BLAST/PSIBLAST alignment of GI: 254780977 and GI: 150396166 at iteration 1
>gi|150396166|ref|YP_001326633.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Sinorhizobium medicae WSM419] Length = 95
>gi|166218182|sp|A6U818|GATC_SINMW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C Length = 95
>gi|150027681|gb|ABR59798.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sinorhizobium medicae WSM419] Length = 95
 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 67/95 (70%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI++ +++       +N  L  +E++SEVNV+GVEPM SV+PM M
Sbjct: 1  MSVDLATVKRVARLARIAVSDQEAERMTSEINGILGFVEQLSEVNVDGVEPMTSVMPMTM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DGDK   I++NAP+ ++NFFVVPK VE
Sbjct: 61 KKREDVVADGDKAADIVANAPNSDRNFFVVPKVVE 95