RPSBLAST alignment of GI: 254780976 and protein with PDBid: 1vhx

>1vhx_A Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} SCOP: c.55.3.8 Length = 150
 Score =  115 bits (289), Expect = 4e-27
 Identities = 50/137 (36%), Positives = 77/137 (56%), Gaps = 3/137 (2%)

Query: 19  IASIDLGTKRIGLAISDPGRRFAHPRPFLVRKKVTQTAL--ELLSFITTENIAAFIIGLP 76
           I  +DLGTK +G+A+SD     A     +   +         L   I    I   ++G P
Sbjct: 5   ILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLSRLSELIKDYTIDKIVLGFP 64

Query: 77  LNMNGSEGPRVHSTRAFVHNMIDRKVYVPFVFWDERLTTVSAQQILIDMNVSRKKRIQKV 136
            NMNG+ GPR  +++ F   + +    VP V WDERLTT++A+++LI  +VSR+KR + +
Sbjct: 65  KNMNGTVGPRGEASQTFAKVL-ETTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKKVI 123

Query: 137 DSIAAALILQEVLDRIS 153
           D +AA +ILQ  LD ++
Sbjct: 124 DKMAAVMILQGYLDSLN 140