HHsearch results for GI: 254780977 and protein with PDBid: 3h0l_C

>3h0l_C Glutamyl-tRNA(Gln) amidotransferase subunit C; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_C 3h0r_C*
Probab=99.97  E-value=7.3e-31  Score=188.08  Aligned_cols=93  Identities=33%  Similarity=0.542  Sum_probs=90.4

Q ss_pred             CCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCH
Q ss_conf             88889999999985277889999999999999999999995235478985211222446677873689999899984083
Q gi|254780977|r    2 LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAP   81 (95)
Q Consensus         2 ~i~~~~i~~la~LarL~l~eee~~~~~~~l~~il~~v~~l~~vdt~~vep~~~~~~~~~~lReD~~~~~~~~e~~l~nap   81 (95)
                      ||++++|+|||+||||+|+++|++.++++|++||+||++|+++||+||+||+|+.+ .+.||+|++.++.+++++|+|||
T Consensus         1 mi~~e~v~~lA~Larl~l~eeE~~~~~~~l~~Il~~~~~L~~vDt~~v~p~~~~~~-~~~lReD~~~~~~~~e~~l~nap   79 (94)
T 3h0l_C            1 MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFE-ETPMREDEPHPSLDREKALMNAP   79 (94)
T ss_dssp             -CCHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHHTTTGGGSCCTTCCCCCCCCS-SCCCBCSCCCCCCCHHHHHTTCS
T ss_pred             CCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCHHHHHHCCC
T ss_conf             98999999999984789999999999999999999999983556588886656554-66878882889979999987675


Q ss_pred             HHCCCEEECCEECC
Q ss_conf             32075685350049
Q gi|254780977|r   82 HVEKNFFVVPKAVE   95 (95)
Q Consensus        82 ~~~~~yf~VPkViE   95 (95)
                      +.++|||+||||||
T Consensus        80 ~~~~~yf~VPkVie   93 (94)
T 3h0l_C           80 ERKDGFFVVPRVVE   93 (94)
T ss_dssp             SEETTEEEEECCC-
T ss_pred             CCCCCEEECCEEEE
T ss_conf             31499487010767