RPSBLAST alignment of GI: 254780976 and MMDB domain: 1iv0_A_

>1iv0_A (A:) Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus}Length = 98
 Score = 94.8 bits (236), Expect = 4e-21
 Identities = 32/97 (32%), Positives = 48/97 (49%), Gaps = 2/97 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTALELLSFITTENIAAFIIGLPLN 78
           + ++D+G  RIGLA+ + G   A  R +LVRK + +    LL F+  E +   ++GLPL 
Sbjct: 3   VGALDVGEARIGLAVGEEGVPLASGRGYLVRKTLEEDVEALLDFVRREGLGKLVVGLPLR 62

Query: 79  MNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTT 115
            +  E  +       V  +  R   V    WDER TT
Sbjct: 63  TDLKESAQAGKVLPLVEAL--RARGVEVELWDERFTT 97