFDS 141


>gi|119512614|ref|ZP_01631690.1| Holliday junction resolvase-like protein [Nodularia spumigena
           CCY9414]
 gi|119462747|gb|EAW43708.1| Holliday junction resolvase-like protein [Nodularia spumigena
           CCY9414]
          Length = 156

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 66/134 (49%), Gaps = 1/134 (0%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
             +D G KR+G+A  D     A     + R    +   ++ + +    +   +IGLP +M
Sbjct: 14  LGLDFGRKRMGVAGCDGTGLIATGLTTIERTSFERDVQQIRNIVDERQVQILVIGLPYSM 73

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +G+ G +    + F    + + + +P  + DERLT+  A+Q+LI  N S  +    +D  
Sbjct: 74  DGTLGFQARQVQKFAK-RLGKALNLPVEYIDERLTSFQAEQLLIAENRSPSRHKGLIDRK 132

Query: 140 AAALILQEVLDRIS 153
           AA++ILQ+ LD   
Sbjct: 133 AASIILQQWLDSRR 146


>gi|186680854|ref|YP_001864050.1| Holliday junction resolvase-like protein [Nostoc punctiforme PCC
           73102]
 gi|186463306|gb|ACC79107.1| Holliday junction resolvase YqgF [Nostoc punctiforme PCC 73102]
          Length = 158

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/131 (31%), Positives = 65/131 (49%), Gaps = 1/131 (0%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
             +D G KRIG+A  D     A     + R    Q   ++   +    +   ++GLP +M
Sbjct: 14  LGLDFGRKRIGVAGCDRTGLIATGITTIERTSFEQDVEQIRQIVNEREVQILVMGLPYSM 73

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           +GS G +    + F    + + + +P  + DERLT+  A+Q+LI  N S  +    +D  
Sbjct: 74  DGSIGFQARQVQKF-TTRLSKALKLPVEYVDERLTSFQAEQLLIAENRSPSRHKGLIDRK 132

Query: 140 AAALILQEVLD 150
           AAALILQ+ LD
Sbjct: 133 AAALILQQWLD 143


>gi|188995932|ref|YP_001930184.1| Holliday junction resolvase-like protein [Porphyromonas gingivalis
           ATCC 33277]
 gi|188595612|dbj|BAG34587.1| probable endonuclease [Porphyromonas gingivalis ATCC 33277]
          Length = 150

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/142 (27%), Positives = 66/142 (46%), Gaps = 5/142 (3%)

Query: 12  SLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAF 71
                  I +ID G KR GLA++DP +        +    +     +   +++ E +  F
Sbjct: 9   FCTDMGRILAIDYGRKRTGLAVTDPLKIIPGGLTTVPTHTLLDFLRD---YVSREPVERF 65

Query: 72  IIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           ++GLP  MN  E   +   R F   +      +P  + DER T+  AQ+ +++  + + K
Sbjct: 66  VLGLPRRMNYEESESMTYIRPFAVKLAQAFPSIPITYVDERFTSRMAQRTILEAGIGKMK 125

Query: 132 RIQK--VDSIAAALILQEVLDR 151
           R  K  VD ++A +ILQ  LD 
Sbjct: 126 RRDKALVDEVSAVIILQSYLDN 147


>gi|295675689|ref|YP_003604213.1| Holliday junction resolvase YqgF [Burkholderia sp. CCGE1002]
 gi|295435532|gb|ADG14702.1| Holliday junction resolvase YqgF [Burkholderia sp. CCGE1002]
          Length = 146

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 66/139 (47%), Gaps = 5/139 (3%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
               + + D G KRIG+A+ +   R A P   +  +        L   I      A ++G
Sbjct: 7   REATLLAFDYGVKRIGVAVGNSLTRRARPLVVVQNRSKEYRFEALGKLIAEWKPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+   R    + F +  ++ +  +P  + DER ++V A+  +   N     R  
Sbjct: 67  LPMHPDGTPHERTQLAKRFGN-QLNGRFNLPVTWVDERYSSVEAEAEIRAGN----ARAD 121

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D+ AA++ILQ+ LD +S
Sbjct: 122 MLDAEAASIILQQYLDELS 140


>gi|197284239|ref|YP_002150111.1| holliday junction resolvase [Proteus mirabilis HI4320]
 gi|226731639|sp|B4EUS0|RUVX_PROMH RecName: Full=Putative Holliday junction resolvase
 gi|194681726|emb|CAR40879.1| putative holliday junction resolvase [Proteus mirabilis HI4320]
          Length = 139

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/137 (27%), Positives = 58/137 (42%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            N+ +   D GTK IG AI       A P      K       ++   I        ++G
Sbjct: 2   SNRTVMGFDFGTKSIGAAIGQEVTGTARPLASFKAKDGIPDWSQIEKIIKEWQPDLVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPLNM+G+E       + F +  +  +  V     DERL+TV A+  L +    R     
Sbjct: 62  LPLNMDGTEQLVTTQAKKFAN-RLHGRFGVQIALHDERLSTVEARAHLFEQGGYRSLDKG 120

Query: 135 KVDSIAAALILQEVLDR 151
            VD+ +A +IL+   +R
Sbjct: 121 SVDATSAVIILESWFER 137


>gi|288802834|ref|ZP_06408271.1| Holliday junction resolvase [Prevotella melaninogenica D18]
 gi|288334651|gb|EFC73089.1| Holliday junction resolvase [Prevotella melaninogenica D18]
          Length = 139

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 65/137 (47%), Gaps = 6/137 (4%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR GLA++DP    A+    +   ++ +       +I  E ++  +IG 
Sbjct: 1   MSRILAIDYGKKRTGLAVTDPLCIIANGLATVPTSELFEFLN---QYIVKEAVSQLVIGK 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--- 132
           P+  NG     +     FV+        +P  ++DER T+V A Q +I   V +K R   
Sbjct: 58  PIQPNGQPSENLARVEQFVNRWRKAHPELPIDYYDERFTSVIAHQAMIAGGVKKKTRRED 117

Query: 133 IQKVDSIAAALILQEVL 149
              VD I+A +ILQ+ +
Sbjct: 118 KGLVDEISATIILQDYM 134


>gi|183596313|ref|ZP_02958341.1| hypothetical protein PROSTU_00048 [Providencia stuartii ATCC 25827]
 gi|188023917|gb|EDU61957.1| hypothetical protein PROSTU_00048 [Providencia stuartii ATCC 25827]
          Length = 139

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/137 (27%), Positives = 61/137 (44%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            ++ + + D GTK IG+A+       A     L          ++   +        I+G
Sbjct: 2   SSRTLLAFDFGTKSIGVAVGQEITGTARSLASLKANDGRPDWQQIEKLLKEWQPQLVIVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPLNM+G+E       R F +  I  +  V     DERL+TV+A+  L +    R     
Sbjct: 62  LPLNMDGTEQLVTSQARNFAN-RIHGRFGVKVELHDERLSTVAAKAELFERGGYRALSKG 120

Query: 135 KVDSIAAALILQEVLDR 151
           KVDS +A +IL+   ++
Sbjct: 121 KVDSASAVVILESWFEQ 137


>gi|261392384|emb|CAX49926.1| conserved hypothetical protein [Neisseria meningitidis 8013]
          Length = 151

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 62/136 (45%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P     + D G  RIG+A  D     +HP   +      +    +   +       F++G
Sbjct: 5   PKGTALAFDFGEARIGVAQGDAELGLSHPLSTVTGGSNDEKFAAIAKLVQEWQPRYFVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+E    H +R F    +  +  +P  + DERL++V A+ +L +  V  KKR  
Sbjct: 65  LPVHTDGTEHEMTHLSRKFGR-RLHGRFNLPVYWMDERLSSVYAESLLSEAQVFGKKRKS 123

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA  IL    +
Sbjct: 124 VLDQVAAQAILHGFFE 139


>gi|325265855|ref|ZP_08132541.1| crossover junction endodeoxyribonuclease [Kingella denitrificans
           ATCC 33394]
 gi|324982493|gb|EGC18119.1| crossover junction endodeoxyribonuclease [Kingella denitrificans
           ATCC 33394]
          Length = 159

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/142 (23%), Positives = 61/142 (42%), Gaps = 1/142 (0%)

Query: 10  VKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIA 69
           +  +       + D G  RIG+A  +     AHP   +      +   ++   I      
Sbjct: 1   MLEIPKQGCCLAFDFGKVRIGVAQGESSLHIAHPICTVSGAGNDEKFAKIAQLIKEWQPE 60

Query: 70  AFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR 129
             ++GLP +++G+E       R F    +  +   P  + DERL++V A+++L +  V  
Sbjct: 61  YLVVGLPTHIDGTEHEMTRLARQFGR-RLHGRFGKPVYWVDERLSSVYAEELLREAAVFG 119

Query: 130 KKRIQKVDSIAAALILQEVLDR 151
           KK+   +D +AA  IL    D 
Sbjct: 120 KKQKPVLDQVAAQAILHYFFDN 141


>gi|86157658|ref|YP_464443.1| Holliday junction resolvase-like protein [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|146325549|sp|Q2IQC1|RUVX_ANADE RecName: Full=Putative Holliday junction resolvase
 gi|85774169|gb|ABC81006.1| Holliday junction resolvase YqgF [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 137

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 46/137 (33%), Positives = 71/137 (51%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
                +DLG  RIGLA++D   R A     +VR+   +    +        +   ++GLP
Sbjct: 1   MRTLGVDLGRVRIGLAVADEILRTARAVTTVVRRGEAEDLAAIAEVARDYEVTRAVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+G+EGP     R F    ++  + VP   +DERL++  A+  L    VS + +  +V
Sbjct: 61  LNMDGTEGPSARLARGFA-PRLEAALGVPVELFDERLSSFEAESRLRARGVSARDQRGQV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D+ AAA+ILQ  LDR +
Sbjct: 120 DAEAAAVILQGWLDRRA 136


>gi|146312992|ref|YP_001178066.1| Holliday junction resolvase-like protein [Enterobacter sp. 638]
 gi|167012721|sp|A4WE85|RUVX_ENT38 RecName: Full=Putative Holliday junction resolvase
 gi|145319868|gb|ABP62015.1| Holliday junction resolvase YqgF [Enterobacter sp. 638]
          Length = 138

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 61/136 (44%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +  + + D GTK IG+AI       A P   +  +  T     +   +      A I+GL
Sbjct: 2   SGTLLAFDFGTKSIGVAIGQRITGTARPLTAIKAQDGTPDWTLIERLLKEWQPEAVIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +        DERL+TV A+  L +    R      
Sbjct: 62  PLNMDGTEQPLTARARKFAN-KIHGRFGAVVKLHDERLSTVEARAGLFEHGGFRALNKGS 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVIILESFFEQ 136


>gi|330812357|ref|YP_004356819.1| holliday junction resolvase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|32130065|sp|Q9F4I8|RUVX_PSEFL RecName: Full=Putative Holliday junction resolvase
 gi|10442817|gb|AAG15556.1| hypothetical protein [Pseudomonas fluorescens]
 gi|327380465|gb|AEA71815.1| putative holliday junction resolvase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 145

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/138 (30%), Positives = 64/138 (46%), Gaps = 2/138 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +   D GTK+IG+A+       A     L  +       ++ + I      A ++GLPLN
Sbjct: 6   LLGFDYGTKQIGVAVGQVITGQARELCTLKAQNGVPDWNQVEALIKEWKPDAVVVGLPLN 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQ-QILIDMNVSRKKRIQKVD 137
           M+G+          F    ++ +  +PF   DERLTT  A+ + L+        R   VD
Sbjct: 66  MDGTPSDMCLRAEKFAR-RLNGRYNLPFYTHDERLTTFEAKGERLVRGGQKGSYRDNPVD 124

Query: 138 SIAAALILQEVLDRISFL 155
           +IAAAL+LQ  LD  + L
Sbjct: 125 AIAAALLLQGWLDANAAL 142


>gi|167570975|ref|ZP_02363849.1| Holliday junction resolvase-like protein [Burkholderia oklahomensis
           C6786]
          Length = 146

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/147 (24%), Positives = 64/147 (43%), Gaps = 5/147 (3%)

Query: 11  KSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAA 70
            +L  +  + + D G KRIG+A+ +   R A     +           +   I      A
Sbjct: 3   AALSRDATLLAFDYGEKRIGVAVGNMLTRTARALVIVPNLNREHRFKAVGELIAEWKPDA 62

Query: 71  FIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRK 130
            ++GLPL+ +G+        + F +  ++ +  +P  + DER ++V A+  L     S  
Sbjct: 63  LVVGLPLHPDGAPHEMTQQAKRFGN-QLNGRFNLPVSWVDERYSSVEARADLRARG-SGA 120

Query: 131 KRIQKVDSIAAALILQEVLDRISFLES 157
            R   VD+ AA +ILQ+ LD +     
Sbjct: 121 DR---VDAEAARIILQQYLDELPDHHE 144


>gi|87120930|ref|ZP_01076822.1| hypothetical protein MED121_09985 [Marinomonas sp. MED121]
 gi|86163768|gb|EAQ65041.1| hypothetical protein MED121_09985 [Marinomonas sp. MED121]
          Length = 152

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/149 (24%), Positives = 62/149 (41%), Gaps = 3/149 (2%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+     D   +    + +   D GT RIG+A+       A P   +  +        + 
Sbjct: 1   MNATSTND--VNTNTARTLLGFDFGTTRIGIAVGQEITATATPINPIKARDGIPNWDTIA 58

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
             +       F++GLPLNM+G+E       R F +  +  +   P    DERL++  A+ 
Sbjct: 59  EVVKEWQPDGFVVGLPLNMDGTENEMCQRARKFAN-RLHGRYNKPSYMMDERLSSYEAKG 117

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVL 149
            +I    +R  +   VD +AA +IL+   
Sbjct: 118 QVIKEGGNRNFKANSVDGLAAQMILESWF 146


>gi|302346307|ref|YP_003814605.1| RNAse YqgF [Prevotella melaninogenica ATCC 25845]
 gi|302150718|gb|ADK96979.1| RNAse YqgF [Prevotella melaninogenica ATCC 25845]
          Length = 139

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 65/137 (47%), Gaps = 6/137 (4%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR GLA++DP    A+    +   ++ +       +I  E ++  +IG 
Sbjct: 1   MSRILAIDYGKKRTGLAVTDPLCIIANGLATVPTSELFEFLN---QYIAKEAVSQLVIGK 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--- 132
           P+  NG     +     FV+        +P  ++DER T+V A Q +I   V +K R   
Sbjct: 58  PIQPNGQPSENLARVEQFVNRWRKAHPELPIDYYDERFTSVIAHQAMIAGGVKKKTRRED 117

Query: 133 IQKVDSIAAALILQEVL 149
              VD I+A +ILQ+ +
Sbjct: 118 KGLVDEISATIILQDYM 134


>gi|295425853|ref|ZP_06818533.1| crossover junction endodeoxyribonuclease [Lactobacillus
           amylolyticus DSM 11664]
 gi|295064456|gb|EFG55384.1| crossover junction endodeoxyribonuclease [Lactobacillus
           amylolyticus DSM 11664]
          Length = 142

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 47/138 (34%), Positives = 75/138 (54%), Gaps = 5/138 (3%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+AISD     A     +     K       L   +   + A F++G
Sbjct: 1   MRLIGLDIGSKTVGVAISDELGITAQKLETIPIDESKFNFGMRPLKKIVREYDPAGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVS-RKKR 132
           LP NM+G+ G  V  ++A+    + +K  +P  + DERLTTV ++++L+ +  V  RKKR
Sbjct: 61  LPKNMDGTSGHSVDRSKAYGE-RLKKKFNLPVYYDDERLTTVESRRVLVEEAGVHDRKKR 119

Query: 133 IQKVDSIAAALILQEVLD 150
            Q +D +AA LILQ  LD
Sbjct: 120 KQVIDQMAAVLILQNYLD 137


>gi|116493009|ref|YP_804744.1| Holliday junction resolvase-like protein [Pediococcus pentosaceus
           ATCC 25745]
 gi|122265527|sp|Q03ES0|RUVX_PEDPA RecName: Full=Putative Holliday junction resolvase
 gi|116103159|gb|ABJ68302.1| RNase H-like ribonuclease [Pediococcus pentosaceus ATCC 25745]
          Length = 146

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/137 (30%), Positives = 78/137 (56%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIG 74
             +  +D+G++ +G+++SD     A     +   +  +      +   +   ++  F++G
Sbjct: 1   MRLMGMDVGSRTVGISVSDQLGWTAQGVEIVPINEDEEIFGIERVKELVKEYDVVGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN +EGPRV + R +   +++    +P  F DERLTTV A+++LI+  + SR KR 
Sbjct: 61  LPKNMNNTEGPRVEAARNYGK-LLEETFGLPIDFQDERLTTVEAERMLIEQADTSRSKRK 119

Query: 134 QKVDSIAAALILQEVLD 150
           + +D +AA+LIL+  L+
Sbjct: 120 KVIDKLAASLILENYLN 136


>gi|270159103|ref|ZP_06187759.1| putative Holliday junction resolvase [Legionella longbeachae
           D-4968]
 gi|289166062|ref|YP_003456200.1| Holliday junction resolvase [Legionella longbeachae NSW150]
 gi|269987442|gb|EEZ93697.1| putative Holliday junction resolvase [Legionella longbeachae
           D-4968]
 gi|288859235|emb|CBJ13169.1| Holliday junction resolvase [Legionella longbeachae NSW150]
          Length = 139

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/135 (28%), Positives = 64/135 (47%), Gaps = 1/135 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P+      D G KRIG+A+       A P   L  +        +   I   +  A ++G
Sbjct: 2   PSSVYLGFDFGYKRIGVAVGQQLTCSASPLATLSARSGVPNWDAVAKVIAQWSPQALVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           +P  ++GSE       R F    + ++  +P    DERL+TV+A++ L      RK +  
Sbjct: 62  IPTCIDGSELYTTVPARRFAQ-ELHKRFVLPVHLVDERLSTVAAREQLFAQGGYRKIKQS 120

Query: 135 KVDSIAAALILQEVL 149
           +VDS+AA +IL++ L
Sbjct: 121 EVDSVAACVILEQWL 135


>gi|228475168|ref|ZP_04059894.1| conserved hypothetical protein [Staphylococcus hominis SK119]
 gi|228270779|gb|EEK12181.1| conserved hypothetical protein [Staphylococcus hominis SK119]
          Length = 142

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 46/139 (33%), Positives = 76/139 (54%), Gaps = 2/139 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFII 73
              I  +D+G++ +G+AISD     A     L    +        L+S I   N+ + +I
Sbjct: 3   RHKILGLDVGSRTVGIAISDLMGWTAQGLDTLRINEEDEEFGIDRLVSIIKDNNVGSVVI 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NMN S G R  ++  +   + +    +  + WDERL+T++A++ L++ +VSR+KR 
Sbjct: 63  GLPKNMNNSIGFRGEASLKYKELLQEALPNIEIIMWDERLSTMAAERSLLEADVSRQKRK 122

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA  ILQ  LD I
Sbjct: 123 KVIDKMAAVFILQGYLDSI 141


>gi|257867380|ref|ZP_05647033.1| conserved hypothetical protein [Enterococcus casseliflavus EC30]
 gi|257873711|ref|ZP_05653364.1| conserved hypothetical protein [Enterococcus casseliflavus EC10]
 gi|257877460|ref|ZP_05657113.1| conserved hypothetical protein [Enterococcus casseliflavus EC20]
 gi|257801436|gb|EEV30366.1| conserved hypothetical protein [Enterococcus casseliflavus EC30]
 gi|257807875|gb|EEV36697.1| conserved hypothetical protein [Enterococcus casseliflavus EC10]
 gi|257811626|gb|EEV40446.1| conserved hypothetical protein [Enterococcus casseliflavus EC20]
          Length = 140

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/134 (33%), Positives = 77/134 (57%), Gaps = 4/134 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIGLPL 77
             +D+G++ +G+A+SDP    A     +   +         L   +    ++ F++GLP 
Sbjct: 1   MGLDVGSRTVGVAVSDPMGWTAQGIEIIRINEDEGNFGYDRLAELVKEYEVSRFVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN + GPR  ++ A+    I+++  +P V+ DERLTTV A+++L++  N SR KR + +
Sbjct: 61  NMNNTIGPRAEASMAYGA-AIEQQFGLPVVYQDERLTTVQAERMLVEQANTSRAKRKKVI 119

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 120 DKLAAVMILQNYLD 133


>gi|90412043|ref|ZP_01220050.1| Holliday junction resolvase-like protein [Photobacterium profundum
           3TCK]
 gi|90327021|gb|EAS43400.1| Holliday junction resolvase-like protein [Photobacterium profundum
           3TCK]
          Length = 142

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 35/140 (25%), Positives = 60/140 (42%), Gaps = 2/140 (1%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           +  ++ + + D GTK IG+AI       A+P   L  K       ++   +        +
Sbjct: 1   MSNSRSVLAFDYGTKSIGVAIGQELTGTANPLAALKAKDGIPNWDDIGKILKEWQPDLVV 60

Query: 73  IGLPLNMNGSEGP-RVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           +GLPL++ G E        + F +  I  +        DERL+TV A+  L +    R  
Sbjct: 61  VGLPLDLEGGELESITPRAKKFAN-RIHGRFGCVVELHDERLSTVEAKADLFERGGYRSL 119

Query: 132 RIQKVDSIAAALILQEVLDR 151
               +DS +A +IL+   +R
Sbjct: 120 SKGNIDSQSAVVILESWFER 139


>gi|308050639|ref|YP_003914205.1| Holliday junction resolvase YqgF [Ferrimonas balearica DSM 9799]
 gi|307632829|gb|ADN77131.1| Holliday junction resolvase YqgF [Ferrimonas balearica DSM 9799]
          Length = 138

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/137 (28%), Positives = 66/137 (48%), Gaps = 1/137 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I + D GTK IG+A+       A P   +  +       E+ + +        ++GL
Sbjct: 1   MSTIMAFDFGTKSIGVAVGQTVTGTASPLLGIKARDGIPNWDEIAALLKEWQPDKLVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G++     + R F + +  R   +  +  DERLTTV A+  L +    R  +  +
Sbjct: 61  PLNMDGTDQHVTRAARKFANRLFGR-FGIETLTQDERLTTVDARARLFEDGGYRALKKDQ 119

Query: 136 VDSIAAALILQEVLDRI 152
           VD++AAALIL+   + +
Sbjct: 120 VDALAAALILESYFETL 136


>gi|34541766|ref|NP_906245.1| Holliday junction resolvase-like protein [Porphyromonas gingivalis
           W83]
 gi|62901001|sp|Q7MT06|RUVX_PORGI RecName: Full=Putative Holliday junction resolvase
 gi|34398084|gb|AAQ67144.1| conserved hypothetical protein TIGR00250 [Porphyromonas gingivalis
           W83]
          Length = 138

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/138 (28%), Positives = 66/138 (47%), Gaps = 5/138 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR GLA++DP +        +    +     +   +++ E +  F++GL
Sbjct: 1   MGRILAIDYGRKRTGLAVTDPLKIIPGGLTTVPTHTLLDFLRD---YVSREPVERFVLGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P  MN  E   +   R F   +      +P  + DER T+  AQ+ +++  + + KR  K
Sbjct: 58  PRRMNYEESESMTYIRPFAVKLAQAFPSIPITYVDERFTSRMAQRTILEAGIGKMKRRDK 117

Query: 136 --VDSIAAALILQEVLDR 151
             VD ++A +ILQ  LD 
Sbjct: 118 ALVDEVSAVIILQSYLDN 135


>gi|257066431|ref|YP_003152687.1| Holliday junction resolvase YqgF [Anaerococcus prevotii DSM 20548]
 gi|256798311|gb|ACV28966.1| Holliday junction resolvase YqgF [Anaerococcus prevotii DSM 20548]
          Length = 139

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 78/137 (56%), Gaps = 1/137 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I  +D+G K IG+A+SDP    ++    + RKK +     +   +   ++   ++GL
Sbjct: 1   MSRIMGLDVGNKTIGVALSDPMFLLSNALETIKRKKASVDIERIKQLVEENDVNLIVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + GP+     +FV  ++ ++V V  V+ DER+TT+ ++ +L+DM V R+ R + 
Sbjct: 61  PKNMNNTIGPQAMRVISFVD-LLKKQVDVEVVYEDERMTTIQSEAVLMDMEVRRENRKKY 119

Query: 136 VDSIAAALILQEVLDRI 152
           +D IAA  ILQ  LDR 
Sbjct: 120 IDKIAATFILQTYLDRR 136


>gi|326798192|ref|YP_004316011.1| Holliday junction resolvase [Sphingobacterium sp. 21]
 gi|326548956|gb|ADZ77341.1| Holliday junction resolvase [Sphingobacterium sp. 21]
          Length = 137

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/135 (28%), Positives = 70/135 (51%), Gaps = 5/135 (3%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I + D GTKRIG+A++DP +  A     +  K V +       +++ E + +F++G+P
Sbjct: 1   MRIMAFDYGTKRIGVAVTDPLQIIATALTTIHPKDVIEYL---KKYVSQEQVESFVVGMP 57

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--IQ 134
             ++GS+       + F++ +      +P V  DER T+  A   + +  + R KR    
Sbjct: 58  KQLDGSDSQSAVHVKGFINLLKKSFPQMPIVTMDERFTSKMASASIAESGLRRSKRQEKG 117

Query: 135 KVDSIAAALILQEVL 149
            VD+I+A +ILQ+ L
Sbjct: 118 LVDAISAVIILQDYL 132


>gi|319400946|gb|EFV89165.1| conserved hypothetical protein [Staphylococcus epidermidis FRI909]
          Length = 142

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 47/139 (33%), Positives = 74/139 (53%), Gaps = 2/139 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFII 73
              I  +D+G+K +G+AISD     A     L   +        +L+  I    +   +I
Sbjct: 3   KHKILGLDVGSKTVGIAISDLMGWTAQGLDTLRINEEQDDLGIDQLVKIIKDNQVGTVVI 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NMN S G R  ++  +   + D    +  V WDERL+T++A++ L++ +VSR+KR 
Sbjct: 63  GLPKNMNNSIGFRGEASIKYKEKLQDSVPSIDIVMWDERLSTMAAERSLLEADVSRQKRK 122

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA  ILQ  LD I
Sbjct: 123 KVIDKMAAVFILQGYLDSI 141


>gi|223044086|ref|ZP_03614125.1| conserved hypothetical protein [Staphylococcus capitis SK14]
 gi|314933782|ref|ZP_07841147.1| putative Holliday junction resolvase [Staphylococcus caprae C87]
 gi|222442480|gb|EEE48586.1| conserved hypothetical protein [Staphylococcus capitis SK14]
 gi|313653932|gb|EFS17689.1| putative Holliday junction resolvase [Staphylococcus caprae C87]
          Length = 142

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 46/137 (33%), Positives = 74/137 (54%), Gaps = 2/137 (1%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIGL 75
            I  +D+G+K +G+AISD     A     L   +        EL+  I    +   +IGL
Sbjct: 5   KIIGLDVGSKTVGIAISDLMGWTAQGLDTLRINEEQNELGIEELVDIIKKNQVGTVVIGL 64

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN S G R  ++  +   + +    +  + WDERL+T++A++ L++ +VSR+KR + 
Sbjct: 65  PKNMNNSIGFRGEASLQYKEKLQEALPSIEIIMWDERLSTMAAERSLLEADVSRQKRKKV 124

Query: 136 VDSIAAALILQEVLDRI 152
           +D +AA  ILQ  LD I
Sbjct: 125 IDKMAAVFILQGYLDSI 141


>gi|329998587|ref|ZP_08303171.1| RNAse H domain protein, YqgF family [Klebsiella sp. MS 92-3]
 gi|328538606|gb|EGF64706.1| RNAse H domain protein, YqgF family [Klebsiella sp. MS 92-3]
          Length = 138

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 60/136 (44%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           +      D GTK IG+A        A P P L  +        +   +      A I+GL
Sbjct: 2   SGTFLGFDFGTKSIGVAGGQRITATARPLPALKAQDGKPDWNVIEKLLKEWQPEAVIVGL 61

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V  +  DERL+TV A+  L +    R      
Sbjct: 62  PLNMDGTEQPLTARARNFAN-KIHGRFGVAILLHDERLSTVEARAGLFEHGGYRALNKGS 120

Query: 136 VDSIAAALILQEVLDR 151
           VDS +A +IL+   ++
Sbjct: 121 VDSASAVVILESYFEQ 136


>gi|319949823|ref|ZP_08023842.1| Holliday junction resolvase-like protein [Dietzia cinnamea P4]
 gi|319436514|gb|EFV91615.1| Holliday junction resolvase-like protein [Dietzia cinnamea P4]
          Length = 151

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/146 (26%), Positives = 57/146 (39%), Gaps = 4/146 (2%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL----SFITTENIAA 70
                  +D+GT RIG+A  DP    A P   +            L      I   +   
Sbjct: 6   TRGRRLGLDVGTARIGVASCDPDGILATPVETIRVVDGDPGWAAELRRLGELIAEYDAVG 65

Query: 71  FIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRK 130
            ++GLP ++ G E       R+F   +      VP    DERLTTV+A   L     + +
Sbjct: 66  VVVGLPTSLKGRETASTAMARSFADALTTASPEVPVELVDERLTTVTAGAALHGAGRNTR 125

Query: 131 KRIQKVDSIAAALILQEVLDRISFLE 156
           K+   +D  AA ++LQ  +D      
Sbjct: 126 KQRDVIDQAAAVVLLQAWIDSRHARR 151


>gi|30249631|ref|NP_841701.1| Holliday junction resolvase-like protein [Nitrosomonas europaea
           ATCC 19718]
 gi|62901022|sp|Q82U42|RUVX_NITEU RecName: Full=Putative Holliday junction resolvase
 gi|30138994|emb|CAD85578.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718]
          Length = 148

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/136 (27%), Positives = 65/136 (47%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            +  + + D G +RIG+AI +   R AHP   + +        ++   I        ++G
Sbjct: 8   SSGTVLAFDFGKRRIGVAIGEHELRMAHPLTTIDQSMTRPRFEKIAELIEAWQPVLLVVG 67

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           L ++ +G+E       R F    ++ +  +P    DER TTV A+ +L ++ V+ KK+  
Sbjct: 68  LSVHADGTEHEITRLCRRFAR-RLEGRFRIPVALADERYTTVIARSVLEEVGVTGKKQRP 126

Query: 135 KVDSIAAALILQEVLD 150
            +D IAA  ILQ   D
Sbjct: 127 MLDQIAAQHILQTYFD 142


>gi|255014065|ref|ZP_05286191.1| Holliday junction resolvase-like protein [Bacteroides sp. 2_1_7]
 gi|256839599|ref|ZP_05545108.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|262382117|ref|ZP_06075255.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|298375296|ref|ZP_06985253.1| Holliday junction resolvase [Bacteroides sp. 3_1_19]
 gi|301310690|ref|ZP_07216629.1| putative Holliday junction resolvase [Bacteroides sp. 20_3]
 gi|256738529|gb|EEU51854.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|262297294|gb|EEY85224.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|298267796|gb|EFI09452.1| Holliday junction resolvase [Bacteroides sp. 3_1_19]
 gi|300832264|gb|EFK62895.1| putative Holliday junction resolvase [Bacteroides sp. 20_3]
          Length = 140

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 71/141 (50%), Gaps = 5/141 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A +D  +  A+    +   +V +   +   +I+ E +  F++GL
Sbjct: 1   MGRIIAIDYGRKRTGIAATDILQMIANGVATVPSGEVVKYLSD---YISREPVDLFVVGL 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN      +    AFV ++      +P  ++DER T+V A + +++  + +KKR   
Sbjct: 58  PKQMNNEPSENMKYVEAFVTHLKRTIPSIPVTYYDERFTSVLAHKAMLEGGLKKKKRQDK 117

Query: 134 QKVDSIAAALILQEVLDRISF 154
             VD I+A +ILQ  L+   +
Sbjct: 118 GLVDEISAVIILQAYLESKKY 138


>gi|15677203|ref|NP_274356.1| Holliday junction resolvase-like protein [Neisseria meningitidis
           MC58]
 gi|121635046|ref|YP_975291.1| Holliday junction resolvase-like protein [Neisseria meningitidis
           FAM18]
 gi|254805133|ref|YP_003083354.1| putative Hollyday junction resolvase [Neisseria meningitidis
           alpha14]
 gi|304387351|ref|ZP_07369543.1| crossover junction endodeoxyribonuclease [Neisseria meningitidis
           ATCC 13091]
 gi|32130068|sp|Q9JZ16|RUVX_NEIMB RecName: Full=Putative Holliday junction resolvase
 gi|167012740|sp|A1KUG2|RUVX_NEIMF RecName: Full=Putative Holliday junction resolvase
 gi|7226581|gb|AAF41712.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|120866752|emb|CAM10505.1| conserved hypothetical protein [Neisseria meningitidis FAM18]
 gi|254668675|emb|CBA06382.1| putative Hollyday junction resolvase [Neisseria meningitidis
           alpha14]
 gi|254669936|emb|CBA04529.1| putative Hollyday junction resolvase [Neisseria meningitidis
           alpha153]
 gi|254673037|emb|CBA07628.1| putative Hollyday junction resolvase [Neisseria meningitidis
           alpha275]
 gi|304338602|gb|EFM04720.1| crossover junction endodeoxyribonuclease [Neisseria meningitidis
           ATCC 13091]
 gi|308389455|gb|ADO31775.1| Holliday junction resolvase-like protein [Neisseria meningitidis
           alpha710]
 gi|316984140|gb|EFV63118.1| conserved hypothetical protein [Neisseria meningitidis H44/76]
 gi|325128470|gb|EGC51351.1| hypothetical protein NMXN1568_0820 [Neisseria meningitidis N1568]
 gi|325130425|gb|EGC53189.1| hypothetical protein NMBOX9930304_0816 [Neisseria meningitidis
           OX99.30304]
 gi|325132467|gb|EGC55160.1| hypothetical protein NMBM6190_0869 [Neisseria meningitidis M6190]
 gi|325134425|gb|EGC57070.1| hypothetical protein NMBM13399_0866 [Neisseria meningitidis M13399]
 gi|325136160|gb|EGC58768.1| hypothetical protein NMBM0579_0893 [Neisseria meningitidis M0579]
 gi|325138241|gb|EGC60810.1| hypothetical protein NMBES14902_0966 [Neisseria meningitidis
           ES14902]
 gi|325140441|gb|EGC62962.1| hypothetical protein NMBCU385_0832 [Neisseria meningitidis CU385]
 gi|325198484|gb|ADY93940.1| conserved hypothetical protein [Neisseria meningitidis G2136]
 gi|325200040|gb|ADY95495.1| conserved hypothetical protein [Neisseria meningitidis H44/76]
 gi|325201953|gb|ADY97407.1| conserved hypothetical protein [Neisseria meningitidis M01-240149]
 gi|325204333|gb|ADY99786.1| conserved hypothetical protein [Neisseria meningitidis M01-240355]
          Length = 151

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 35/136 (25%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P     + D G  RIG+A  D     +HP   +      +    +   +       F++G
Sbjct: 5   PKGTALAFDFGEARIGVAQGDAELGLSHPLSTVTGGSNDEKFAAIAKLVQEWQPRYFVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G++    H +R F    ++ +  +P  + DERL++V A+ +L +  V  KKR  
Sbjct: 65  LPVHTDGTKHEMTHLSRKFGR-RLNGRFNLPVYWVDERLSSVYAESLLSEAQVFGKKRKS 123

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA  IL    +
Sbjct: 124 VLDQVAAQAILHGFFE 139


>gi|27468217|ref|NP_764854.1| hypothetical protein SE1299 [Staphylococcus epidermidis ATCC 12228]
 gi|57867099|ref|YP_188756.1| hypothetical protein SERP1180 [Staphylococcus epidermidis RP62A]
 gi|251811023|ref|ZP_04825496.1| crossover junction endodeoxyribonuclease [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|282875958|ref|ZP_06284825.1| RNAse YqgF [Staphylococcus epidermidis SK135]
 gi|293366426|ref|ZP_06613104.1| conserved hypothetical protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|32130023|sp|Q8CSA9|RUVX_STAES RecName: Full=Putative Holliday junction resolvase
 gi|62900904|sp|Q5HNT4|RUVX_STAEQ RecName: Full=Putative Holliday junction resolvase
 gi|27315763|gb|AAO04898.1|AE016748_132 conserved hypothetical protein [Staphylococcus epidermidis ATCC
           12228]
 gi|57637757|gb|AAW54545.1| conserved hypothetical protein TIGR00250 [Staphylococcus
           epidermidis RP62A]
 gi|251805441|gb|EES58098.1| crossover junction endodeoxyribonuclease [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|281294983|gb|EFA87510.1| RNAse YqgF [Staphylococcus epidermidis SK135]
 gi|291319460|gb|EFE59828.1| conserved hypothetical protein [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329735297|gb|EGG71589.1| RNAse H domain protein, YqgF family [Staphylococcus epidermidis
           VCU045]
 gi|329737275|gb|EGG73529.1| RNAse H domain protein, YqgF family [Staphylococcus epidermidis
           VCU028]
          Length = 142

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 46/139 (33%), Positives = 74/139 (53%), Gaps = 2/139 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFII 73
              I  +D+G+K +G+AISD     A     L   +        +L+  I    +   +I
Sbjct: 3   KHKILGLDVGSKTVGIAISDLMGWTAQGLDTLRINEEQDDLGIDQLVKIIKDNQVGTVVI 62

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP NMN S G R  ++  +   + +    +  V WDERL+T++A++ L++ +VSR+KR 
Sbjct: 63  GLPKNMNNSIGFRGEASIKYKEKLQESIPSIDIVMWDERLSTMAAERSLLEADVSRQKRK 122

Query: 134 QKVDSIAAALILQEVLDRI 152
           + +D +AA  ILQ  LD I
Sbjct: 123 KVIDKMAAVFILQGYLDSI 141


>gi|328957194|ref|YP_004374580.1| Holliday junction resolvase-like protein [Carnobacterium sp. 17-4]
 gi|328673518|gb|AEB29564.1| Holliday junction resolvase-like protein [Carnobacterium sp. 17-4]
          Length = 140

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 44/138 (31%), Positives = 72/138 (52%), Gaps = 4/138 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIG 74
                +D+G+K +G+A+SDP    A     +   +  +      +   I    +   +IG
Sbjct: 1   MRTMGLDVGSKTVGVAVSDPFGWTAQGIEIVKINETQEEYGIERIGELIKIHEVTKVVIG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMN-VSRKKRI 133
           LP NMN S GPR  ++  +   +I     +P +  DERLTTV A+++LI+    SR KR 
Sbjct: 61  LPKNMNNSIGPRAEASLRYAE-LIKETFNLPVILQDERLTTVQAERMLIEEGNTSRAKRK 119

Query: 134 QKVDSIAAALILQEVLDR 151
           + +D +AA +ILQ  L++
Sbjct: 120 KVIDKVAAVMILQNYLNQ 137


>gi|313674137|ref|YP_004052133.1| holliday junction resolvase yqgf [Marivirga tractuosa DSM 4126]
 gi|312940835|gb|ADR20025.1| Holliday junction resolvase YqgF [Marivirga tractuosa DSM 4126]
          Length = 137

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/139 (29%), Positives = 70/139 (50%), Gaps = 6/139 (4%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              + +ID GTKR+GLA++DP +  A P   +  K + Q      ++ ++E + A + G 
Sbjct: 1   MPRVLAIDYGTKRVGLAVTDPLKIIASPLEMIHSKDLVQYL---ANYFSSEEVEAVVCGY 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P N  G          AF++    +   +P    DE  ++  A Q +I    +RK+R +K
Sbjct: 58  PTNEEGEATDATRHVDAFINLFKKKFPTMPLHLQDESFSSQEAMQAMIHSGSNRKQRNKK 117

Query: 136 ---VDSIAAALILQEVLDR 151
              +D I+AA+ILQ+ L+ 
Sbjct: 118 SGNIDKISAAIILQQFLEE 136


>gi|218768356|ref|YP_002342868.1| Holliday junction resolvase-like protein [Neisseria meningitidis
           Z2491]
 gi|32130067|sp|Q9JU11|RUVX_NEIMA RecName: Full=Putative Holliday junction resolvase
 gi|121052364|emb|CAM08696.1| conserved hypothetical protein [Neisseria meningitidis Z2491]
 gi|319410602|emb|CBY90971.1| conserved hypothetical protein [Neisseria meningitidis WUE 2594]
          Length = 151

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 35/136 (25%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P     + D G  RIG+A  D     +HP   +      +    +   +       F++G
Sbjct: 5   PKGTALAFDFGEARIGVAQGDAELGLSHPLATVTGGSNDEKFAAIAKLVQEWQPRYFVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G++    H +R F    ++ +  +P  + DERL++V A+ +L +  V  KKR  
Sbjct: 65  LPVHTDGTKHEMTHLSRKFGR-RLNGRFNLPVYWVDERLSSVYAESLLSEAQVFGKKRKS 123

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA  IL    +
Sbjct: 124 VLDQVAAQAILHGFFE 139


>gi|311894841|dbj|BAJ27249.1| putative Holliday junction resolvase [Kitasatospora setae KM-6054]
          Length = 157

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/146 (28%), Positives = 63/146 (43%), Gaps = 2/146 (1%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
                 ++D+G  RIG+A+ DP    A P   +     +Q    L + +   +    ++G
Sbjct: 7   RRGRRIAVDVGDARIGVAVCDPDGLIATPVETVPAGGRSQ--ARLKAIVEEYDAVEVVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP ++NG EGP     R +   +      V     DER+TTV+A   L     S KK   
Sbjct: 65  LPRSLNGKEGPAAAKVREYAGRLAGLLYPVGVRLVDERMTTVTAAAGLRASGRSSKKGRS 124

Query: 135 KVDSIAAALILQEVLDRISFLESSKG 160
            +D  AA +ILQ  L+       + G
Sbjct: 125 VIDQAAAVVILQSALETERVSGRAPG 150


>gi|319638570|ref|ZP_07993332.1| Holliday junction resolvase [Neisseria mucosa C102]
 gi|317400319|gb|EFV80978.1| Holliday junction resolvase [Neisseria mucosa C102]
          Length = 151

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 31/136 (22%), Positives = 62/136 (45%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P   + + D G  RIG+A  +     +HP   +      +    +   +       F++G
Sbjct: 5   PKGTVLAFDFGEARIGVAQGEAELGMSHPLATVTGNSNDEKFEAIAKLVKEWQPKYFVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP + +G+E      +R F    +  +  +P  + DER++++ A+ +L +  V  +K+  
Sbjct: 65  LPTHTDGTEHELTRLSRKFGR-RLHGRFNLPVYWVDERMSSLYAESLLAEAQVFGRKQKS 123

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA  ILQ   +
Sbjct: 124 VLDQVAAQAILQGFFE 139


>gi|269137634|ref|YP_003294334.1| hypothetical protein ETAE_0276 [Edwardsiella tarda EIB202]
 gi|267983294|gb|ACY83123.1| conserved hypothetical protein [Edwardsiella tarda EIB202]
 gi|304557699|gb|ADM40363.1| Putative Holliday junction resolvase [Edwardsiella tarda FL6-60]
          Length = 140

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 1/138 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + I + D GT+ IG AI       A P              ++   +        ++GLP
Sbjct: 4   RTILAFDFGTRSIGCAIGQELTGSARPLQSFKANDGAPDWQQIEKVLREWQPDLVVVGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+GSE P     R F +  +  +  V     DERL+TV A+  L      R     +V
Sbjct: 64  LNMDGSEQPLTQMARKFAN-RLHGRFGVQIALQDERLSTVEARAHLFAGGGYRALEKGRV 122

Query: 137 DSIAAALILQEVLDRISF 154
           D+ +AALIL+   +  ++
Sbjct: 123 DAASAALILESWFEHQTY 140


>gi|197123036|ref|YP_002134987.1| Holliday junction resolvase-like protein [Anaeromyxobacter sp. K]
 gi|226725482|sp|B4UH04|RUVX_ANASK RecName: Full=Putative Holliday junction resolvase
 gi|196172885|gb|ACG73858.1| Holliday junction resolvase YqgF [Anaeromyxobacter sp. K]
          Length = 137

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 45/137 (32%), Positives = 72/137 (52%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
                +DLG  RIGLA++D   R A     +VR+   +    +        +   ++GLP
Sbjct: 1   MRTLGVDLGRVRIGLAVADEILRTARAVTTVVRRTEAEDLSAIAEVARDYEVTRAVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+G+EGP     R F    ++  + VP   +DERL++  A+  L    +S +++  +V
Sbjct: 61  LNMDGTEGPSARLARGFA-PRLEAALGVPVELFDERLSSFEAESRLRARGLSAREQRGQV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D+ AAA+ILQ  LDR +
Sbjct: 120 DAEAAAVILQGWLDRRA 136


>gi|34499365|ref|NP_903580.1| Holliday junction resolvase-like protein [Chromobacterium violaceum
           ATCC 12472]
 gi|62901005|sp|Q7NR74|RUVX_CHRVO RecName: Full=Putative Holliday junction resolvase
 gi|34105215|gb|AAQ61571.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 137

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 33/133 (24%), Positives = 61/133 (45%), Gaps = 2/133 (1%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
            + D G +RIG+A+ D      HP   +      +    +   I        ++GLP++ 
Sbjct: 1   MAFDFGERRIGVAVGDTILGIPHPLATIDTAVTDERFAAIARLIEEWQPRQLVVGLPMHP 60

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR-KKRIQKVDS 138
           +G E      +R F +  +  +  +P    DER T+V A+Q+L +  V + +K+   +D 
Sbjct: 61  DGEEHELSALSRRFAN-RLKGRFGLPVWLVDERYTSVIAEQLLEEAGVKKGRKQKPALDQ 119

Query: 139 IAAALILQEVLDR 151
           +AA  IL    ++
Sbjct: 120 VAAQAILAGWFEQ 132


>gi|119470543|ref|ZP_01613246.1| Holliday junction resolvase-like protein [Alteromonadales bacterium
           TW-7]
 gi|119446244|gb|EAW27521.1| Holliday junction resolvase-like protein [Alteromonadales bacterium
           TW-7]
          Length = 149

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 55/135 (40%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + +   D GTK IG+A+       A     +  +        +   +        ++GLP
Sbjct: 12  RTVMGFDFGTKSIGIAVGQELTGSASSLKAVKAQDGIPNWDHIAVQVNEWQPDLMVVGLP 71

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+G+        + F +  +     +P    DERLTT  A+  L +    +      V
Sbjct: 72  LNMDGTSQEVTFKAKKFAN-RLHNHYGIPVQTQDERLTTADAKARLFEQGGYKNLGKGNV 130

Query: 137 DSIAAALILQEVLDR 151
           D+++A +IL+   + 
Sbjct: 131 DNMSAVIILESFFES 145


>gi|281420285|ref|ZP_06251284.1| putative Holliday junction resolvase [Prevotella copri DSM 18205]
 gi|281405587|gb|EFB36267.1| putative Holliday junction resolvase [Prevotella copri DSM 18205]
          Length = 137

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/140 (29%), Positives = 66/140 (47%), Gaps = 6/140 (4%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I SID G KR GLA++DP +  A+    +   ++        ++I  E +   +IG P
Sbjct: 1   MRILSIDYGKKRTGLAVTDPLQIIANGLATVSTHELFTYIE---TYIQKEQVERIVIGKP 57

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK- 135
           +  NG     +     F +        +P  ++DER T+V A + +ID  V +K R +  
Sbjct: 58  MQPNGQPSENLARVENFYNRWRKAHPEIPIEYYDERFTSVLAHRAMIDGGVKKKVRKENK 117

Query: 136 --VDSIAAALILQEVLDRIS 153
             VD I+A +ILQ+ L    
Sbjct: 118 GLVDEISATIILQDYLQSRR 137


>gi|322834236|ref|YP_004214263.1| Holliday junction resolvase YqgF [Rahnella sp. Y9602]
 gi|321169437|gb|ADW75136.1| Holliday junction resolvase YqgF [Rahnella sp. Y9602]
          Length = 142

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 62/136 (45%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           N+ + + D GTK IGLAI       A P      +  T    ++   +        ++GL
Sbjct: 3   NRTVFAFDFGTKSIGLAIGQEVTGTARPLTSFKAQDGTPDWQKIEKLLKEWLPDLVVVGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  +  +  V     DERL+TV A+  L D    R      
Sbjct: 63  PLNMDGTEQPLTARARKFAN-RLHGRFGVQVELHDERLSTVEARADLFDRGGFRALDKGS 121

Query: 136 VDSIAAALILQEVLDR 151
           VD+ +A +IL+   ++
Sbjct: 122 VDAASAVIILESWFEK 137


>gi|300770445|ref|ZP_07080324.1| Holliday junction resolvase family protein [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|300762921|gb|EFK59738.1| Holliday junction resolvase family protein [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 138

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 70/141 (49%), Gaps = 5/141 (3%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             + + D GTKRIG+A++DP +  A+    +      +    L +++ TE +  F++G P
Sbjct: 1   MRLMAFDYGTKRIGIAVTDPLQIVANALTTVH---PDEIVDFLKNYLQTEQVETFVVGKP 57

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--IQ 134
             M+GS+         F+  +  +   +P    DER T+  A  ++    + + KR    
Sbjct: 58  RQMDGSDSESASHVIGFIRLLKKQFPAIPVAEVDERFTSKMASAVIAQSGMKKGKRQQKG 117

Query: 135 KVDSIAAALILQEVLDRISFL 155
            VD+I+A +ILQ  +D  SFL
Sbjct: 118 LVDTISATIILQSYMDSRSFL 138


>gi|254447654|ref|ZP_05061120.1| conserved hypothetical protein TIGR00250 [gamma proteobacterium
           HTCC5015]
 gi|198262997|gb|EDY87276.1| conserved hypothetical protein TIGR00250 [gamma proteobacterium
           HTCC5015]
          Length = 141

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 40/142 (28%), Positives = 62/142 (43%), Gaps = 5/142 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              +  ID G KRIG+A        A P   L           L   +      A ++GL
Sbjct: 1   MNTLLGIDFGLKRIGIATGQTLTCSATPLTTLPNHAEHTNWDGLDKVLKDWKPDAIVLGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDM----NVSRKK 131
           PLN +GS+       R F  + + +    P  + DER ++  A+Q L       ++ RK 
Sbjct: 61  PLNKDGSDHALTKQVRQF-RDTLGQHFSGPIHWQDERASSREAEQSLTSQRASGDLRRKV 119

Query: 132 RIQKVDSIAAALILQEVLDRIS 153
           + + +D +AAALILQ  L++  
Sbjct: 120 KKEDIDQLAAALILQRWLNKTP 141


>gi|254360570|ref|ZP_04976719.1| crossover junction endodeoxyribonuclease [Mannheimia haemolytica
           PHL213]
 gi|261493723|ref|ZP_05990241.1| crossover junction endodeoxyribonuclease [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261494545|ref|ZP_05991029.1| crossover junction endodeoxyribonuclease [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|153091110|gb|EDN73115.1| crossover junction endodeoxyribonuclease [Mannheimia haemolytica
           PHL213]
 gi|261309794|gb|EEY11013.1| crossover junction endodeoxyribonuclease [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261310613|gb|EEY11798.1| crossover junction endodeoxyribonuclease [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 141

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 37/135 (27%), Positives = 60/135 (44%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + + + D GT  IG A+       A        +       E+   +        ++GLP
Sbjct: 7   KTVIAFDFGTNSIGCAVGQSITGTAQGLTTFKAQDGIPNWEEIGKLLQDWKPDMLVVGLP 66

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+G+E P     R F +  ++ +  +P    DERLTTV A+  +      +  +  KV
Sbjct: 67  LNMDGTEQPLTQRARKFAN-RLNGRFNLPVELQDERLTTVEAKAEIFSRGGYKALKKDKV 125

Query: 137 DSIAAALILQEVLDR 151
           DSI+A LIL+   + 
Sbjct: 126 DSISACLILESWFEN 140


>gi|304382926|ref|ZP_07365408.1| Holliday junction resolvase [Prevotella marshii DSM 16973]
 gi|304335951|gb|EFM02199.1| Holliday junction resolvase [Prevotella marshii DSM 16973]
          Length = 140

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/138 (29%), Positives = 68/138 (49%), Gaps = 5/138 (3%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPL 77
            I SID G KR GLA++DP +        +   ++ +      +++  E +   +IG P 
Sbjct: 5   RILSIDYGKKRTGLAVTDPLQMICGGLATVPTSELFKFL---QTYMEKEPVERIVIGEPK 61

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK-- 135
             NG     +   + FV+       +VP  F+DER T++ A + ++D  + +K R  K  
Sbjct: 62  QPNGMPSENMARVQQFVNRWRKAVPHVPIEFYDERFTSLLAHKAMLDGGLKKKARRDKAL 121

Query: 136 VDSIAAALILQEVLDRIS 153
           VD I+A +ILQ  L+ I 
Sbjct: 122 VDEISATIILQSYLESIR 139


>gi|187922872|ref|YP_001894514.1| Holliday junction resolvase-like protein [Burkholderia phytofirmans
           PsJN]
 gi|226725498|sp|B2T0I5|RUVX_BURPP RecName: Full=Putative Holliday junction resolvase
 gi|187714066|gb|ACD15290.1| Holliday junction resolvase YqgF [Burkholderia phytofirmans PsJN]
          Length = 146

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 34/139 (24%), Positives = 64/139 (46%), Gaps = 5/139 (3%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
               + + D G KRIG+A+ +   R A P   +  +        +   I      A ++G
Sbjct: 7   REATLLAFDYGEKRIGVAVGNSLTRRARPLVIVQNRSREYRFEAVGKLIAEWKPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP + +G+        + F +  ++ +  +P  + DER ++V A+  +   N     R  
Sbjct: 67  LPFHPDGAPHEMTQLAKRFGN-QLNGRFNLPVTWVDERYSSVEAKAEIRAGNG----RAD 121

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D+ AA++ILQ+ LD +S
Sbjct: 122 MLDAEAASIILQQYLDGLS 140


>gi|325270162|ref|ZP_08136769.1| Holliday junction resolvase [Prevotella multiformis DSM 16608]
 gi|324987463|gb|EGC19439.1| Holliday junction resolvase [Prevotella multiformis DSM 16608]
          Length = 139

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/137 (29%), Positives = 63/137 (45%), Gaps = 6/137 (4%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR GLA++DP R  A+    +    +         +I  E +   +IG 
Sbjct: 1   MGRILAIDYGKKRTGLAVTDPLRIIANGLATVATSGLFDFLT---QYIAEEPVDRLVIGR 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--- 132
           P+  +G     +     FV+        +P  ++DER T+V A Q LI   V +K R   
Sbjct: 58  PVQPSGEPSENLVRVEQFVNRWRKAHPELPIDYYDERFTSVLAHQALIAGGVKKKTRREN 117

Query: 133 IQKVDSIAAALILQEVL 149
              VD I+A +ILQ+ +
Sbjct: 118 KGLVDEISATIILQDYM 134


>gi|15892378|ref|NP_360092.1| Holliday junction resolvase-like protein [Rickettsia conorii str.
           Malish 7]
 gi|32130054|sp|Q92IG5|RUVX_RICCN RecName: Full=Putative Holliday junction resolvase
 gi|15619527|gb|AAL02993.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 154

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 49/155 (31%), Positives = 81/155 (52%), Gaps = 1/155 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I  +++  + L PN P+ +ID G K++G+A+S+  R  A P   +           LL
Sbjct: 1   MIIKNLQEFYRLLIPNVPLIAIDYGNKKLGIALSNQERSIAMPLNTITEINKKIVITSLL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           + I    +   IIGLP++M+G+   + +    F    + + + +P    DERLTT +A  
Sbjct: 61  NIIEKYKVCGVIIGLPIDMSGAVTEQTNIVMKFAE-ELAKSINLPIYLQDERLTTKAANN 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
           +L    V RK R    D++AA++IL+ VLD I  +
Sbjct: 120 LLKSFGVKRKDRNNNDDAVAASMILETVLDSIKNI 154


>gi|157803931|ref|YP_001492480.1| Holliday junction resolvase-like protein [Rickettsia canadensis
           str. McKiel]
 gi|167012756|sp|A8EZB2|RUVX_RICCK RecName: Full=Putative Holliday junction resolvase
 gi|157785194|gb|ABV73695.1| Holliday junction resolvase-like protein [Rickettsia canadensis
           str. McKiel]
          Length = 154

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 49/152 (32%), Positives = 78/152 (51%), Gaps = 1/152 (0%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M I  +++  + L PN  + +ID G+K++G+A+S+  R  A P   +     T     +L
Sbjct: 1   MIIKNLQEFYRLLIPNTQLIAIDYGSKKLGIAMSNGERSIAMPLNTITVVNKTAVINSVL 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
           S I    I   +IGLP++M+G    + +    F    + +   +P    DERLTT +A  
Sbjct: 61  SIIAKYKICGVVIGLPIDMSGVVTQQTNIVMKFAE-ELAKYTNLPIYLQDERLTTKAANN 119

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRI 152
            L    V RK R    D++AA++IL+ VLD I
Sbjct: 120 FLKSFGVKRKDRNNNDDAVAASMILETVLDSI 151


>gi|88859063|ref|ZP_01133704.1| Holliday junction resolvase-like protein [Pseudoalteromonas
           tunicata D2]
 gi|88819289|gb|EAR29103.1| Holliday junction resolvase-like protein [Pseudoalteromonas
           tunicata D2]
          Length = 149

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 58/135 (42%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + +   D GT+ IG+A+       A P   +  +       E+ + +        ++GLP
Sbjct: 12  RTVLGFDFGTRSIGIAVGQEITGSASPLKAINARDGIPNWDEIAAIVNEWQPDLLVVGLP 71

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+G+        + F +  +     +P    DERLTT  A+  L      +K     V
Sbjct: 72  LNMDGTNQEVTFQAKKFAN-RLHNNYGLPVETQDERLTTADAKSQLFAQGGFKKLTKGNV 130

Query: 137 DSIAAALILQEVLDR 151
           DS++A LIL+   + 
Sbjct: 131 DSMSALLILESYFEN 145


>gi|317493541|ref|ZP_07951962.1| hypothetical protein HMPREF0864_02727 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316918484|gb|EFV39822.1| hypothetical protein HMPREF0864_02727 [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 140

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 60/136 (44%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           N+ I + D GTK IG AI       A P       + +    ++   +        ++GL
Sbjct: 3   NRTIIAFDFGTKSIGAAIGQEVTGTARPLASFKANEGSPDWSKIEKMLKEWQPDLVVVGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  I  +  V     DERL+TV A+  L      R      
Sbjct: 63  PLNMDGTEQPVTAQARKFAN-RIHGRFGVQVALHDERLSTVEARAHLFAGGGYRALDKGS 121

Query: 136 VDSIAAALILQEVLDR 151
           VD+ +A +IL+   ++
Sbjct: 122 VDAASAVIILESWFEQ 137


>gi|220917826|ref|YP_002493130.1| Holliday junction resolvase YqgF [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|254767492|sp|B8JDZ9|RUVX_ANAD2 RecName: Full=Putative Holliday junction resolvase
 gi|219955680|gb|ACL66064.1| Holliday junction resolvase YqgF [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 137

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 45/137 (32%), Positives = 72/137 (52%), Gaps = 1/137 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
                +DLG  RIGLA++D   R A     +VR+   +    +        +   ++GLP
Sbjct: 1   MRTLGVDLGRVRIGLAVADEILRTARAVTTVVRRTEAEDLAAIAEVARDYEVTRAVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+G+EGP     R F    ++  + VP   +DERL++  A+  L    +S +++  +V
Sbjct: 61  LNMDGTEGPSARLARGFA-PRLEAALGVPVELFDERLSSFEAESRLRARGLSAREQRGQV 119

Query: 137 DSIAAALILQEVLDRIS 153
           D+ AAA+ILQ  LDR +
Sbjct: 120 DAEAAAVILQGWLDRRA 136


>gi|300811591|ref|ZP_07092075.1| RNAse YqgF [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
 gi|313124258|ref|YP_004034517.1| holliday junction resolvase [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|300497451|gb|EFK32489.1| RNAse YqgF [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
 gi|312280821|gb|ADQ61540.1| Putative Holliday junction resolvase [Lactobacillus delbrueckii
           subsp. bulgaricus ND02]
 gi|325126221|gb|ADY85551.1| Putative Holliday junction resolvase [Lactobacillus delbrueckii
           subsp. bulgaricus 2038]
 gi|325685731|gb|EGD27809.1| crossover junction endodeoxyribonuclease [Lactobacillus delbrueckii
           subsp. lactis DSM 20072]
          Length = 142

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 44/138 (31%), Positives = 75/138 (54%), Gaps = 5/138 (3%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             +  +D+G+K IG+A+SDP    A     +   +         L   +       F++G
Sbjct: 1   MRLLGLDVGSKTIGVAVSDPLGITAQAVMTIPIDEDRHNFGMRSLKKLVREYEADGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVS-RKKR 132
           LP NM+G+ G  V  ++A     +++K  +P  + DERLTTV++++IL+ +  +  R++R
Sbjct: 61  LPKNMDGTAGRSVSRSKAMGE-RLEQKFGLPVYYDDERLTTVASERILVEEAGMHDRRQR 119

Query: 133 IQKVDSIAAALILQEVLD 150
            + VD +AA LILQ  LD
Sbjct: 120 KEVVDQMAAVLILQNYLD 137


>gi|254495884|ref|ZP_05108793.1| YqgF [Legionella drancourtii LLAP12]
 gi|254354866|gb|EET13492.1| YqgF [Legionella drancourtii LLAP12]
          Length = 138

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/137 (28%), Positives = 61/137 (44%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P+      D G KRIG+A+       A P   +  +        +   +      A I+G
Sbjct: 2   PDGVYLGFDFGYKRIGVAVGQRLTCSASPLATISAQTGVPDWTVVAKVVAQWTPQALIVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           +P  ++G E     + R F    + ++  +P    DERLTTV A+  L      RK +  
Sbjct: 62  IPTCIDGREQYTTSAARRFAK-ELRKRFTLPVHLVDERLTTVEARGHLFAQGGYRKIKQT 120

Query: 135 KVDSIAAALILQEVLDR 151
           +VDSIAA +IL++ L  
Sbjct: 121 EVDSIAACVILEQWLQY 137


>gi|255529990|ref|YP_003090362.1| Holliday junction resolvase YqgF [Pedobacter heparinus DSM 2366]
 gi|255342974|gb|ACU02300.1| Holliday junction resolvase YqgF [Pedobacter heparinus DSM 2366]
          Length = 138

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 36/138 (26%), Positives = 68/138 (49%), Gaps = 5/138 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I + D GTKRIG+A++DP +  A     +  K + +       ++  E + AF+ G 
Sbjct: 1   MPRILAFDYGTKRIGIAVTDPLQIIATGLDTIHPKDIVEYL---KKYLLAEQVEAFVFGD 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR--KKRI 133
           P  M+G+        + F   +      +P  + DER T+  A Q ++   + +  +K  
Sbjct: 58  PKQMDGTPSESAQHVKGFAKTLKKTFPDIPQYWIDERFTSKLAHQAIMQSGLKKQDRKNK 117

Query: 134 QKVDSIAAALILQEVLDR 151
           ++VD+I+A +ILQ  +++
Sbjct: 118 ERVDTISATIILQYFMEQ 135


>gi|149280102|ref|ZP_01886226.1| Holliday junction resolvase-like protein [Pedobacter sp. BAL39]
 gi|149229116|gb|EDM34511.1| Holliday junction resolvase-like protein [Pedobacter sp. BAL39]
          Length = 138

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 40/138 (28%), Positives = 69/138 (50%), Gaps = 5/138 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I + D GTKR+G+A++DP +  A     +  K + +       ++ TE + AF+IG 
Sbjct: 1   MPRILAFDYGTKRVGIAVTDPLQIIATGLDNVHPKDIIEYL---KKYLLTEQVEAFVIGD 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P  M+GS        + F   +      +P  + DER T+  A Q ++   + ++ R  K
Sbjct: 58  PKQMDGSPSESAQHIKGFARTLKKTFPDIPQFWVDERFTSKLAHQTILQSGLKKQDRKDK 117

Query: 136 --VDSIAAALILQEVLDR 151
             VD+IAA +ILQ  +++
Sbjct: 118 SRVDTIAATIILQYFMEQ 135


>gi|325851999|ref|ZP_08171082.1| RNAse H domain protein, YqgF family [Prevotella denticola CRIS
           18C-A]
 gi|325484555|gb|EGC87471.1| RNAse H domain protein, YqgF family [Prevotella denticola CRIS
           18C-A]
          Length = 139

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/137 (29%), Positives = 64/137 (46%), Gaps = 6/137 (4%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR GLA++DP R  A+    +    +         +I TE +   +IG 
Sbjct: 1   MGRILAIDYGKKRTGLAVTDPLRIIANGLATVATSGLFDFLT---QYIETETVERLVIGR 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--- 132
           P+  +G     +     FV+        +P  ++DER T+V A Q +I   V +K R   
Sbjct: 58  PVQPDGRPSENLGRVEQFVNRWRKAHPELPVDYYDERFTSVIAHQAMIAGGVKKKTRREN 117

Query: 133 IQKVDSIAAALILQEVL 149
              VD I+A +ILQ+ +
Sbjct: 118 KGLVDEISATIILQDYM 134


>gi|327312426|ref|YP_004327863.1| RNAse H domain-containing protein, YqgF family [Prevotella
           denticola F0289]
 gi|326944800|gb|AEA20685.1| RNAse H domain protein, YqgF family [Prevotella denticola F0289]
          Length = 139

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/137 (29%), Positives = 64/137 (46%), Gaps = 6/137 (4%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR GLA++DP R  A+    +    +         +I TE +   +IG 
Sbjct: 1   MGRILAIDYGKKRTGLAVTDPLRIIANGLATVATSGLFDFLT---QYIGTETVEQLVIGR 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--- 132
           P+  +G     +     FV+        +P  ++DER T+V A Q +I   V +K R   
Sbjct: 58  PVQPDGRPSENLGRVEQFVNRWRKAHPELPVDYYDERFTSVIAHQAMIAGGVKKKTRREN 117

Query: 133 IQKVDSIAAALILQEVL 149
              VD I+A +ILQ+ +
Sbjct: 118 KGLVDEISATIILQDYM 134


>gi|304391702|ref|ZP_07373644.1| putative Holliday junction resolvase [Ahrensia sp. R2A130]
 gi|303295931|gb|EFL90289.1| putative Holliday junction resolvase [Ahrensia sp. R2A130]
          Length = 160

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 58/151 (38%), Positives = 83/151 (54%), Gaps = 1/151 (0%)

Query: 5   LIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFIT 64
            +     +L+ +  +  IDLGTK IGLAISD     + P   + R K T     +L F T
Sbjct: 8   ELAQFADALQGSGRLLGIDLGTKTIGLAISDENWAISSPVRTIKRTKFTPDVQAMLEFAT 67

Query: 65  TENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID 124
            E ++  +IGLPLNM+GSEGPR  S+RAF    + R   +P   WDE L+T  A + +  
Sbjct: 68  AERVSGIVIGLPLNMDGSEGPRAQSSRAFAR-NLSRLTELPIQLWDESLSTSEALEGVSA 126

Query: 125 MNVSRKKRIQKVDSIAAALILQEVLDRISFL 155
              ++ K   K+D++AA+LILQ   D +  L
Sbjct: 127 KKAAQMKADGKLDALAASLILQGCCDAMRAL 157


>gi|268608523|ref|ZP_06142250.1| Holliday junction resolvase YqgF [Ruminococcus flavefaciens FD-1]
          Length = 143

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/134 (30%), Positives = 60/134 (44%), Gaps = 1/134 (0%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I S+D G  R G+A+       A P   +  K   +   +  +    +     ++G P N
Sbjct: 3   IMSVDFGDARTGIAVCGKSEMIASPVTVIPEKDFDKCIEKTAALAKEQRAEQIVVGYPKN 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           MNG+ G R      F    ++    +P   WDER TTVSA   L   N   KKR   VD+
Sbjct: 63  MNGTIGERCEKCTLFAE-KLEEMTGIPTRLWDERCTTVSAHNYLNVTNTRGKKRKNVVDA 121

Query: 139 IAAALILQEVLDRI 152
           +AA +IL+  L+  
Sbjct: 122 VAAVIILESYLEYR 135


>gi|118597218|sp|Q6MD02|RUVX_PARUW RecName: Full=Putative Holliday junction resolvase
          Length = 150

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 48/150 (32%), Positives = 74/150 (49%), Gaps = 8/150 (5%)

Query: 10  VKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA-------LELLSF 62
           +++      I  ID G  RIGLA SD  +  A P   +  +K ++         +  L  
Sbjct: 1   MENKPKPSRILGIDFGMSRIGLAQSDERKIIAMPLITVHTEKKSEQTVIKLLETISQLCE 60

Query: 63  ITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL 122
                I   +IGLPL M+G  G      + F   ++ +   +P   WDERLTTV A++ L
Sbjct: 61  TQKCEIEEIVIGLPLMMSGRTGFLADEVKHFAQ-LLQQLTPIPIRLWDERLTTVQAERSL 119

Query: 123 IDMNVSRKKRIQKVDSIAAALILQEVLDRI 152
            +  ++RKKR + VD ++A++ILQ  LD  
Sbjct: 120 RESQLTRKKRSKVVDIVSASIILQSYLDSR 149


>gi|169350060|ref|ZP_02866998.1| hypothetical protein CLOSPI_00800 [Clostridium spiroforme DSM 1552]
 gi|169293273|gb|EDS75406.1| hypothetical protein CLOSPI_00800 [Clostridium spiroforme DSM 1552]
          Length = 139

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 67/137 (48%), Gaps = 2/137 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK--KVTQTALELLSFITTENIAAFII 73
            + I  +DLG++  G+A+SD     AH             Q A  ++  I    I   ++
Sbjct: 1   MEKILGLDLGSRTCGIAMSDALGMLAHGLETYRFNDGNYKQAANYVVEIINKNQIKTVVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP +MNG  G R   +  F   +  +   +  V  DERLTT  AQ  LI  +VSRKKR 
Sbjct: 61  GLPKHMNGDLGERAQISIMFKEMLEKKVAGLNVVLVDERLTTKVAQDRLIFADVSRKKRK 120

Query: 134 QKVDSIAAALILQEVLD 150
           Q +D +AA  ILQ  LD
Sbjct: 121 QVIDKMAAVAILQGYLD 137


>gi|161870210|ref|YP_001599380.1| Holliday junction resolvase-like protein [Neisseria meningitidis
           053442]
 gi|189046101|sp|A9LZR5|RUVX_NEIM0 RecName: Full=Putative Holliday junction resolvase
 gi|161595763|gb|ABX73423.1| Putative Holliday junction resolvase [Neisseria meningitidis
           053442]
          Length = 151

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 35/136 (25%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P     + D G  RIG+A  D     +HP   +      +    +   +       F++G
Sbjct: 5   PKGTALAFDFGETRIGVAQGDAELGLSHPLSTVTGGSNDEKFAAIAKLVQEWQPRYFVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G++    H +R F    ++ +  +P  + DERL++V A+ +L +  V  KKR  
Sbjct: 65  LPVHTDGTKHEMTHLSRKFGR-RLNGRFNLPVYWVDERLSSVYAESLLSEAQVFGKKRKS 123

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA  IL    +
Sbjct: 124 VLDQVAAQAILHGFFE 139


>gi|116514509|ref|YP_813415.1| Holliday junction resolvase-like protein [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
 gi|122274759|sp|Q048Z5|RUVX_LACDB RecName: Full=Putative Holliday junction resolvase
 gi|116093824|gb|ABJ58977.1| RNase H-like ribonuclease [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
          Length = 142

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 44/138 (31%), Positives = 75/138 (54%), Gaps = 5/138 (3%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             +  +D+G+K IG+A+SDP    A     +   +         L   +       F++G
Sbjct: 1   MRLLGLDVGSKTIGVAVSDPLGITAQAVMTIPIDEDRHNFGMRSLKKLVREYEANGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVS-RKKR 132
           LP NM+G+ G  V  ++A     +++K  +P  + DERLTTV++++IL+ +  +  R++R
Sbjct: 61  LPKNMDGTAGRSVSRSKAMGE-RLEQKFGLPVYYDDERLTTVASERILVEEAGMHDRRQR 119

Query: 133 IQKVDSIAAALILQEVLD 150
            + VD +AA LILQ  LD
Sbjct: 120 KEVVDQMAAVLILQNYLD 137


>gi|190149502|ref|YP_001968027.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307262821|ref|ZP_07544446.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|226725478|sp|B3H073|RUVX_ACTP7 RecName: Full=Putative Holliday junction resolvase
 gi|189914633|gb|ACE60885.1| putative Holliday junction resolvase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|306871836|gb|EFN03555.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 137

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 39/134 (29%), Positives = 63/134 (47%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + I + D GT  IG A+       A   P    +       ++   I        ++GLP
Sbjct: 3   RTILAFDFGTYSIGCAVGQDITGTAQGLPSFKAQDGIPNWDQIEKVIKEWQPERLVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+G+E P     + F +  ++ +  +P    DERLTTVSA+  + +    +  +  KV
Sbjct: 63  LNMDGTEQPLTQRAKKFAN-RLNGRFNLPVELQDERLTTVSAKAEIFERGGYKALKKDKV 121

Query: 137 DSIAAALILQEVLD 150
           DSI+A LIL+   +
Sbjct: 122 DSISACLILESWFE 135


>gi|50122846|ref|YP_052013.1| Holliday junction resolvase-like protein [Pectobacterium
           atrosepticum SCRI1043]
 gi|62900970|sp|Q6D075|RUVX_ERWCT RecName: Full=Putative Holliday junction resolvase
 gi|49613372|emb|CAG76823.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 139

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 35/136 (25%), Positives = 61/136 (44%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            N+ + + D GTK IG+AI       A        ++      ++   ++       ++G
Sbjct: 2   SNRTLLAFDFGTKSIGVAIGQEITGTARALTSFKAQEGIPDWQKVEKLLSEWQPDLVVVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPLNM+G+E P     R F +  +  +  V     DERL+TV A+  L +    +     
Sbjct: 62  LPLNMDGTEQPLTARARKFAN-RLHGRFGVAIELHDERLSTVEARADLFERGGFKALDKG 120

Query: 135 KVDSIAAALILQEVLD 150
            VD+ +A +IL+   +
Sbjct: 121 SVDAASAVIILESWFE 136


>gi|322436322|ref|YP_004218534.1| Holliday junction resolvase YqgF [Acidobacterium sp. MP5ACTX9]
 gi|321164049|gb|ADW69754.1| Holliday junction resolvase YqgF [Acidobacterium sp. MP5ACTX9]
          Length = 143

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 44/134 (32%), Positives = 70/134 (52%), Gaps = 2/134 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I ++D+G  RIG+A++DP    A P   L RK   + A  LL  I    +   ++G P
Sbjct: 4   GRIMALDVGKARIGIALTDPLGYTAQPLLTLWRKTRNEDARSLLRLIRKHEVTHLVVGNP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSR-KKRIQK 135
           L+++G   P       F   + +R   +P   WDERL++V+A +IL +   +R K R   
Sbjct: 64  LHLSGDLSPFAAKVHEFAEYLRER-TEIPIQLWDERLSSVAANEILDEAGHARGKDRKFI 122

Query: 136 VDSIAAALILQEVL 149
           +D +AA LIL+  +
Sbjct: 123 IDQVAAVLILEGWM 136


>gi|238918247|ref|YP_002931761.1| hypothetical protein NT01EI_0284 [Edwardsiella ictaluri 93-146]
 gi|259495703|sp|C5BCS0|RUVX_EDWI9 RecName: Full=Putative Holliday junction resolvase
 gi|238867815|gb|ACR67526.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 140

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 39/135 (28%), Positives = 58/135 (42%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + I + D GT+ IG AI       A P              ++   +        ++GLP
Sbjct: 4   RTILAFDFGTRSIGCAIGQELTGSARPLQSFKANDGVPDWQQIEKVLREWQPDLVVVGLP 63

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+GSE P     R F +  +  +  V     DERL+TV A+  L      R     +V
Sbjct: 64  LNMDGSEQPLTQQARKFAN-RLHGRFGVQIALQDERLSTVEARAHLFAGGGYRALEKGRV 122

Query: 137 DSIAAALILQEVLDR 151
           D+ +AALIL+   + 
Sbjct: 123 DAASAALILESWFEN 137


>gi|104774411|ref|YP_619391.1| putative Hollyday junction resolvase [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC 11842]
 gi|118597212|sp|Q1G949|RUVX_LACDA RecName: Full=Putative Holliday junction resolvase
 gi|103423492|emb|CAI98394.1| Putative Hollyday junction resolvase [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC 11842]
          Length = 142

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 44/138 (31%), Positives = 75/138 (54%), Gaps = 5/138 (3%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIG 74
             +  +D+G+K IG+A+SDP    A     +   +         L   +       F++G
Sbjct: 1   MRLLGLDVGSKTIGVAVSDPLGITAQSVMTIPIDEDRHNFGMRSLKKLVREYEANGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVS-RKKR 132
           LP NM+G+ G  V  ++A     +++K  +P  + DERLTTV++++IL+ +  +  R++R
Sbjct: 61  LPKNMDGTAGRSVSRSKAMGE-RLEQKFGLPVYYDDERLTTVASERILVEEAGMHDRRQR 119

Query: 133 IQKVDSIAAALILQEVLD 150
            + VD +AA LILQ  LD
Sbjct: 120 KEVVDQMAAVLILQNYLD 137


>gi|221195852|ref|ZP_03568905.1| conserved hypothetical protein [Atopobium rimae ATCC 49626]
 gi|221184326|gb|EEE16720.1| conserved hypothetical protein [Atopobium rimae ATCC 49626]
          Length = 140

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 45/135 (33%), Positives = 68/135 (50%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             + ++D+G  R+G+A+SDP  R A P   L  ++V   A    S +        + G P
Sbjct: 1   MRVLALDIGDARVGIAVSDPDGRIASPVCVLPAQEVFSHARSFRSVLEDWEPELLVCGKP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           L ++G EGP+          + DR   +P    DERL++  A++IL    +S K    KV
Sbjct: 61  LTLSGEEGPQAQKIMEQAKKIADR-TGLPVELTDERLSSSEAKRILRAQGLSEKTMRGKV 119

Query: 137 DSIAAALILQEVLDR 151
           D +AA+L LQ  LDR
Sbjct: 120 DMVAASLFLQAWLDR 134


>gi|167563836|ref|ZP_02356752.1| Holliday junction resolvase-like protein [Burkholderia oklahomensis
           EO147]
          Length = 146

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 38/147 (25%), Positives = 63/147 (42%), Gaps = 5/147 (3%)

Query: 11  KSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAA 70
            +L  +  + + D G KRIG+A+ +   R A     +           +   I      A
Sbjct: 3   AALSRDATLLAFDYGEKRIGVAVGNMLTRTARALVIVPNLNREHRFKAVGELIAEWKPDA 62

Query: 71  FIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRK 130
            ++GLPL+ +G+        + F + M  R   +P  + DER ++V A+  L     S  
Sbjct: 63  LVVGLPLHPDGAPHEMTQQAKRFGNQMNGR-FNLPVSWVDERYSSVEARADLRARG-SGA 120

Query: 131 KRIQKVDSIAAALILQEVLDRISFLES 157
            R   VD+ AA +ILQ+ LD +     
Sbjct: 121 DR---VDAEAARIILQQYLDELPDHHE 144


>gi|325298806|ref|YP_004258723.1| Holliday junction resolvase [Bacteroides salanitronis DSM 18170]
 gi|324318359|gb|ADY36250.1| Holliday junction resolvase [Bacteroides salanitronis DSM 18170]
          Length = 139

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 39/142 (27%), Positives = 66/142 (46%), Gaps = 5/142 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A++DP +  A     +   ++    L    ++  E +   IIG 
Sbjct: 1   MSRILAIDYGKKRTGIAVTDPMQVIASGLTTVPTHQLMDFLL---GYVRQEAVERIIIGH 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN  +   +     F++ +  +   +P   +DER T+V A Q ++   + +K R   
Sbjct: 58  PKQMNNEDSENMKRIVPFMNQLKKKLPDMPVELYDERFTSVLAHQAMLAGGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISFL 155
             VD I+A +ILQ  L+    L
Sbjct: 118 ALVDEISATIILQSYLEAKRGL 139


>gi|320101933|ref|YP_004177524.1| Holliday junction resolvase YqgF [Isosphaera pallida ATCC 43644]
 gi|319749215|gb|ADV60975.1| Holliday junction resolvase YqgF [Isosphaera pallida ATCC 43644]
          Length = 183

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 43/139 (30%), Positives = 76/139 (54%), Gaps = 5/139 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVR----KKVTQTALELLSFITTENIAAF 71
              I ++D G KR+GLAISDPGR  A P   L R       T     L   +    +   
Sbjct: 1   MGTILALDHGLKRVGLAISDPGRSIASPLGRLERPGGEAGFTTEIQTLKRLVREHGVDRL 60

Query: 72  IIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           ++GLP++ +G + P+  + R +   +  +++ +  ++ DER +T  A +++ +  +S  K
Sbjct: 61  VMGLPVHTSGRDSPQARAARQWGDRV-AKELGLTIIYVDERYSTKHADELMREAGLSAAK 119

Query: 132 RIQKVDSIAAALILQEVLD 150
           R ++VDS+AA +IL++ LD
Sbjct: 120 RKRRVDSLAAVVILRDYLD 138


>gi|146305439|ref|YP_001185904.1| Holliday junction resolvase-like protein [Pseudomonas mendocina
           ymp]
 gi|145573640|gb|ABP83172.1| Holliday junction resolvase YqgF [Pseudomonas mendocina ymp]
          Length = 144

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 41/138 (29%), Positives = 62/138 (44%), Gaps = 1/138 (0%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
           KP + +   D GTK+IG+A+       A     L  +        + + I      A ++
Sbjct: 4   KPVRLLLGFDYGTKQIGVAVGQVITGQARELCVLKAQNGVPDWNRVEALIKEWQPDAVVV 63

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLPLNM+G+          F    ++    +P    DERLTT  A+   +    S   R 
Sbjct: 64  GLPLNMDGTPSEMSARAEKFAR-RLNGHFNLPAYTHDERLTTFEAKGQRLREGQSGGYRE 122

Query: 134 QKVDSIAAALILQEVLDR 151
           + VD+IAAAL+LQ  L+ 
Sbjct: 123 RPVDAIAAALLLQGWLEE 140


>gi|32034409|ref|ZP_00134591.1| COG0816: Predicted endonuclease involved in recombination (possible
           Holliday junction resolvase in Mycoplasmas and B.
           subtilis) [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|126207719|ref|YP_001052944.1| Holliday junction resolvase-like protein [Actinobacillus
           pleuropneumoniae L20]
 gi|165975691|ref|YP_001651284.1| Holliday junction resolvase-like protein [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|303251647|ref|ZP_07337820.1| Holliday junction resolvase-like protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303252798|ref|ZP_07338958.1| Holliday junction resolvase-like protein [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307245044|ref|ZP_07527138.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307247216|ref|ZP_07529266.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307251761|ref|ZP_07533664.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307253998|ref|ZP_07535846.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307258453|ref|ZP_07540191.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307260688|ref|ZP_07542378.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|167012686|sp|A3MYV3|RUVX_ACTP2 RecName: Full=Putative Holliday junction resolvase
 gi|226725479|sp|B0BSN8|RUVX_ACTPJ RecName: Full=Putative Holliday junction resolvase
 gi|126096511|gb|ABN73339.1| putative Holliday junction resolvase [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|165875792|gb|ABY68840.1| putative Holliday junction resolvase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|302648359|gb|EFL78555.1| Holliday junction resolvase-like protein [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302649489|gb|EFL79672.1| Holliday junction resolvase-like protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306854032|gb|EFM86243.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306856274|gb|EFM88427.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306860762|gb|EFM92772.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306863024|gb|EFM94970.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306867458|gb|EFM99308.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306869609|gb|EFN01396.1| Holliday junction resolvase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 137

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 40/134 (29%), Positives = 63/134 (47%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + I + D GT  IG A+       A   P    +       ++   I        ++GLP
Sbjct: 3   RTILAFDFGTYSIGCAVGQDITGTAQGLPSFKAQDGIPNWDQIEKVIKEWQPERLVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+GSE P     + F +  ++ +  +P    DERLTTVSA+  + +    +  +  KV
Sbjct: 63  LNMDGSEQPLTQRAKKFAN-RLNGRFNLPVELQDERLTTVSAKAEIFERGGYKALKKDKV 121

Query: 137 DSIAAALILQEVLD 150
           DSI+A LIL+   +
Sbjct: 122 DSISACLILESWFE 135


>gi|229593127|ref|YP_002875246.1| Holliday junction resolvase-like protein [Pseudomonas fluorescens
           SBW25]
 gi|312963615|ref|ZP_07778096.1| putative Holliday junction resolvase [Pseudomonas fluorescens WH6]
 gi|259495710|sp|C3K3K0|RUVX_PSEFS RecName: Full=Putative Holliday junction resolvase
 gi|229364993|emb|CAY53130.1| putative holliday junction resolvase [Pseudomonas fluorescens
           SBW25]
 gi|311282124|gb|EFQ60724.1| putative Holliday junction resolvase [Pseudomonas fluorescens WH6]
          Length = 145

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 43/138 (31%), Positives = 62/138 (44%), Gaps = 2/138 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           I   D GTK+IG+A+       A     L  +       ++ + I      A ++GLPLN
Sbjct: 6   ILGFDYGTKQIGVAVGQVITGQARELCTLKAQNGIPDWNQVEALIKEWKPDAVVVGLPLN 65

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNV-SRKKRIQKVD 137
           M+G+          F    ++ +  +PF   DERLTT  A+    D        R   VD
Sbjct: 66  MDGTPSDMCLRAEKFAR-RLNGRYNIPFYTHDERLTTFEAKGERRDRGGQKGSYRDNPVD 124

Query: 138 SIAAALILQEVLDRISFL 155
           +IAAAL+LQ  LD  + L
Sbjct: 125 AIAAALLLQGWLDENTAL 142


>gi|300726437|ref|ZP_07059885.1| conserved hypothetical protein [Prevotella bryantii B14]
 gi|299776285|gb|EFI72847.1| conserved hypothetical protein [Prevotella bryantii B14]
          Length = 139

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 37/142 (26%), Positives = 63/142 (44%), Gaps = 6/142 (4%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I SID G KR GLA++DP +  A+    +    +        ++   E +   I+G 
Sbjct: 1   MGRILSIDYGKKRTGLAVTDPMQIIANGLTTVSTVDLWDFL---QNYCKKEGVERIIMGK 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--- 132
           P   NG     +     F +        +P  ++DER T+V A + +ID  V +K R   
Sbjct: 58  PTQPNGLPSENMGRVENFYNRWHKAHPEIPIEYYDERFTSVIAHRAMIDGGVKKKVRREN 117

Query: 133 IQKVDSIAAALILQEVLDRISF 154
              VD ++A +IL++ +    +
Sbjct: 118 KGLVDEVSATIILEDWMSSHRY 139


>gi|296139684|ref|YP_003646927.1| Holliday junction resolvase YqgF [Tsukamurella paurometabola DSM
           20162]
 gi|296027818|gb|ADG78588.1| Holliday junction resolvase YqgF [Tsukamurella paurometabola DSM
           20162]
          Length = 161

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 40/143 (27%), Positives = 57/143 (39%), Gaps = 5/143 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
                ++D+G  RIG+A+SDP    A P   +   +       +   +T       +IGL
Sbjct: 9   RGRRLALDVGKARIGVAVSDPDGILATPVETVKAARDGSDLRRIAQLVTDYEPVEIVIGL 68

Query: 76  PLNMNGSEGPRVHSTRAFVHN-----MIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRK 130
           P  + G  G        F            +      F DER TTV+AQ+ L D  V  K
Sbjct: 69  PRTLRGDRGESARMAEGFAARLATVLDATDQPSPRVCFSDERFTTVTAQRALRDNGVRAK 128

Query: 131 KRIQKVDSIAAALILQEVLDRIS 153
           ++   +D  AA  ILQ  LD   
Sbjct: 129 EQRAVIDQAAAVAILQGWLDERR 151


>gi|313897358|ref|ZP_07830901.1| RNAse H domain protein, YqgF family [Clostridium sp. HGF2]
 gi|312957728|gb|EFR39353.1| RNAse H domain protein, YqgF family [Clostridium sp. HGF2]
          Length = 137

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK--KVTQTALELLSFITTENIAAFIIG 74
             I  +DLG+K +G+++SD     A P   +  +         ++  +I    +   ++G
Sbjct: 1   MRILGLDLGSKTLGVSVSDALGMIARPVETIRFESDDYEAACKQVQPYIKEFQVKTAVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP +MNG  G R   +  F   +    + +  V WDERLTTV+A++ILI  +VSRKKR +
Sbjct: 61  LPKHMNGDVGIRGEISLMFKEKL--EALGLEVVLWDERLTTVAAEKILISADVSRKKRKK 118

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA  ILQ  LD 
Sbjct: 119 IIDQMAAVQILQSYLDS 135


>gi|87307204|ref|ZP_01089349.1| hypothetical protein DSM3645_16815 [Blastopirellula marina DSM
           3645]
 gi|87289944|gb|EAQ81833.1| hypothetical protein DSM3645_16815 [Blastopirellula marina DSM
           3645]
          Length = 159

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 45/139 (32%), Positives = 72/139 (51%), Gaps = 1/139 (0%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           +     IA ID GT RIG+AI+DP R  A P     R+ +             E I  F+
Sbjct: 9   IPTVGRIAGIDFGTVRIGVAITDPDRILASPFENYTRRSLKIDRQYFEELAKLERIVLFV 68

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLP++M+G+E  +    R F    + R   VP V++DER TT  A+  L  + ++++K+
Sbjct: 69  VGLPVHMSGNESGKSGEARKFGQW-LGRITGVPIVYYDERFTTSIAKDYLAGLGMTKQKK 127

Query: 133 IQKVDSIAAALILQEVLDR 151
              +D +AA ++L   L+ 
Sbjct: 128 KAVIDKLAAQILLTAYLEN 146


>gi|126657653|ref|ZP_01728808.1| Holliday junction resolvase-like protein [Cyanothece sp. CCY0110]
 gi|126621109|gb|EAZ91823.1| Holliday junction resolvase-like protein [Cyanothece sp. CCY0110]
          Length = 143

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 42/140 (30%), Positives = 67/140 (47%), Gaps = 3/140 (2%)

Query: 16  NQPI--ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
            + I    +D+G KRIG+A  D     A     + R+   Q   +L + +T       +I
Sbjct: 1   MERISALGLDVGKKRIGVAGCDGTGLIATGLTTIERQSFPQDVQQLQTLVTEREAQLLVI 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP +M+GS G +    + F    I + + +P  + DERLT+V A+  L       +   
Sbjct: 61  GLPYSMDGSIGFQAKQVQKFAK-RISKALELPVEYIDERLTSVEAETKLKAQKKYSRHNK 119

Query: 134 QKVDSIAAALILQEVLDRIS 153
             VD +AA +ILQ+ LD+  
Sbjct: 120 GLVDRLAATIILQQWLDQRR 139


>gi|91782034|ref|YP_557240.1| Holliday junction resolvase-like protein [Burkholderia xenovorans
           LB400]
 gi|296160318|ref|ZP_06843136.1| Holliday junction resolvase YqgF [Burkholderia sp. Ch1-1]
 gi|118597203|sp|Q144Q1|RUVX_BURXL RecName: Full=Putative Holliday junction resolvase
 gi|91685988|gb|ABE29188.1| Conserved hypothetical protein 250 [Burkholderia xenovorans LB400]
 gi|295889529|gb|EFG69329.1| Holliday junction resolvase YqgF [Burkholderia sp. Ch1-1]
          Length = 146

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 33/139 (23%), Positives = 65/139 (46%), Gaps = 5/139 (3%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
               + + D G KRIG+A+ +   + A P   +  +        +   I      A ++G
Sbjct: 7   REATLLAFDYGEKRIGVAVGNSLTKSARPLVIVQNRSREYRFEAVGKLIAEWKPNALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+        + F +  ++ +  +P  + DER ++V A+  +   N     R  
Sbjct: 67  LPMHPDGTPHEMTQLAKRFGN-QLNGRFNLPVTWIDERYSSVEAKAEIRAGNG----RAD 121

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D+ AA++ILQ+ LD +S
Sbjct: 122 MLDAEAASIILQQYLDGLS 140


>gi|209518623|ref|ZP_03267441.1| Holliday junction resolvase YqgF [Burkholderia sp. H160]
 gi|209500906|gb|EEA00944.1| Holliday junction resolvase YqgF [Burkholderia sp. H160]
          Length = 146

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 66/139 (47%), Gaps = 5/139 (3%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
               + + D G KRIG+A+ +   R A P   +  +        L   I      A ++G
Sbjct: 7   REATLLAFDYGEKRIGVAVGNSLTRRARPLVVVQNRSKEYRFEALGKLIAEWKPDALVVG 66

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+   R    + F +  ++ +  +P  + DER ++V A+  +   N     R  
Sbjct: 67  LPMHPDGTPHERTQLAKRFGN-QLNGRFNLPVTWVDERYSSVEAEAEIRAGN----ARAD 121

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D+ AA++ILQ+ LD ++
Sbjct: 122 MLDAEAASIILQQYLDGLT 140


>gi|257870135|ref|ZP_05649788.1| conserved hypothetical protein [Enterococcus gallinarum EG2]
 gi|257804299|gb|EEV33121.1| conserved hypothetical protein [Enterococcus gallinarum EG2]
          Length = 140

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 44/134 (32%), Positives = 74/134 (55%), Gaps = 4/134 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTA--LELLSFITTENIAAFIIGLPL 77
             +D+G++ +G+A+SDP    A     +   +         L   +    +  F++GLP 
Sbjct: 1   MGLDVGSRTVGVAVSDPMGWTAQGIEIIRINEDENDFGYDRLGELVKEYEVTRFVVGLPK 60

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRIQKV 136
           NMN + GPR  ++ A+    I+ +  +P  + DERLTTV A+++L++  N SR KR + +
Sbjct: 61  NMNNTIGPRAEASLAYGK-AIEERFDLPVDYQDERLTTVQAERMLVEQANTSRAKRKKVI 119

Query: 137 DSIAAALILQEVLD 150
           D +AA +ILQ  LD
Sbjct: 120 DKLAAVMILQNYLD 133


>gi|297537845|ref|YP_003673614.1| Holliday junction resolvase YqgF [Methylotenera sp. 301]
 gi|297257192|gb|ADI29037.1| Holliday junction resolvase YqgF [Methylotenera sp. 301]
          Length = 164

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 30/133 (22%), Positives = 59/133 (44%), Gaps = 1/133 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             +   D G +RIG+A+ +     A+P   +  +        +   +        I+GLP
Sbjct: 30  STVLCFDFGEQRIGVAVGEHLLASANPLVTIDNESNEVRFEAISKLVKEWQPKLLIVGLP 89

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           L+++G+E       + F    ++ +  +P V  DER ++V A  +L    +  + + + +
Sbjct: 90  LSLDGAETSVTQLCKKFAR-RLNGRFNLPVVLIDERYSSVEASDLLNQSGIKGRAQKEML 148

Query: 137 DSIAAALILQEVL 149
           D +AA  ILQ   
Sbjct: 149 DQVAAQTILQSYF 161


>gi|224023748|ref|ZP_03642114.1| hypothetical protein BACCOPRO_00464 [Bacteroides coprophilus DSM
           18228]
 gi|224016970|gb|EEF74982.1| hypothetical protein BACCOPRO_00464 [Bacteroides coprophilus DSM
           18228]
          Length = 142

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 38/142 (26%), Positives = 69/142 (48%), Gaps = 5/142 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A++DP +  A+    +   ++    L    ++T E++   I+G 
Sbjct: 1   MSRIIAIDYGRKRTGIAVTDPMQIIANGLTTVPTHQLMDFLL---KYVTQESVERIIVGH 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR--I 133
           P  MN  +   + +   F++ +  +   +P    DER T+V A Q ++   + +K R   
Sbjct: 58  PKQMNNEDSENMKNIIPFINQLKKKLPKIPVELVDERFTSVLAHQAMLAGGLKKKDRQNK 117

Query: 134 QKVDSIAAALILQEVLDRISFL 155
             VD I+A +ILQ  L+    +
Sbjct: 118 ALVDEISATIILQSYLEGKRNM 139


>gi|289643075|ref|ZP_06475206.1| Holliday junction resolvase YqgF [Frankia symbiont of Datisca
           glomerata]
 gi|289507119|gb|EFD28087.1| Holliday junction resolvase YqgF [Frankia symbiont of Datisca
           glomerata]
          Length = 164

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 45/132 (34%), Positives = 63/132 (47%), Gaps = 1/132 (0%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVR-KKVTQTALELLSFITTENIAAFIIGLPLN 78
             ID+GT RIG+A SDP  R A P   L R  ++     E+   +   +    ++GLP  
Sbjct: 9   VGIDVGTVRIGVAASDPDARIAFPVTTLRRGTRLNSDLDEIAMIVRDRHAVEVVVGLPTR 68

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDS 138
           ++G  GP     R +   +  R   VP    DERLTTV A + + +  +  + R   VD 
Sbjct: 69  LSGLPGPAARKAREYADLLAARVAPVPVRLVDERLTTVVAHRRMAERGLRARDRRAVVDQ 128

Query: 139 IAAALILQEVLD 150
            AA  ILQ  LD
Sbjct: 129 EAAVQILQSALD 140


>gi|261823143|ref|YP_003261249.1| Holliday junction resolvase-like protein [Pectobacterium wasabiae
           WPP163]
 gi|261607156|gb|ACX89642.1| Holliday junction resolvase YqgF [Pectobacterium wasabiae WPP163]
          Length = 139

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 61/135 (45%), Gaps = 1/135 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           N+ + + D GTK IG+AI       A        ++      ++   ++       ++GL
Sbjct: 3   NRTLLAFDFGTKSIGVAIGQEITGTARALTSFKAQEGIPDWQKVEKLLSEWQPDLVVVGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  +  +  V     DERL+TV A+  L +    +      
Sbjct: 63  PLNMDGTEQPLTARARKFAN-RLHGRFGVAIELHDERLSTVEARADLFERGGFKALDKGS 121

Query: 136 VDSIAAALILQEVLD 150
           VD+ +A +IL+   +
Sbjct: 122 VDAASAVIILESWFE 136


>gi|116333831|ref|YP_795358.1| Holliday junction resolvase-like protein [Lactobacillus brevis ATCC
           367]
 gi|122269482|sp|Q03R45|RUVX_LACBA RecName: Full=Putative Holliday junction resolvase
 gi|116099178|gb|ABJ64327.1| RNase H-like ribonuclease [Lactobacillus brevis ATCC 367]
          Length = 145

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 47/146 (32%), Positives = 80/146 (54%), Gaps = 4/146 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT--ALELLSFITTENIAAFIIG 74
             +  +D+G++ +G+A+SD     A     +   +  +      +   I + ++  F++G
Sbjct: 1   MKLMGLDVGSRTVGVAVSDALGWTAQGVEIIRINEDEEQFGLDRVGELIASHDVQGFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN S GPR  +++ +    +  +  +P  F DERLTTV A+++L++  + SR+KR 
Sbjct: 61  LPKNMNNSLGPRAEASKRYGDM-LTARFNLPVDFEDERLTTVEAERMLVEQADTSRRKRK 119

Query: 134 QKVDSIAAALILQEVLDRISFLESSK 159
           Q +D +AA LILQ  LDR   L   K
Sbjct: 120 QVIDKLAAGLILQNYLDRHGKLTREK 145


>gi|257784263|ref|YP_003179480.1| Holliday junction resolvase YqgF [Atopobium parvulum DSM 20469]
 gi|257472770|gb|ACV50889.1| Holliday junction resolvase YqgF [Atopobium parvulum DSM 20469]
          Length = 140

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 41/134 (30%), Positives = 64/134 (47%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             + ++D+G  RIG+A+SDP    A P   L  ++V   A    + +        + G P
Sbjct: 1   MRVLALDIGEVRIGVAVSDPDGAIASPVCVLPAQEVLSHARTFKTVLEDWEPELLLCGRP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
             + G +GP+           I +   +P  F DERL++  A++IL    +S K    KV
Sbjct: 61  KTLAGEDGPQAQKITVQAE-QIAKNCQLPLEFTDERLSSAEAKKILRAQGLSEKAMRGKV 119

Query: 137 DSIAAALILQEVLD 150
           D +AA+L LQ  LD
Sbjct: 120 DMVAASLFLQSWLD 133


>gi|256545147|ref|ZP_05472513.1| Holliday junction resolvase [Anaerococcus vaginalis ATCC 51170]
 gi|256399188|gb|EEU12799.1| Holliday junction resolvase [Anaerococcus vaginalis ATCC 51170]
          Length = 139

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 52/139 (37%), Positives = 78/139 (56%), Gaps = 1/139 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I  +DLG K IG+A+SDP    A     + RKK +    +L+  I  + +   IIGL
Sbjct: 1   MSRIMGLDLGDKTIGVALSDPFFITAQAYITIKRKKASLDIEKLIEIINEKEVNLIIIGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + GP+     +FV  ++ +   +   + DER+TT+ + Q+L+DMNV+ K R + 
Sbjct: 61  PKNMNNTLGPQAMKVISFVD-LLKKSTDIEIKYQDERMTTIQSDQVLMDMNVNLKDRKKY 119

Query: 136 VDSIAAALILQEVLDRISF 154
           VD IAA+ ILQ  LD  + 
Sbjct: 120 VDKIAASFILQTYLDGRNN 138


>gi|315641319|ref|ZP_07896395.1| crossover junction endodeoxyribonuclease [Enterococcus italicus DSM
           15952]
 gi|315482892|gb|EFU73412.1| crossover junction endodeoxyribonuclease [Enterococcus italicus DSM
           15952]
          Length = 145

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 44/137 (32%), Positives = 74/137 (54%), Gaps = 4/137 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             I  +D+G++ +G+A+SDP    A     +     +       +        I  F++G
Sbjct: 1   MRIMGLDVGSRTVGIAVSDPMGWTAQGIEIIKINEDEDNFGFDRVKELADQYEIGHFVVG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVSRKKRI 133
           LP NMN + GPR  ++ ++    +++   +P  + DERLTTV A+++LI+  N SR KR 
Sbjct: 61  LPKNMNNTIGPRAEASMSYGE-KLEQLFGLPVSYQDERLTTVQAERMLIEQANASRAKRK 119

Query: 134 QKVDSIAAALILQEVLD 150
           + +D +AA +ILQ  LD
Sbjct: 120 KVIDKLAAVMILQNFLD 136


>gi|260893291|ref|YP_003239388.1| Holliday junction resolvase YqgF [Ammonifex degensii KC4]
 gi|260865432|gb|ACX52538.1| Holliday junction resolvase YqgF [Ammonifex degensii KC4]
          Length = 146

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 42/137 (30%), Positives = 70/137 (51%), Gaps = 2/137 (1%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I ++D+G K IG+A+SDP    A     L R +  +    +L       +   +IGLP
Sbjct: 1   MRILALDVGDKTIGVAVSDPFGLTAQGLKVLHRGEEAEDVQHVLELARRYEVEEVVIGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
             + G  GP+      F    +  +  +  ++WDER TT  A+++L+  +VSRKKR +  
Sbjct: 61  RTLAGEIGPQAQKVLRFGE--LLAQQGLKIIYWDERFTTKEAEKVLLAADVSRKKRRRVK 118

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA L+L+  L++  
Sbjct: 119 DILAAVLLLEAYLEKRR 135


>gi|153005395|ref|YP_001379720.1| Holliday junction resolvase-like protein [Anaeromyxobacter sp.
           Fw109-5]
 gi|167012689|sp|A7HDE0|RUVX_ANADF RecName: Full=Putative Holliday junction resolvase
 gi|152028968|gb|ABS26736.1| Holliday junction resolvase YqgF [Anaeromyxobacter sp. Fw109-5]
          Length = 137

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 46/134 (34%), Positives = 68/134 (50%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
                +DLG  RIGLA++D   R A P   +  +        + + +    +   ++GLP
Sbjct: 1   MRYLGLDLGRARIGLALADDVLRTARPLSVVRHRTREADLASIAATLREWEVGTAVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+GSEG      RAF    + R   VP   +DERL+T  A+  L +   S ++   +V
Sbjct: 61  LNMDGSEGASARYARAFAE-ELARATGVPVELFDERLSTFEAESRLREQGFSARELRGRV 119

Query: 137 DSIAAALILQEVLD 150
           D+ AAA+ILQ  LD
Sbjct: 120 DAEAAAVILQGWLD 133


>gi|325981453|ref|YP_004293855.1| Holliday junction resolvase YqgF [Nitrosomonas sp. AL212]
 gi|325530972|gb|ADZ25693.1| Holliday junction resolvase YqgF [Nitrosomonas sp. AL212]
          Length = 161

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 37/135 (27%), Positives = 62/135 (45%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I + D G KR+G+AI +     AHP   +  +   +  + +   I T     F++G+P
Sbjct: 21  GSILAFDFGKKRVGVAIGNTALGVAHPLITIDSEVTNKRFVMIAQLIDTWQPVLFVVGMP 80

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           L+ +G        ++ F    +  +  +P V  DER T+  A  IL +  V  +++   +
Sbjct: 81  LHSDGIVHELTQLSQRFAR-RLAGRFNIPVVMQDERYTSQIASTILREAGVVGREQKSVL 139

Query: 137 DSIAAALILQEVLDR 151
           D IAA  ILQ   D 
Sbjct: 140 DQIAAQQILQSFFDE 154


>gi|300723963|ref|YP_003713277.1| putative Holliday junction resolvase [Xenorhabdus nematophila ATCC
           19061]
 gi|297630494|emb|CBJ91159.1| putative Holliday junction resolvase [Xenorhabdus nematophila ATCC
           19061]
          Length = 139

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 60/137 (43%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
            N+ I + D GT+ IG AI       A         + +     +   +        I+G
Sbjct: 2   KNRTIIAFDFGTRSIGAAIGQEVTGTARALSAFKANEGSPNWQLIEKLLKEWQPDLVIVG 61

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LPLNM+G+E P     R F +  +  +  V     DERLTTV A+  L D    +     
Sbjct: 62  LPLNMDGTEQPVTAQARKFAN-RLHGRFGVQVALHDERLTTVEARSHLFDHGGYKALNKG 120

Query: 135 KVDSIAAALILQEVLDR 151
           KVD+ +A +IL+   +R
Sbjct: 121 KVDAASAVIILESWFER 137


>gi|167752474|ref|ZP_02424601.1| hypothetical protein ALIPUT_00725 [Alistipes putredinis DSM 17216]
 gi|167659543|gb|EDS03673.1| hypothetical protein ALIPUT_00725 [Alistipes putredinis DSM 17216]
          Length = 137

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 38/140 (27%), Positives = 65/140 (46%), Gaps = 5/140 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID GTKR G+A+SDP R  A     +  K + +       +    +++  +IG 
Sbjct: 1   MGRILAIDYGTKRTGIAVSDPLRIIAGGLETVETKGLERWL---AQYFAANDVSTIVIGK 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P+ M+G+              +         VF+DER T+V A + +++  + +  R  K
Sbjct: 58  PMQMSGAPSETWRYVEPLAARLRRAYPDKEVVFYDERFTSVIAHRTMLESGMGKMARRDK 117

Query: 136 --VDSIAAALILQEVLDRIS 153
             VD I+A +ILQ  ++  S
Sbjct: 118 ALVDKISATIILQGYMESRS 137


>gi|293390910|ref|ZP_06635244.1| Holliday junction resolvase-like protein [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951444|gb|EFE01563.1| Holliday junction resolvase-like protein [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 139

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 56/134 (41%), Gaps = 1/134 (0%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPL 77
            + + D GTK IG A+       A   P    +        +   I     A  ++GLPL
Sbjct: 4   TVLAFDFGTKSIGCAVGQSITGTAQSLPAFKAQDGIPNWDAIEKCIQEWQPARIVVGLPL 63

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NM+G+E P     + F    +  +  +P    DERLTT  A+  +      R     KVD
Sbjct: 64  NMDGTEQPLTLRAKKFAK-RLHGRFNIPVDLQDERLTTTEARSEIFSRGGYRALNKSKVD 122

Query: 138 SIAAALILQEVLDR 151
            I+A LIL+   + 
Sbjct: 123 GISACLILESWFEN 136


>gi|152994576|ref|YP_001339411.1| Holliday junction resolvase YqgF [Marinomonas sp. MWYL1]
 gi|150835500|gb|ABR69476.1| Holliday junction resolvase YqgF [Marinomonas sp. MWYL1]
          Length = 156

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 62/136 (45%), Gaps = 1/136 (0%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
              + +   D GT RIG+AI       A P   L  K+      E+   +      AF++
Sbjct: 18  NTVRSVLGFDFGTTRIGVAIGQSITGTAQPLDPLKAKEGIPNWDEITRIVEEWKPDAFVV 77

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLPL+M+GSE       R F    +  +  +P+   DERL++  A+  +I    +R  + 
Sbjct: 78  GLPLDMDGSENEMCQRARKFAK-RLHGRFNLPYHMMDERLSSYEAKGQVIARGGNRNFKE 136

Query: 134 QKVDSIAAALILQEVL 149
             VD +AA +IL+   
Sbjct: 137 NSVDGLAAQMILETWF 152


>gi|154482585|ref|ZP_02025033.1| hypothetical protein EUBVEN_00252 [Eubacterium ventriosum ATCC
           27560]
 gi|149736610|gb|EDM52496.1| hypothetical protein EUBVEN_00252 [Eubacterium ventriosum ATCC
           27560]
          Length = 142

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 45/139 (32%), Positives = 79/139 (56%), Gaps = 4/139 (2%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK---KVTQTALELLSFITTENIAAFII 73
             I  +D G+K +G+A++DP    A     + R    K+ +T   +   +   NI   ++
Sbjct: 1   MRILGLDFGSKTVGVAVTDPLGYTAQGVEIIRRDSPNKLRKTLARIEQLVEQYNIEKIVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           G P+ ++G+EG RV  T+ F    ++R+  +  VF DERLTTV A +I+ +  + ++ R 
Sbjct: 61  GYPVMLSGTEGERVKKTKEFGAM-LERRTGLEIVFQDERLTTVEAYEIMDEAGIKKQDRY 119

Query: 134 QKVDSIAAALILQEVLDRI 152
           + VD IAA +IL++ ++RI
Sbjct: 120 KYVDQIAATIILEDYINRI 138


>gi|119484674|ref|ZP_01619156.1| Holliday junction resolvase-like protein [Lyngbya sp. PCC 8106]
 gi|119457492|gb|EAW38616.1| Holliday junction resolvase-like protein [Lyngbya sp. PCC 8106]
          Length = 149

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 40/134 (29%), Positives = 69/134 (51%), Gaps = 1/134 (0%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNM 79
             +D+G KRIG+A  D    FA     L R    +   +L   +    +   ++GLP +M
Sbjct: 13  LGLDIGQKRIGVAGCDGLGLFATGLMTLKRSAFERDVAQLRELVEDRRVQVLVVGLPYSM 72

Query: 80  NGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSI 139
           NG+ G +    + +    + + + +P  + DERLT+  A+Q+L D ++S  +    +D  
Sbjct: 73  NGTIGFQAKKVQKYA-TGLAKALDLPLEYVDERLTSFQAEQMLRDAHISPSRNKGLIDRK 131

Query: 140 AAALILQEVLDRIS 153
           AAA+ILQ+ LD+  
Sbjct: 132 AAAIILQQWLDQRR 145


>gi|227326191|ref|ZP_03830215.1| Holliday junction resolvase-like protein [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 139

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 61/135 (45%), Gaps = 1/135 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           ++ I + D GTK IG+AI       A        ++      ++   ++       ++GL
Sbjct: 3   SRTILAFDFGTKSIGVAIGQEITGTARALTSFKAQEGIPDWQKVEKLLSEWQPDLVVVGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  +  +  V     DERL+TV A+  L +    +      
Sbjct: 63  PLNMDGTEQPLTARARKFAN-RLHGRFGVAIELHDERLSTVEARADLFERGGFKALDKGS 121

Query: 136 VDSIAAALILQEVLD 150
           VD+ +A +IL+   +
Sbjct: 122 VDAASAVIILESWFE 136


>gi|269101817|ref|ZP_06154514.1| putative Holliday junction resolvase [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268161715|gb|EEZ40211.1| putative Holliday junction resolvase [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 141

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 32/140 (22%), Positives = 58/140 (41%), Gaps = 2/140 (1%)

Query: 13  LKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFI 72
           +  ++ + + D GTK IG+AI       A P   L  +    +   +   +        +
Sbjct: 1   MSQSRTVLAFDYGTKSIGVAIGQEITGTAQPLKALKARDGIPSWEAIEQILKEWQPDLVV 60

Query: 73  IGLPLNMNGSEGPR-VHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKK 131
           +GLPL+M+G E        + F +  +  +        DERL+T  A+  L +    R  
Sbjct: 61  VGLPLDMSGHELETITPRAKKFAN-RLHGRFGCQVELHDERLSTAEARAELFEFGGYRNL 119

Query: 132 RIQKVDSIAAALILQEVLDR 151
               +DS +A +IL+   + 
Sbjct: 120 SKGNIDSQSAVVILESWFEN 139


>gi|323698536|ref|ZP_08110448.1| Holliday junction resolvase YqgF [Desulfovibrio sp. ND132]
 gi|323458468|gb|EGB14333.1| Holliday junction resolvase YqgF [Desulfovibrio desulfuricans
           ND132]
          Length = 138

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 45/135 (33%), Positives = 62/135 (45%), Gaps = 1/135 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
                ID G KR+GLA+SD       P   L R        EL   I  E I A ++GLP
Sbjct: 1   MRALGIDFGLKRVGLAVSDRTGTLVSPLKTLERTTRQALFDELTEIIHDEAIEAVVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           L ++G +       R F    + R++  P    DERLT+  A++ L    +   KR   +
Sbjct: 61  LALSGEDTLTTRQARNFAE-SLGRRIDAPVHLMDERLTSAQAEEELNAAGLRGAKRKAAL 119

Query: 137 DSIAAALILQEVLDR 151
           DS AA +IL+  LD 
Sbjct: 120 DSQAAVVILRSWLDS 134


>gi|315037653|ref|YP_004031221.1| Holliday junction resolvase-like protein [Lactobacillus amylovorus
           GRL 1112]
 gi|325956138|ref|YP_004286748.1| Holliday junction resolvase-like protein [Lactobacillus acidophilus
           30SC]
 gi|312275786|gb|ADQ58426.1| Holliday junction resolvase-like protein [Lactobacillus amylovorus
           GRL 1112]
 gi|325332703|gb|ADZ06611.1| Holliday junction resolvase-like protein [Lactobacillus acidophilus
           30SC]
 gi|327182946|gb|AEA31393.1| Holliday junction resolvase-like protein [Lactobacillus amylovorus
           GRL 1118]
          Length = 142

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 44/138 (31%), Positives = 74/138 (53%), Gaps = 5/138 (3%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+A+SD     A     +     K       L   +   +   F++G
Sbjct: 1   MRLLGLDVGSKTVGVAVSDELGITAQKLETIQIDETKYNFGMRPLKKLVRQYDPEGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILID-MNVS-RKKR 132
           LP NM+G+ G  V  ++A+    ++ K  +P  + DERLTT+ +Q++L++   +  RKKR
Sbjct: 61  LPKNMDGTSGSSVARSKAYGK-RLEEKFGLPVYYSDERLTTIESQRVLVEDAGIHDRKKR 119

Query: 133 IQKVDSIAAALILQEVLD 150
            Q +D +AA LILQ  LD
Sbjct: 120 KQVIDQMAAVLILQNYLD 137


>gi|158313531|ref|YP_001506039.1| Holliday junction resolvase YqgF [Frankia sp. EAN1pec]
 gi|158108936|gb|ABW11133.1| Holliday junction resolvase YqgF [Frankia sp. EAN1pec]
          Length = 188

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 43/134 (32%), Positives = 65/134 (48%), Gaps = 3/134 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVR---KKVTQTALELLSFITTENIAAFIIGLP 76
             +D+G+ R+G+A+SDP    A P   L R   ++      EL   +   +    ++GLP
Sbjct: 32  IGVDVGSVRVGVAVSDPDGLLAVPVTTLRRDVSRRGFADVDELADIVRDRHAVEVVVGLP 91

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            +++G EG  V   R +   +  R   VP    DERLTTV A + + +  +  + R   V
Sbjct: 92  RHLSGREGEAVRLARRYAEVLSARVAPVPVRLVDERLTTVVAHRRMAERGLRSRARRDLV 151

Query: 137 DSIAAALILQEVLD 150
           D  AA  ILQ  LD
Sbjct: 152 DQEAAVQILQHHLD 165


>gi|329896502|ref|ZP_08271560.1| Putative Holliday junction resolvase [gamma proteobacterium
           IMCC3088]
 gi|328921719|gb|EGG29092.1| Putative Holliday junction resolvase [gamma proteobacterium
           IMCC3088]
          Length = 139

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 32/135 (23%), Positives = 60/135 (44%), Gaps = 1/135 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              +   D G ++IG+A+ +   + A P   L  +       +L + +     A  ++G 
Sbjct: 1   MSRVLCFDYGLRQIGVAVGNAALQTAEPLCTLKAQDGIPNWDQLAALLEEWQPAIVVVGE 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NM+G++       R F +  I  +  V     DERL++  A+Q   +M      +   
Sbjct: 61  PSNMDGTDSDMAARARKFAN-RIHGRFGVKVALADERLSSFEAKQQAREMGHDGDYKKTP 119

Query: 136 VDSIAAALILQEVLD 150
           +D++AA +ILQ   +
Sbjct: 120 IDALAAMIILQSYFE 134


>gi|295111267|emb|CBL28017.1| conserved hypothetical protein TIGR00250 [Synergistetes bacterium
           SGP1]
          Length = 146

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 41/134 (30%), Positives = 60/134 (44%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLS-FITTENIAAFIIGL 75
             + ++D+G+ R+G AISDP R  A                      +        ++G+
Sbjct: 7   GRVLALDVGSARVGAAISDPMRLIAQGLAVWPVVDRDGGWRRKFEACLVQYAPTLVLVGM 66

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P   +G+ GP        V  +      + F  WDER TTV A + +I+  VSR  R Q+
Sbjct: 67  PTRTDGTRGPEAERVAKLVDLLRAGHPDLAFDTWDERFTTVMAHRAMIEGGVSRSGRRQR 126

Query: 136 VDSIAAALILQEVL 149
           VD IAA LIL+  L
Sbjct: 127 VDKIAAVLILESWL 140


>gi|251793467|ref|YP_003008196.1| Holliday junction resolvase-like protein [Aggregatibacter
           aphrophilus NJ8700]
 gi|247534863|gb|ACS98109.1| conserved hypothetical protein [Aggregatibacter aphrophilus NJ8700]
          Length = 139

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 38/137 (27%), Positives = 58/137 (42%), Gaps = 1/137 (0%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPL 77
            + + D GTK IG A+       A   P    +        +   I     A  ++GLPL
Sbjct: 4   TVLAFDFGTKSIGCAVGQSITGTAQSLPAFKAQDGIPNWDAIGKTIKEWQPARIVVGLPL 63

Query: 78  NMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVD 137
           NM+G+E       + F +  +  +  +P    DERLTT  A+  +      R     KVD
Sbjct: 64  NMDGTEQELTLRAKKFAN-RLHGRFNLPVELQDERLTTTEARSEIFSRGGYRALNKSKVD 122

Query: 138 SIAAALILQEVLDRISF 154
            I+A LIL+   ++ S 
Sbjct: 123 GISACLILESWFEQYSE 139


>gi|86131929|ref|ZP_01050526.1| Holliday junction resolvase-like protein [Dokdonia donghaensis
           MED134]
 gi|85817751|gb|EAQ38925.1| Holliday junction resolvase-like protein [Dokdonia donghaensis
           MED134]
          Length = 163

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 39/143 (27%), Positives = 66/143 (46%), Gaps = 5/143 (3%)

Query: 9   LVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENI 68
            +  +     I +ID GTKR G+A++D  +  A     +  K + +      +++  E +
Sbjct: 21  FLHQILQMARIIAIDYGTKRTGVAVTDELQLIASGLTTVPTKDIFKFL---ATYLAEEKV 77

Query: 69  AAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVS 128
            A +IG P  MN            F  ++  +   +  +  DER T+  A Q +ID  + 
Sbjct: 78  EAMVIGEPKRMNNEASDVEEHIVRFRESVEKKHPELKIIRQDERFTSKMAFQTMIDSGIG 137

Query: 129 RKKR--IQKVDSIAAALILQEVL 149
           +KKR     VD I+A +ILQ+ L
Sbjct: 138 KKKRQNKALVDQISATIILQDYL 160


>gi|77361516|ref|YP_341091.1| Holliday junction resolvase-like protein [Pseudoalteromonas
           haloplanktis TAC125]
 gi|146325592|sp|Q3IFA0|RUVX_PSEHT RecName: Full=Putative Holliday junction resolvase
 gi|76876427|emb|CAI87649.1| putative Holliday junction resolvase [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 149

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 33/148 (22%), Positives = 60/148 (40%), Gaps = 5/148 (3%)

Query: 4   LLIEDLVKSLKPNQP-IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSF 62
           +  ++        Q  +   D GTK IG+AI       A     +  +       ++   
Sbjct: 1   MTKKNFK---PQGQRTVMGFDFGTKSIGIAIGQELTGSASSLKAVKAQDGIPNWDDIAVQ 57

Query: 63  ITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL 122
           +        ++GLPLNM+G+        + F +  +     +P    DERLTT  A+  L
Sbjct: 58  VNEWQPDLMVVGLPLNMDGTAQEVTFKAKKFAN-RLHNHYAIPVETQDERLTTADAKARL 116

Query: 123 IDMNVSRKKRIQKVDSIAAALILQEVLD 150
            +    +     KVD+++A +IL+   +
Sbjct: 117 FEQGGYKNLGKGKVDNMSAVIILESFFE 144


>gi|172036395|ref|YP_001802896.1| Holliday junction resolvase-like protein [Cyanothece sp. ATCC
           51142]
 gi|254767512|sp|B1WX86|RUVX_CYAA5 RecName: Full=Putative Holliday junction resolvase
 gi|171697849|gb|ACB50830.1| putative holliday junction resolvase, YqgF family [Cyanothece sp.
           ATCC 51142]
          Length = 143

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 39/140 (27%), Positives = 66/140 (47%), Gaps = 3/140 (2%)

Query: 16  NQPI--ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
            + I    +D+G KRIG+A  D     A     + R+   Q   +L + +    +   +I
Sbjct: 1   MERISALGLDVGKKRIGVAGCDGTGLIATGLTTIERQSFPQDVQQLEALVKEREVQLLVI 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP +M+G+ G +    + F    +   + +P  + DERLT+V A+  L       +   
Sbjct: 61  GLPYSMDGTIGFQAKKVQKFAK-RLSTALELPIEYIDERLTSVEAETHLKSQKKYSRYNK 119

Query: 134 QKVDSIAAALILQEVLDRIS 153
             VD +AA +ILQ+ LD+  
Sbjct: 120 GLVDRLAATIILQQWLDQRR 139


>gi|322514742|ref|ZP_08067768.1| crossover junction endodeoxyribonuclease [Actinobacillus ureae ATCC
           25976]
 gi|322119337|gb|EFX91453.1| crossover junction endodeoxyribonuclease [Actinobacillus ureae ATCC
           25976]
          Length = 137

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 62/134 (46%), Gaps = 1/134 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
           + I + D GT  IG A+       A        +       ++   I        ++GLP
Sbjct: 3   RTILAFDFGTYSIGCAVGQDITGTAQGLSSFKAQDGIPNWDQIEKVIQEWLPERLVVGLP 62

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           LNM+G+E P     + F +  ++ +  +P    DERLTTVSA+  + +    +  +  KV
Sbjct: 63  LNMDGTEQPLTQRAKKFAN-RLNGRFNLPVELQDERLTTVSAKAEIFERGGYKALKKDKV 121

Query: 137 DSIAAALILQEVLD 150
           DSI+A LIL+   +
Sbjct: 122 DSISACLILESWFE 135


>gi|119716635|ref|YP_923600.1| Holliday junction resolvase YqgF [Nocardioides sp. JS614]
 gi|167012741|sp|A1SJC8|RUVX_NOCSJ RecName: Full=Putative Holliday junction resolvase
 gi|119537296|gb|ABL81913.1| Holliday junction resolvase YqgF [Nocardioides sp. JS614]
          Length = 156

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 50/144 (34%), Positives = 67/144 (46%), Gaps = 3/144 (2%)

Query: 20  ASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIA---AFIIGLP 76
             ID G  RIG+A SDP    A P   + R K     +  +     +  A     ++GLP
Sbjct: 7   IGIDPGDARIGVARSDPSGFLATPVETVRRGKGDLARIGRILAAEEDEGATVLEVVVGLP 66

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            +++G EGP     R F   +  R   VP    DER+TTVSA+ +L D   +  KR   V
Sbjct: 67  RSLSGREGPAAAKVREFAGRLAARVAPVPVRLVDERMTTVSAEAMLRDQGRTGGKRRAVV 126

Query: 137 DSIAAALILQEVLDRISFLESSKG 160
           D  AA LILQ  LD      ++ G
Sbjct: 127 DQAAAVLILQHALDTERATGAAPG 150


>gi|325680097|ref|ZP_08159663.1| RNAse H domain protein, YqgF family [Ruminococcus albus 8]
 gi|324108172|gb|EGC02422.1| RNAse H domain protein, YqgF family [Ruminococcus albus 8]
          Length = 140

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 47/133 (35%), Positives = 66/133 (49%), Gaps = 1/133 (0%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLP 76
             I ++D G  R G+AISD     A P   +      + A ++            ++GLP
Sbjct: 1   MRILAVDYGDARTGIAISDNSEFLASPVCTITEYHADRLAQKVADIAKERGAGEIVVGLP 60

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
           +NMNG++G R     AF    +   V V    WDER TTV+A Q L + NV  KKR   V
Sbjct: 61  INMNGTKGERAEKCEAFAEM-LRGLVDVEVKMWDERSTTVTAHQYLNETNVRGKKRKAVV 119

Query: 137 DSIAAALILQEVL 149
           D++AA +IL+  L
Sbjct: 120 DTVAATIILESYL 132


>gi|162148752|ref|YP_001603213.1| Holliday junction resolvase [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545482|ref|YP_002277711.1| Holliday junction resolvase YqgF [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|189046098|sp|A9HRJ3|RUVX_GLUDA RecName: Full=Putative Holliday junction resolvase
 gi|161787329|emb|CAP56923.1| putative Holliday junction resolvase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533159|gb|ACI53096.1| Holliday junction resolvase YqgF [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 154

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 50/151 (33%), Positives = 84/151 (55%), Gaps = 2/151 (1%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M +  +  +   L  +Q +  +D G K IGLA+SD     A P   L R K++  A E+ 
Sbjct: 1   MPLFNMHQIRGQLGRDQRLLGLDPGQKTIGLALSDVSLMLASPYGALRRGKLSVVAAEIR 60

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                E +   + GLPL+M+GS GP   + R ++   +  +V +P   WDERL++ +  +
Sbjct: 61  RIAAREGVGGLVSGLPLSMDGSFGPAAQAARDWM-ISLSEQVGLPAAMWDERLSSSAVNR 119

Query: 121 ILI-DMNVSRKKRIQKVDSIAAALILQEVLD 150
           +LI D +++R++R + VD +AA+ +LQ  LD
Sbjct: 120 MLIQDADMTRQRRAELVDKLAASYMLQGALD 150


>gi|325144525|gb|EGC66824.1| hypothetical protein NMBM01240013_0937 [Neisseria meningitidis
           M01-240013]
 gi|325205893|gb|ADZ01346.1| conserved hypothetical protein [Neisseria meningitidis M04-240196]
 gi|325208296|gb|ADZ03748.1| conserved hypothetical protein [Neisseria meningitidis NZ-05/33]
          Length = 151

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 34/136 (25%), Positives = 62/136 (45%), Gaps = 1/136 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P     + D G  RIG+A  D     +HP   +      +    +   +       F++G
Sbjct: 5   PKGTALAFDFGEARIGVAQGDAELGLSHPLSTVTGGSNDEKFAAIAKLVQEWQPRYFVVG 64

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G++    H +  F    ++ +  +P  + DERL++V A+ +L +  V  KKR  
Sbjct: 65  LPVHTDGTKHEMTHLSHKFGR-RLNGRFNLPVYWVDERLSSVYAESLLSEAQVFGKKRKS 123

Query: 135 KVDSIAAALILQEVLD 150
            +D +AA  IL    +
Sbjct: 124 VLDQVAAQAILHGFFE 139


>gi|227115172|ref|ZP_03828828.1| Holliday junction resolvase-like protein [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 139

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 61/135 (45%), Gaps = 1/135 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
           ++ I + D GTK IG+AI       A        ++      ++   ++       ++GL
Sbjct: 3   SRTILAFDFGTKSIGVAIGQEITGTARALTSFKAQEGIPDWQKVEKLLSEWQPDLVVVGL 62

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           PLNM+G+E P     R F +  +  +  +     DERL+TV A+  L +    +      
Sbjct: 63  PLNMDGTEQPLTARARKFAN-RLHGRFGIAIELHDERLSTVEARADLFERGGFKALDKGS 121

Query: 136 VDSIAAALILQEVLD 150
           VD+ +A +IL+   +
Sbjct: 122 VDAASAVIILESWFE 136


>gi|114799411|ref|YP_760995.1| hypothetical protein HNE_2300 [Hyphomonas neptunium ATCC 15444]
 gi|123128643|sp|Q0BZU8|RUVX_HYPNA RecName: Full=Putative Holliday junction resolvase
 gi|114739585|gb|ABI77710.1| conserved hypothetical protein TIGR00250 [Hyphomonas neptunium ATCC
           15444]
          Length = 151

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 50/152 (32%), Positives = 81/152 (53%), Gaps = 5/152 (3%)

Query: 1   MSILLIEDLVKSLKPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL 60
           M+++ + DL         +  ID GT  IG+A +D  R  A P   +++KK+  +   LL
Sbjct: 1   MAVVDLFDL----PREGVLLGIDPGTATIGVAATDRIRMMASPVETILKKKLAPSLERLL 56

Query: 61  SFITTENIAAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQ 120
                      I+GLPLN++GS GPR  S R  V +++ +   +P  F DER ++  A  
Sbjct: 57  HIYDERAAVGLIVGLPLNVDGSMGPRAQSVRTLVSSLL-KVRDLPVTFQDERYSSAEAGD 115

Query: 121 ILIDMNVSRKKRIQKVDSIAAALILQEVLDRI 152
           I+     +R+ R  ++D+ AAA+ILQ+ L R+
Sbjct: 116 IMRAAGATRRNREARIDASAAAVILQDALSRL 147


>gi|89890525|ref|ZP_01202035.1| endonuclease involved in recombination repair [Flavobacteria
           bacterium BBFL7]
 gi|89517440|gb|EAS20097.1| endonuclease involved in recombination repair [Flavobacteria
           bacterium BBFL7]
          Length = 139

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 42/140 (30%), Positives = 69/140 (49%), Gaps = 5/140 (3%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I +ID G KR G+A++DP +  A     +   +++        ++ TE++   +IG 
Sbjct: 1   MSRILAIDYGKKRTGIAVTDPMQIIASGLTTVATHELSVFLE---KYLNTEDVETIVIGE 57

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P  M+ ++        AF   + ++   +     DER T+  A Q +ID  +S+ KR  K
Sbjct: 58  PKQMDYTDSELGGVINAFAKALQEKYPAITIERVDERFTSKMAFQTMIDSGLSKSKRRNK 117

Query: 136 --VDSIAAALILQEVLDRIS 153
             VD IAA +ILQ  +DR S
Sbjct: 118 ALVDEIAATIILQTYMDRKS 137


>gi|189485524|ref|YP_001956465.1| putative Holliday junction resolvase RuvX [uncultured Termite group
           1 bacterium phylotype Rs-D17]
 gi|226695313|sp|B1H0H2|RUVX_UNCTG RecName: Full=Putative Holliday junction resolvase
 gi|170287483|dbj|BAG14004.1| putative Holliday junction resolvase RuvX [uncultured Termite group
           1 bacterium phylotype Rs-D17]
          Length = 140

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 53/136 (38%), Positives = 77/136 (56%), Gaps = 2/136 (1%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              I  ID G KRIG+AI+D  R  A P   +    + + AL++L      +++  ++GL
Sbjct: 1   MNRIMGIDYGLKRIGIAITDFLRITASPFDTVKNVSLKKNALKILEIAKNRDVSIIVLGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVSRKKRIQ 134
           PLNMNG+EG    + R F+   I     +     DERLTTV A+++LI + ++SR+KR  
Sbjct: 61  PLNMNGTEGGMAETVRKFIE-KIKFLSDIEVTTVDERLTTVQAERMLIEEADISREKRKG 119

Query: 135 KVDSIAAALILQEVLD 150
             D + AALILQ  LD
Sbjct: 120 IKDKVVAALILQTYLD 135


>gi|294788595|ref|ZP_06753837.1| putative Holliday junction resolvase [Simonsiella muelleri ATCC
           29453]
 gi|294483472|gb|EFG31157.1| putative Holliday junction resolvase [Simonsiella muelleri ATCC
           29453]
          Length = 154

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 35/137 (25%), Positives = 63/137 (45%), Gaps = 1/137 (0%)

Query: 15  PNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIG 74
           P     + D G  RIG+A  +     AHP   +  +   +  + +   IT       ++G
Sbjct: 11  PMGCALAFDFGETRIGVAQGNREIAIAHPIATITGQSNEEKLIAIARLITQWQPEYLVVG 70

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQ 134
           LP++ +G+E       R F  + ++ +  +P  + DER +++ A+++L    V  KK   
Sbjct: 71  LPVHADGTEHEVTALARKFG-HRLNARFRLPIYWADERFSSLYAEELLKQAQVFGKKNKA 129

Query: 135 KVDSIAAALILQEVLDR 151
            +D +AA  ILQ   D 
Sbjct: 130 VLDQVAAQAILQSFFDN 146


>gi|282882848|ref|ZP_06291453.1| putative Holliday junction resolvase [Peptoniphilus lacrimalis
           315-B]
 gi|300814171|ref|ZP_07094454.1| RNAse YqgF [Peptoniphilus sp. oral taxon 836 str. F0141]
 gi|281297259|gb|EFA89750.1| putative Holliday junction resolvase [Peptoniphilus lacrimalis
           315-B]
 gi|300511828|gb|EFK39045.1| RNAse YqgF [Peptoniphilus sp. oral taxon 836 str. F0141]
          Length = 147

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/136 (31%), Positives = 71/136 (52%), Gaps = 1/136 (0%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGL 75
              +  +D+G K IG+AISD     A P   + R    +   ++   I   ++   ++GL
Sbjct: 1   MNRVLGLDVGEKWIGVAISDETFTIATPLETIERTSNKEAYDKIHDLIEKYDVKKIVVGL 60

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQK 135
           P NMN + GP     + F    +  K  +  V+ DER+TT+ A+ +L++ +V R+ R + 
Sbjct: 61  PKNMNNTLGPTCQMVQKFSE-KLKNKFRLELVYVDERMTTLMAKDVLMEASVRRENRKKY 119

Query: 136 VDSIAAALILQEVLDR 151
           VD IAAA IL+  +D 
Sbjct: 120 VDKIAAAFILKTYMDS 135


>gi|313884998|ref|ZP_07818750.1| RNAse H domain protein, YqgF family [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312619689|gb|EFR31126.1| RNAse H domain protein, YqgF family [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 145

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/139 (32%), Positives = 74/139 (53%), Gaps = 3/139 (2%)

Query: 18  PIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKK--VTQTALELLSFITTENIAAFIIGL 75
            I  +D+G+K +G+A+SD     A     +   +         LL  +    +   +IGL
Sbjct: 6   RIVGLDVGSKTVGVAMSDLLGWIAQGLETIRIDEEAGDFGFDRLLELLDQHQVKKVVIGL 65

Query: 76  PLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL-IDMNVSRKKRIQ 134
           P NMN + GPR  +++ +   ++D +  +   + DERLTT  A+++L  + NVSR KR +
Sbjct: 66  PKNMNNTIGPRAQASQRYGQKLLDIRPDLLIAYQDERLTTSQAERMLVSEGNVSRSKRKK 125

Query: 135 KVDSIAAALILQEVLDRIS 153
            +D +AA +ILQ  LD  S
Sbjct: 126 VIDKLAAVIILQNYLDANS 144


>gi|223986206|ref|ZP_03636224.1| hypothetical protein HOLDEFILI_03534 [Holdemania filiformis DSM
           12042]
 gi|223961820|gb|EEF66314.1| hypothetical protein HOLDEFILI_03534 [Holdemania filiformis DSM
           12042]
          Length = 139

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 46/140 (32%), Positives = 68/140 (48%), Gaps = 3/140 (2%)

Query: 16  NQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELL--SFITTENIAAFII 73
            + I  +DLG++ +G+A+SDP    A              A                F++
Sbjct: 1   MERIMGLDLGSRTLGIAVSDPLGMIARTVETFRFADDDYDAACARAVQLAKELGAVKFVL 60

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP +MNG  G R   +  F    ++    +P +  DERLTT +A++ILI  +VSRKKR 
Sbjct: 61  GLPKHMNGDVGIRGQISLDF-KAKLEAACGLPVILQDERLTTAAAERILISADVSRKKRK 119

Query: 134 QKVDSIAAALILQEVLDRIS 153
             +D +AA  ILQ  LD+  
Sbjct: 120 AVIDQMAAVQILQSYLDQKR 139


>gi|42518572|ref|NP_964502.1| hypothetical protein LJ0476 [Lactobacillus johnsonii NCC 533]
 gi|62900996|sp|Q74KV1|RUVX_LACJO RecName: Full=Putative Holliday junction resolvase
 gi|41582857|gb|AAS08468.1| hypothetical protein LJ_0476 [Lactobacillus johnsonii NCC 533]
          Length = 143

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/138 (31%), Positives = 74/138 (53%), Gaps = 5/138 (3%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+AISDP    A     +     K +    ++   +   ++  F++G
Sbjct: 1   MRLLGLDVGSKTVGVAISDPLGITAQELETIKIDESKFSFGLRQIRRIVRKYDVEGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVS-RKKR 132
           LP NM+GS G  V  ++ +    +  K  +P  + DERLTTV A +IL+ +  V  R +R
Sbjct: 61  LPKNMDGSSGHSVERSKQYGE-RLKEKFDLPVYYMDERLTTVQADRILVEEAGVHDRVER 119

Query: 133 IQKVDSIAAALILQEVLD 150
            + +D +AA LILQ  L+
Sbjct: 120 KKVIDQMAAVLILQNYLE 137


>gi|316933654|ref|YP_004108636.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris DX-1]
 gi|315601368|gb|ADU43903.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris DX-1]
          Length = 160

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 59/134 (44%), Positives = 79/134 (58%), Gaps = 1/134 (0%)

Query: 26  TKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLNMNGSEGP 85
           TK IG+A SDP RR A     + RK  T  A  LL+         F++GLPLNM+GSEGP
Sbjct: 28  TKTIGVAASDPDRRLATGVETIARKAFTADAARLLALAAERTACGFVLGLPLNMDGSEGP 87

Query: 86  RVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKVDSIAAALIL 145
           R  STRAF    + +   +P   WDERL+T + ++ LI  +VSR KR + +D  AA  IL
Sbjct: 88  RAQSTRAFAR-NLAKLTELPIGLWDERLSTAAVERELIANDVSRAKRAKVIDEHAAIFIL 146

Query: 146 QEVLDRISFLESSK 159
           Q  LDR++ L  ++
Sbjct: 147 QGALDRLAALRRAE 160


>gi|227505017|ref|ZP_03935066.1| possible Holliday junction resolvase [Corynebacterium striatum ATCC
           6940]
 gi|227198381|gb|EEI78429.1| possible Holliday junction resolvase [Corynebacterium striatum ATCC
           6940]
          Length = 180

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 46/158 (29%), Positives = 69/158 (43%), Gaps = 12/158 (7%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQT-----ALELLSFITTENI 68
             N    ++D+GT RIG+A+SD     A P   + R+   +         +L  I   ++
Sbjct: 13  PGNGRRLALDVGTVRIGVAVSDSNASLALPVETVSRETGFKDQDKGDIDRILELIREYHV 72

Query: 69  AAFIIGLPLNMNGSEGPRVHSTRAFVHNMIDR------KVYVPFVFWDERLTTVSAQQIL 122
              ++GLP ++ G+    V   +     +  R          P    DERLTTV+A   L
Sbjct: 73  VEVVVGLPRDLQGNGSKSVKHAKEIAFRIRRRLGKDETIGQPPVRMADERLTTVAATTAL 132

Query: 123 IDMNVSRKKRIQKVDSIAAALILQEVLD-RISFLESSK 159
               VS KK  + +D  AA  ILQ  LD R + L+S  
Sbjct: 133 RASGVSEKKGRKVIDQAAAVEILQSWLDARHNALQSDA 170


>gi|116629094|ref|YP_814266.1| RNase H-like ribonuclease [Lactobacillus gasseri ATCC 33323]
 gi|238853837|ref|ZP_04644202.1| conserved hypothetical protein [Lactobacillus gasseri 202-4]
 gi|282852131|ref|ZP_06261488.1| RNAse YqgF [Lactobacillus gasseri 224-1]
 gi|311111120|ref|ZP_07712517.1| putative Holliday junction resolvase [Lactobacillus gasseri MV-22]
 gi|122273908|sp|Q045P4|RUVX_LACGA RecName: Full=Putative Holliday junction resolvase
 gi|116094676|gb|ABJ59828.1| RNase H-like ribonuclease [Lactobacillus gasseri ATCC 33323]
 gi|238833532|gb|EEQ25804.1| conserved hypothetical protein [Lactobacillus gasseri 202-4]
 gi|282556695|gb|EFB62300.1| RNAse YqgF [Lactobacillus gasseri 224-1]
 gi|311066274|gb|EFQ46614.1| putative Holliday junction resolvase [Lactobacillus gasseri MV-22]
          Length = 143

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/138 (31%), Positives = 73/138 (52%), Gaps = 5/138 (3%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+AISDP    A     +     K +    ++   +   ++  F++G
Sbjct: 1   MRLLGLDVGSKTVGVAISDPLGITAQELETIKIDESKFSFGMRQIRKLVRKYDVEGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL-IDMNVS-RKKR 132
           LP NM+GS G  V  ++ +    +  K  +P  + DERLTTV A +IL  +  V  R +R
Sbjct: 61  LPKNMDGSSGHSVERSKQYGE-RLKEKFDLPVHYMDERLTTVQADRILVQEAGVHDRVER 119

Query: 133 IQKVDSIAAALILQEVLD 150
            + +D +AA LILQ  L+
Sbjct: 120 KKVIDQMAAVLILQSYLE 137


>gi|302525837|ref|ZP_07278179.1| Holliday junction resolvase YqgF [Streptomyces sp. AA4]
 gi|302434732|gb|EFL06548.1| Holliday junction resolvase YqgF [Streptomyces sp. AA4]
          Length = 166

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 46/148 (31%), Positives = 67/148 (45%), Gaps = 1/148 (0%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRK-KVTQTALELLSFITTENIAAFI 72
                  ++D+G+ R+G+A+SDP    A P   L R  K       L   +T   +   I
Sbjct: 17  PGRGRRLAVDVGSVRVGVALSDPAPVLASPLVTLSRDAKDDSDLDRLAELVTEHEVVEVI 76

Query: 73  IGLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKR 132
           +GLP  +   +G       A+   +  R   VP    DERLTTV+A ++L    V  +K+
Sbjct: 77  VGLPRTLANRQGAAADLALAYAEKLAGRVGDVPVRLADERLTTVTASRMLSQRGVKGRKQ 136

Query: 133 IQKVDSIAAALILQEVLDRISFLESSKG 160
              VD  AA  ILQ  LD  +   + KG
Sbjct: 137 RAVVDQAAAVEILQAWLDAAAAHRARKG 164


>gi|227888703|ref|ZP_04006508.1| crossover junction endodeoxyribonuclease [Lactobacillus johnsonii
           ATCC 33200]
 gi|227850730|gb|EEJ60816.1| crossover junction endodeoxyribonuclease [Lactobacillus johnsonii
           ATCC 33200]
          Length = 143

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/138 (31%), Positives = 74/138 (53%), Gaps = 5/138 (3%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+AISDP    A     +     K +    ++   +   ++  F++G
Sbjct: 1   MRLLGLDVGSKTVGVAISDPLGITAQELETIKIDESKFSFGLRQIRKIVRKYDVEGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVS-RKKR 132
           LP NM+GS G  V  ++ +    +  K  +P  + DERLTTV A +IL+ +  V  R +R
Sbjct: 61  LPKNMDGSSGRSVERSKQYGE-RLKEKFDLPVYYMDERLTTVQADRILVEEAGVHDRVER 119

Query: 133 IQKVDSIAAALILQEVLD 150
            + +D +AA LILQ  L+
Sbjct: 120 KKVIDQMAAVLILQNYLE 137


>gi|330961163|gb|EGH61423.1| Holliday junction resolvase-like protein [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 146

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/138 (30%), Positives = 62/138 (44%), Gaps = 2/138 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  ID GTK+IG+A+       A     L  +       ++ + IT     A ++GLPLN
Sbjct: 7   LLGIDYGTKQIGVAVGQAITGQARELCTLKAQNGVPDWDKVQALITEWKPDAIVVGLPLN 66

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQ-QILIDMNVSRKKRIQKVD 137
           M+G+          F    ++ +  V     DERLTT  A+ + +         R   VD
Sbjct: 67  MDGTPSEMSARAEKFSR-RLNGRFGVTVYTHDERLTTFEAKGERMARGGQKGSYRDNPVD 125

Query: 138 SIAAALILQEVLDRISFL 155
           +IAAAL+LQ  LD    L
Sbjct: 126 AIAAALLLQGWLDEHPEL 143


>gi|268318983|ref|YP_003292639.1| putative Holliday junction resolvase [Lactobacillus johnsonii
           FI9785]
 gi|262397358|emb|CAX66372.1| putative Holliday junction resolvase [Lactobacillus johnsonii
           FI9785]
          Length = 143

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/138 (31%), Positives = 74/138 (53%), Gaps = 5/138 (3%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+AISDP    A     +     K +    ++   +   ++  F++G
Sbjct: 1   MRLLGLDVGSKTVGVAISDPLGITAQELETIKIDESKFSFGMRQIRKIVRKYDVEGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILI-DMNVS-RKKR 132
           LP NM+GS G  V  ++ +    +  K  +P  + DERLTTV A +IL+ +  V  R +R
Sbjct: 61  LPKNMDGSSGHSVERSKQYGG-RLKEKFDLPVYYVDERLTTVQADRILVEEAGVHDRVER 119

Query: 133 IQKVDSIAAALILQEVLD 150
            + +D +AA LILQ  L+
Sbjct: 120 KKVIDQMAAVLILQNYLE 137


>gi|300362249|ref|ZP_07058425.1| crossover junction endodeoxyribonuclease [Lactobacillus gasseri
           JV-V03]
 gi|300353240|gb|EFJ69112.1| crossover junction endodeoxyribonuclease [Lactobacillus gasseri
           JV-V03]
          Length = 143

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/138 (31%), Positives = 73/138 (52%), Gaps = 5/138 (3%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALELLSFITTENIAAFIIG 74
             +  +D+G+K +G+AISDP    A     +     K +    ++   +   ++  F++G
Sbjct: 1   MRLLGLDVGSKTVGVAISDPLGITAQELETIKIDESKFSFGMRQIRKIVRKYDVEGFVLG 60

Query: 75  LPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQIL-IDMNVS-RKKR 132
           LP NM+GS G  V  ++ +    +  K  +P  + DERLTTV A +IL  +  V  R +R
Sbjct: 61  LPKNMDGSSGHSVERSKQYGE-RLKEKFDLPVHYMDERLTTVQADRILVQEAGVHDRVER 119

Query: 133 IQKVDSIAAALILQEVLD 150
            + +D +AA LILQ  L+
Sbjct: 120 KKVIDQMAAVLILQSYLE 137


>gi|28872152|ref|NP_794771.1| hypothetical protein PSPTO_5038 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213971481|ref|ZP_03399593.1| holliday junction resolvase-like protein [Pseudomonas syringae pv.
           tomato T1]
 gi|301385811|ref|ZP_07234229.1| Holliday junction resolvase-like protein [Pseudomonas syringae pv.
           tomato Max13]
 gi|302062228|ref|ZP_07253769.1| Holliday junction resolvase-like protein [Pseudomonas syringae pv.
           tomato K40]
 gi|302133701|ref|ZP_07259691.1| Holliday junction resolvase-like protein [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|32130016|sp|Q87VA1|RUVX_PSESM RecName: Full=Putative Holliday junction resolvase
 gi|28855406|gb|AAO58466.1| conserved protein of unknown function [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213923763|gb|EEB57346.1| holliday junction resolvase-like protein [Pseudomonas syringae pv.
           tomato T1]
 gi|330873936|gb|EGH08085.1| Holliday junction resolvase-like protein [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330963801|gb|EGH64061.1| Holliday junction resolvase-like protein [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331018478|gb|EGH98534.1| Holliday junction resolvase-like protein [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 146

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/138 (29%), Positives = 61/138 (44%), Gaps = 2/138 (1%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           +  ID GTK+IG+A+       A     L  +       ++ + I      A ++GLPLN
Sbjct: 7   LLGIDYGTKQIGVAVGQAITGQARELCTLKAQNGVPDWDKVQALINEWKPDAIVVGLPLN 66

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQ-QILIDMNVSRKKRIQKVD 137
           M+G+          F    ++ +  V     DERLTT  A+ + +         R   VD
Sbjct: 67  MDGTPSEMSARAEKFSR-KLNGRFGVTVYTHDERLTTFEAKGERMARGGQKGSYRDNPVD 125

Query: 138 SIAAALILQEVLDRISFL 155
           +IAAAL+LQ  LD    L
Sbjct: 126 AIAAALLLQGWLDEHPEL 143


>gi|15609691|ref|NP_217070.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis H37Rv]
 gi|15842092|ref|NP_337129.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis CDC1551]
 gi|31793737|ref|NP_856230.1| Holliday junction resolvase-like protein [Mycobacterium bovis
           AF2122/97]
 gi|121638439|ref|YP_978663.1| Holliday junction resolvase-like protein [Mycobacterium bovis BCG
           str. Pasteur 1173P2]
 gi|148662393|ref|YP_001283916.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis H37Ra]
 gi|148823750|ref|YP_001288504.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis F11]
 gi|167968835|ref|ZP_02551112.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis H37Ra]
 gi|215404503|ref|ZP_03416684.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis 02_1987]
 gi|215412328|ref|ZP_03421088.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis 94_M4241A]
 gi|215427950|ref|ZP_03425869.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis T92]
 gi|215431512|ref|ZP_03429431.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis EAS054]
 gi|218754294|ref|ZP_03533090.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis GM 1503]
 gi|219558558|ref|ZP_03537634.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis T17]
 gi|224990933|ref|YP_002645620.1| Holliday junction resolvase-like protein [Mycobacterium bovis BCG
           str. Tokyo 172]
 gi|253798365|ref|YP_003031366.1| hypothetical protein TBMG_01418 [Mycobacterium tuberculosis KZN
           1435]
 gi|254232676|ref|ZP_04926003.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|254366759|ref|ZP_04982802.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254551606|ref|ZP_05142053.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis '98-R604 INH-RIF-EM']
 gi|260187568|ref|ZP_05765042.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis CPHL_A]
 gi|260201681|ref|ZP_05769172.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis T46]
 gi|260205873|ref|ZP_05773364.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis K85]
 gi|260205876|ref|ZP_05773367.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis K85]
 gi|289444090|ref|ZP_06433834.1| conserved hypothetical protein [Mycobacterium tuberculosis T46]
 gi|289448203|ref|ZP_06437947.1| conserved hypothetical protein [Mycobacterium tuberculosis CPHL_A]
 gi|289553656|ref|ZP_06442866.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605]
 gi|289570723|ref|ZP_06450950.1| conserved hypothetical protein [Mycobacterium tuberculosis T17]
 gi|289575260|ref|ZP_06455487.1| Holliday junction resolvase [Mycobacterium tuberculosis K85]
 gi|289575262|ref|ZP_06455489.1| predicted protein [Mycobacterium tuberculosis K85]
 gi|289746346|ref|ZP_06505724.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289751173|ref|ZP_06510551.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
 gi|289754672|ref|ZP_06514050.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054]
 gi|289762724|ref|ZP_06522102.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|294994335|ref|ZP_06800026.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis 210]
 gi|297635165|ref|ZP_06952945.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis KZN 4207]
 gi|297732157|ref|ZP_06961275.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis KZN R506]
 gi|298526027|ref|ZP_07013436.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|306776828|ref|ZP_07415165.1| hypothetical protein TMAG_02358 [Mycobacterium tuberculosis
           SUMu001]
 gi|306785356|ref|ZP_07423678.1| hypothetical protein TMCG_01799 [Mycobacterium tuberculosis
           SUMu003]
 gi|306794036|ref|ZP_07432338.1| hypothetical protein TMEG_03230 [Mycobacterium tuberculosis
           SUMu005]
 gi|307085241|ref|ZP_07494354.1| hypothetical protein TMLG_02282 [Mycobacterium tuberculosis
           SUMu012]
 gi|313659491|ref|ZP_07816371.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis KZN V2475]
 gi|54039585|sp|P67488|RUVX_MYCBO RecName: Full=Putative Holliday junction resolvase
 gi|54042290|sp|P67487|RUVX_MYCTU RecName: Full=Putative Holliday junction resolvase
 gi|167012735|sp|A1KLQ2|RUVX_MYCBP RecName: Full=Putative Holliday junction resolvase
 gi|167012738|sp|A5U5Q4|RUVX_MYCTA RecName: Full=Putative Holliday junction resolvase
 gi|254767520|sp|C1AF23|RUVX_MYCBT RecName: Full=Putative Holliday junction resolvase
 gi|1781048|emb|CAB06184.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis H37Rv]
 gi|13882373|gb|AAK46943.1| conserved hypothetical protein [Mycobacterium tuberculosis CDC1551]
 gi|31619331|emb|CAD94769.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97]
 gi|121494087|emb|CAL72565.1| Conserved hypothetical protein [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|124601735|gb|EAY60745.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|134152270|gb|EBA44315.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148506545|gb|ABQ74354.1| Holliday junction resolvase-like protein [Mycobacterium
           tuberculosis H37Ra]
 gi|148722277|gb|ABR06902.1| conserved hypothetical protein [Mycobacterium tuberculosis F11]
 gi|224774046|dbj|BAH26852.1| Holliday junction resolvase-like protein [Mycobacterium bovis BCG
           str. Tokyo 172]
 gi|253319868|gb|ACT24471.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
           1435]
 gi|289417009|gb|EFD14249.1| conserved hypothetical protein [Mycobacterium tuberculosis T46]
 gi|289421161|gb|EFD18362.1| conserved hypothetical protein [Mycobacterium tuberculosis CPHL_A]
 gi|289438288|gb|EFD20781.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605]
 gi|289539691|gb|EFD44269.1| Holliday junction resolvase [Mycobacterium tuberculosis K85]
 gi|289539693|gb|EFD44271.1| predicted protein [Mycobacterium tuberculosis K85]
 gi|289544477|gb|EFD48125.1| conserved hypothetical protein [Mycobacterium tuberculosis T17]
 gi|289686874|gb|EFD54362.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289691760|gb|EFD59189.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
 gi|289695259|gb|EFD62688.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054]
 gi|289710230|gb|EFD74246.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|298495821|gb|EFI31115.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|308214755|gb|EFO74154.1| hypothetical protein TMAG_02358 [Mycobacterium tuberculosis
           SUMu001]
 gi|308329948|gb|EFP18799.1| hypothetical protein TMCG_01799 [Mycobacterium tuberculosis
           SUMu003]
 gi|308337593|gb|EFP26444.1| hypothetical protein TMEG_03230 [Mycobacterium tuberculosis
           SUMu005]
 gi|308365195|gb|EFP54046.1| hypothetical protein TMLG_02282 [Mycobacterium tuberculosis
           SUMu012]
 gi|323718827|gb|EGB27983.1| hypothetical protein TMMG_02565 [Mycobacterium tuberculosis
           CDC1551A]
 gi|326904169|gb|EGE51102.1| hypothetical protein TBPG_02063 [Mycobacterium tuberculosis W-148]
 gi|328458135|gb|AEB03558.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
           4207]
          Length = 170

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/147 (29%), Positives = 57/147 (38%), Gaps = 2/147 (1%)

Query: 14  KPNQPIASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFII 73
                   ID+G  RIG+A SDP    A P   + R +  +    L +          I+
Sbjct: 19  PGRGRRLGIDVGAARIGVACSDPDAILATPVETVRRDRSGKHLRRLAALAAELEAVEVIV 78

Query: 74  GLPLNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRI 133
           GLP  +    G            +  R    P    DERLTTVSAQ+ L    V   ++ 
Sbjct: 79  GLPRTLADRIGRSAQDAIELAEALARRVSPTPVRLADERLTTVSAQRSLRQAGVRASEQR 138

Query: 134 QKVDSIAAALILQEVLDRISFLESSKG 160
             +D  AA  ILQ  LD    L +  G
Sbjct: 139 AVIDQAAAVAILQSWLDER--LAAMAG 163


>gi|227894661|ref|ZP_04012466.1| crossover junction endodeoxyribonuclease [Lactobacillus ultunensis
           DSM 16047]
 gi|227863556|gb|EEJ70977.1| crossover junction endodeoxyribonuclease [Lactobacillus ultunensis
           DSM 16047]
          Length = 142

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/138 (31%), Positives = 74/138 (53%), Gaps = 5/138 (3%)

Query: 17  QPIASIDLGTKRIGLAISDPGRRFAHPRPFLV--RKKVTQTALE