Query         gi|254780977|ref|YP_003065390.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 95
No_of_seqs    109 out of 1328
Neff          6.8 
Searched_HMMs 33803
Date          Wed Jun  1 19:45:55 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780977.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >3ip4_C Aspartyl/glutamyl-tRNA 100.0   2E-30 5.8E-35  186.6   9.5   94    2-95      3-96  (100)
  2 >3h0l_C Glutamyl-tRNA(Gln) ami 100.0 6.3E-30 1.9E-34  183.8   8.6   93    2-95      1-93  (94)
  3 >1wy9_A Allograft inflammatory  32.0      41  0.0012   15.8   3.6   30    2-31      5-34  (43)
  4 >3dtp_E RLC, myosin regulatory  28.2      48  0.0014   15.4   3.4   29    2-30      5-33  (42)
  5 >1y1x_A Leishmania major homol  16.7      84  0.0025   14.1   2.9   30    2-31     43-72  (79)
  6 >2w1o_A 60S acidic ribosomal p  16.5      85  0.0025   14.0   3.9   31    3-33     19-49  (70)
  7 >1nyr_A Threonyl-tRNA syntheta  15.5      55  0.0016   15.0   0.8   49   18-71     48-96  (106)
  8 >2jvd_A UPF0291 protein YNZC;   15.4      91  0.0027   13.9   2.6   26    2-27      1-30  (54)
  9 >1gjy_A Sorcin, CP-22, V19; ca  14.4      97  0.0029   13.7   2.5   28    3-30     33-60  (69)
 10 >2hep_A UPF0291 protein YNZC;   13.3   1E+02  0.0031   13.5   2.1   27    2-28      1-31  (85)

No 1  
>>3ip4_C Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_C 2dqn_C* 2g5h_C 2g5i_C* 2f2a_C (C:)
Probab=99.97  E-value=2e-30  Score=186.56  Aligned_cols=94  Identities=28%  Similarity=0.382  Sum_probs=92.6

Q ss_pred             CCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCH
Q ss_conf             88889999999985277889999999999999999999995235478985211222446677873689999899984083
Q gi|254780977|r    2 LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAP   81 (95)
Q Consensus         2 ~i~~~~i~~la~LarL~l~eee~~~~~~~l~~il~~v~~l~~vdt~~vep~~~~~~~~~~lReD~~~~~~~~e~~l~nap   81 (95)
                      +|++++|+|||+||||+|+++|+++++++|++|+.|+++|++|||+||+||+|+.+..++||+|++.++.+++.+|+|||
T Consensus         3 ~i~~e~i~~la~LarL~l~eee~~~~~~~l~~il~~~~~L~evdt~~Vep~~~~~~~~~~lReD~~~~~~~~e~il~nap   82 (100)
T 3ip4_C            3 KVTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVLREDKAIKGIPQELALKNAK   82 (100)
T ss_dssp             CCCHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHHHGGGGGSCCTTCCCCSCCSCCCCCCBCSCCCCCCCHHHHHTTCS
T ss_pred             CCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCC
T ss_conf             79999999999982789999999999999999999999983477678887643222356787986899989999987286


Q ss_pred             HHCCCEEECCEECC
Q ss_conf             32075685350049
Q gi|254780977|r   82 HVEKNFFVVPKAVE   95 (95)
Q Consensus        82 ~~~~~yf~VPkViE   95 (95)
                      ++++|||+||||||
T Consensus        83 ~~~~~yf~VPkVie   96 (100)
T 3ip4_C           83 ETEDGQFKVPTIMN   96 (100)
T ss_dssp             SEETTEEEEECC--
T ss_pred             CCCCCEEEECCCCC
T ss_conf             31299377061648


No 2  
>>3h0l_C Glutamyl-tRNA(Gln) amidotransferase subunit C; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_C 3h0r_C* (C:)
Probab=99.96  E-value=6.3e-30  Score=183.79  Aligned_cols=93  Identities=33%  Similarity=0.533  Sum_probs=90.0

Q ss_pred             CCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCH
Q ss_conf             88889999999985277889999999999999999999995235478985211222446677873689999899984083
Q gi|254780977|r    2 LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAP   81 (95)
Q Consensus         2 ~i~~~~i~~la~LarL~l~eee~~~~~~~l~~il~~v~~l~~vdt~~vep~~~~~~~~~~lReD~~~~~~~~e~~l~nap   81 (95)
                      ||++++|+|||+||||+|+++|++.+.++|++|++|+++|+++||+||+||+|+.... +||+|++.++.+++++|+|||
T Consensus         1 mi~~~~i~~la~La~l~lseee~~~~~~~l~~il~~~e~l~~vdt~~v~p~~~~~~~~-~lReD~~~~~~~~e~il~nap   79 (94)
T 3h0l_C            1 MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEET-PMREDEPHPSLDREKALMNAP   79 (94)
T ss_dssp             -CCHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHHTTTGGGSCCTTCCCCCCCCSSC-CCBCSCCCCCCCHHHHHTTCS
T ss_pred             CCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCHHHHHHCCC
T ss_conf             9898999999998478999999999999999999999998344658889765556566-778861888979999987575


Q ss_pred             HHCCCEEECCEECC
Q ss_conf             32075685350049
Q gi|254780977|r   82 HVEKNFFVVPKAVE   95 (95)
Q Consensus        82 ~~~~~yf~VPkViE   95 (95)
                      +.++|||+||||||
T Consensus        80 ~~~~~~f~VPkViE   93 (94)
T 3h0l_C           80 ERKDGFFVVPRVVE   93 (94)
T ss_dssp             SEETTEEEEECCC-
T ss_pred             CCCCCEEECCEEEE
T ss_conf             31499486131877


No 3  
>>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A (A:60-102)
Probab=32.03  E-value=41  Score=15.76  Aligned_cols=30  Identities=13%  Similarity=0.241  Sum_probs=26.1

Q ss_pred             CCCHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             888899999999852778899999999999
Q gi|254780977|r    2 LIDVVDVKRIAHFSRISIKEEDIPLFLLRL   31 (95)
Q Consensus         2 ~i~~~~i~~la~LarL~l~eee~~~~~~~l   31 (95)
                      .|+.++++++.+-.-..+++++++++..++
T Consensus         5 ~I~~~ELr~~l~~lG~~~t~~ei~~mi~~~   34 (43)
T 1wy9_A            5 DIDIMSLKRMLEKLGVPKTHLELKRLIREV   34 (43)
T ss_dssp             SEEHHHHHHHHHHTTCCCCHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHCCCCHHHHHHHHHHHC
T ss_conf             898289999999741230168777776421


No 4  
>>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} (E:137-178)
Probab=28.22  E-value=48  Score=15.39  Aligned_cols=29  Identities=10%  Similarity=0.000  Sum_probs=25.4

Q ss_pred             CCCHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             88889999999985277889999999999
Q gi|254780977|r    2 LIDVVDVKRIAHFSRISIKEEDIPLFLLR   30 (95)
Q Consensus         2 ~i~~~~i~~la~LarL~l~eee~~~~~~~   30 (95)
                      .|+..+++++..-.-..+++++++++..+
T Consensus         5 ~Is~~ELr~~l~~~G~~lt~~ei~emi~~   33 (42)
T 3dtp_E            5 KCKEETLKRSLTTWGEKFSQDEVDQALSE   33 (42)
T ss_dssp             CCBHHHHHHHHHHSSSCCCHHHHHHHHHS
T ss_pred             CHHHHHHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             23368898889985889999999999998


No 5  
>>1y1x_A Leishmania major homolog of programmed cell death 6 protein; SGPP, structural genomics, PSI, protein structure initiative; 1.95A {Leishmania major strain friedlin} (A:1-79)
Probab=16.74  E-value=84  Score=14.06  Aligned_cols=30  Identities=10%  Similarity=0.066  Sum_probs=23.7

Q ss_pred             CCCHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             888899999999852778899999999999
Q gi|254780977|r    2 LIDVVDVKRIAHFSRISIKEEDIPLFLLRL   31 (95)
Q Consensus         2 ~i~~~~i~~la~LarL~l~eee~~~~~~~l   31 (95)
                      .|+.++++++..-.-..+++++++.+...+
T Consensus        43 ~I~~~el~~~l~~~g~~ls~~ei~~~~~~~   72 (79)
T 1y1x_A           43 AISVPELNAALSSAGVPFSLATTEKLLHMY   72 (79)
T ss_dssp             SBCHHHHHHHHCBTTBCCCHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             697999999999850268777766776420


No 6  
>>2w1o_A 60S acidic ribosomal protein P2; ribonucleoprotein, ribosome, translation, dimerization, phosphoprotein; NMR {Homo sapiens} (A:)
Probab=16.52  E-value=85  Score=14.03  Aligned_cols=31  Identities=19%  Similarity=0.288  Sum_probs=28.0

Q ss_pred             CCHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
Q ss_conf             8889999999985277889999999999999
Q gi|254780977|r    3 IDVVDVKRIAHFSRISIKEEDIPLFLLRLNN   33 (95)
Q Consensus         3 i~~~~i~~la~LarL~l~eee~~~~~~~l~~   33 (95)
                      .+.++|++|-.-+-++.+++.++.+...|+.
T Consensus        19 Ps~~dvkkIL~svG~e~d~~~l~~lv~~l~g   49 (70)
T 2w1o_A           19 PSAKDIKKILDSVGIEADDDRLNKVISELNG   49 (70)
T ss_dssp             CCHHHHHHHHHHHTCCCCSHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHCCCCCCHHHHHHHHHHHCC
T ss_conf             9999999999984886369999999999569


No 7  
>>1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} (A:66-134,A:188-224)
Probab=15.48  E-value=55  Score=15.05  Aligned_cols=49  Identities=8%  Similarity=0.072  Sum_probs=32.6

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             788999999999999999999999523547898521122244667787368999
Q gi|254780977|r   18 SIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGD   71 (95)
Q Consensus        18 ~l~eee~~~~~~~l~~il~~v~~l~~vdt~~vep~~~~~~~~~~lReD~~~~~~   71 (95)
                      .+++++++++..+++.++.     +.++|.-|....--.-...+||-|.-...+
T Consensus        48 ~lT~eel~~IE~kMnelI~-----~nl~~~~~~~~~~~~~~~~~~~~~~~~~~l   96 (106)
T 1nyr_A           48 NISSDDFEQIEKTMKQIVN-----ENMSTAKIKEFKLLSTAGAYWRGDSNNKML   96 (106)
T ss_dssp             CCCSTTHHHHHHHHHHHHH-----TTCCGGGCCEEEEEEEEEEETTSCSSSCEE
T ss_pred             CCCHHHHHHHHHHHHHHHH-----CCCCCHHCCCHHHHHCCHHEECCCCCCHHH
T ss_conf             9998999999999999985-----599720013033322020100587437011


No 8  
>>2jvd_A UPF0291 protein YNZC; solution structure, construct optimization, cytoplasm, structural genomics, unknown function, PSI-2; NMR {Bacillus subtilis} (A:)
Probab=15.37  E-value=91  Score=13.86  Aligned_cols=26  Identities=23%  Similarity=0.302  Sum_probs=19.9

Q ss_pred             CCCHHHHHHHHHHHCC----CCCHHHHHHH
Q ss_conf             8888999999998527----7889999999
Q gi|254780977|r    2 LIDVVDVKRIAHFSRI----SIKEEDIPLF   27 (95)
Q Consensus         2 ~i~~~~i~~la~LarL----~l~eee~~~~   27 (95)
                      |++++.|.+|-.||+.    .||++|..+=
T Consensus         1 M~~~~~i~RINeLakK~K~~gLT~~Ek~Eq   30 (54)
T 2jvd_A            1 MISNAKIARINELAAKAKAGVITEEEKAEQ   30 (54)
T ss_dssp             CCCHHHHHHHHHHHHHHHHTCCCHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCHHHHHHH
T ss_conf             986889999999998874259999999999


No 9  
>>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} (A:57-125)
Probab=14.43  E-value=97  Score=13.72  Aligned_cols=28  Identities=7%  Similarity=0.173  Sum_probs=15.5

Q ss_pred             CCHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             8889999999985277889999999999
Q gi|254780977|r    3 IDVVDVKRIAHFSRISIKEEDIPLFLLR   30 (95)
Q Consensus         3 i~~~~i~~la~LarL~l~eee~~~~~~~   30 (95)
                      |+.++++++.+-.-..++++++..+..+
T Consensus        33 I~~~el~~~l~~~g~~~s~~ei~~l~~~   60 (69)
T 1gjy_A           33 VDPQELQKALTTMGFRLNPQTVNSIAKR   60 (69)
T ss_dssp             ECHHHHHHHHHTTTCCCCHHHHHHHHHH
T ss_pred             ECHHHHHHHHHHCCCCCCHHHHHHHHHH
T ss_conf             7599999999981899999999999999


No 10 
>>2hep_A UPF0291 protein YNZC; SR384, structure, autostructure, northeast structural genomics consortium, PSI-1, protein structure initiative, NESG; NMR {Bacillus subtilis} (A:)
Probab=13.34  E-value=1e+02  Score=13.54  Aligned_cols=27  Identities=22%  Similarity=0.271  Sum_probs=20.1

Q ss_pred             CCCHHHHHHHHHHHCC----CCCHHHHHHHH
Q ss_conf             8888999999998527----78899999999
Q gi|254780977|r    2 LIDVVDVKRIAHFSRI----SIKEEDIPLFL   28 (95)
Q Consensus         2 ~i~~~~i~~la~LarL----~l~eee~~~~~   28 (95)
                      |++++.|.+|-.||+.    .||++|..+=.
T Consensus         1 M~~~~~i~RINeLakK~K~~gLT~eEk~Eq~   31 (85)
T 2hep_A            1 MISNAKIARINELAAKAKAGVITEEEKAEQQ   31 (85)
T ss_dssp             CCCSHHHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCCHHHHHHHH
T ss_conf             9858899999999987412589999999999


Done!