BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780977|ref|YP_003065390.1| putative glutamyl-tRNA(Gln)
amidotransferase subunit C protein [Candidatus Liberibacter asiaticus
str. psy62]
         (95 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780977|ref|YP_003065390.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C protein
          [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040654|gb|ACT57450.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C protein
          [Candidatus Liberibacter asiaticus str. psy62]
          Length = 95

 Score =  185 bits (470), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/95 (100%), Positives = 95/95 (100%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM
Sbjct: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE
Sbjct: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95


>gi|315122521|ref|YP_004063010.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C protein
          [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495923|gb|ADR52522.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C protein
          [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 95

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/95 (78%), Positives = 83/95 (87%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M++DVVDVKRIAH SRI I+EEDIPL L R N TLSVL KISEVNV+GVEPM SV+PMKM
Sbjct: 1  MVMDVVDVKRIAHLSRILIEEEDIPLLLSRFNQTLSVLNKISEVNVDGVEPMTSVLPMKM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V RPD+VCDG KV+SILSNAPHVE NFF+VPK VE
Sbjct: 61 VLRPDIVCDGGKVDSILSNAPHVENNFFLVPKIVE 95


>gi|15965064|ref|NP_385417.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C protein
          [Sinorhizobium meliloti 1021]
 gi|307301135|ref|ZP_07580904.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sinorhizobium
          meliloti BL225C]
 gi|307317868|ref|ZP_07597306.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sinorhizobium
          meliloti AK83]
 gi|20138269|sp|Q92QK8|GATC_RHIME RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|15074243|emb|CAC45890.1| Putative glutamyl-tRNA(GLN) amidotransferase subunit C
          [Sinorhizobium meliloti 1021]
 gi|306896630|gb|EFN27378.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sinorhizobium
          meliloti AK83]
 gi|306904090|gb|EFN34676.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sinorhizobium
          meliloti BL225C]
          Length = 95

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 69/95 (72%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI++ +E+       LN  L  +E++SEV+V+GVEPM SV+PMKM
Sbjct: 1  MSVDLATVKRVARLARIAVSDEEAERMTGELNGILGFVEQLSEVDVDGVEPMTSVMPMKM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D+V DGDK + I++NAP+ ++NFF+VPK VE
Sbjct: 61 KKRDDIVADGDKADDIVANAPNSDRNFFLVPKVVE 95


>gi|39936174|ref|NP_948450.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Rhodopseudomonas palustris CGA009]
 gi|81562236|sp|Q6N571|GATC_RHOPA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|39650029|emb|CAE28552.1| Glu-tRNA(Gln) amidotransferase subunit C [Rhodopseudomonas
          palustris CGA009]
          Length = 95

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 48/95 (50%), Positives = 68/95 (71%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI++ E+++P     LN  L+ +E++SEVNVEGVEPM SV PM+M
Sbjct: 1  MSVDAATVRRIAHLARIAVTEDEVPHLQGELNAMLAFVEQLSEVNVEGVEPMTSVTPMQM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+  + +++NAP  E +FF+VPK VE
Sbjct: 61 KKRADVVNDGEIADQVVANAPSTEDHFFLVPKVVE 95


>gi|159184708|ref|NP_354324.2| glutamyl-tRNA-Gln-amidotransferase chain C [Agrobacterium
          tumefaciens str. C58]
 gi|39931606|sp|Q8UFS9|GATC_AGRT5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|159139996|gb|AAK87109.2| glutamyl-tRNA-Gln-amidotransferase chain C [Agrobacterium
          tumefaciens str. C58]
          Length = 95

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 69/95 (72%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI++ EE+    L +LN  L  +E++SEVNV+GVEPM SV P++M
Sbjct: 1  MSVDLATVKRVARLARIAVSEEEAQNMLGQLNGILGFVEQLSEVNVDGVEPMTSVTPVEM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+K + I++NAP  +++FF+VPK VE
Sbjct: 61 KKRADVVTDGNKADDIVANAPATDRDFFMVPKVVE 95


>gi|150396166|ref|YP_001326633.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Sinorhizobium
          medicae WSM419]
 gi|166218182|sp|A6U818|GATC_SINMW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|150027681|gb|ABR59798.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sinorhizobium
          medicae WSM419]
          Length = 95

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 67/95 (70%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI++ +++       +N  L  +E++SEVNV+GVEPM SV+PM M
Sbjct: 1  MSVDLATVKRVARLARIAVSDQEAERMTSEINGILGFVEQLSEVNVDGVEPMTSVMPMTM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DGDK   I++NAP+ ++NFFVVPK VE
Sbjct: 61 KKREDVVADGDKAADIVANAPNSDRNFFVVPKVVE 95


>gi|325292678|ref|YP_004278542.1| Glu-tRNA Gln amidotransferase subunit C [Agrobacterium sp. H13-3]
 gi|325060531|gb|ADY64222.1| Glu-tRNA Gln amidotransferase subunit C [Agrobacterium sp. H13-3]
          Length = 95

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 68/95 (71%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI++ E++    L +LN  L  +E++SEVNV+GVEPM SV P+ M
Sbjct: 1  MSVDLATVKRVARLARIAVTEDEAQNMLGQLNGILGFVEQLSEVNVDGVEPMTSVTPVDM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+K E I++NAP  +++FF+VPK VE
Sbjct: 61 KKRADVVTDGNKAEDIVANAPATDRDFFMVPKVVE 95


>gi|319783696|ref|YP_004143172.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Mesorhizobium
          ciceri biovar biserrulae WSM1271]
 gi|317169584|gb|ADV13122.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Mesorhizobium
          ciceri biovar biserrulae WSM1271]
          Length = 95

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/95 (50%), Positives = 64/95 (67%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+AH +RI++ EED       LN  L  +E+++EV+V G+EPM SV PM M
Sbjct: 1  MSVDLQTVKRVAHLARIAVSEEDAERMTGELNAILGFVEQLNEVDVSGIEPMTSVTPMDM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG K   I++NAP  E+NFF+VPK VE
Sbjct: 61 KKRQDVVTDGGKAADIVANAPATEENFFLVPKVVE 95


>gi|227821664|ref|YP_002825634.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Sinorhizobium
          fredii NGR234]
 gi|254791010|sp|C3MAA2|GATC_RHISN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|227340663|gb|ACP24881.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sinorhizobium
          fredii NGR234]
          Length = 95

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 68/95 (71%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI++ +E+       LN  L  +E++SEVNV+GVEPM SV+PM+M
Sbjct: 1  MSVDLATVKRVARLARIAVSDEEAERMTGELNGILGFVEQLSEVNVDGVEPMTSVMPMEM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D+V DGDK   I++NAP+ +++FF+VPK VE
Sbjct: 61 KKRDDIVADGDKAADIVANAPNSDRDFFLVPKVVE 95


>gi|77462821|ref|YP_352325.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhodobacter
          sphaeroides 2.4.1]
 gi|126461713|ref|YP_001042827.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhodobacter
          sphaeroides ATCC 17029]
 gi|221638689|ref|YP_002524951.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhodobacter
          sphaeroides KD131]
 gi|332557709|ref|ZP_08412031.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhodobacter
          sphaeroides WS8N]
 gi|123592458|sp|Q3J460|GATC_RHOS4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|166218175|sp|A3PI89|GATC_RHOS1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|254791012|sp|B9KPF7|GATC_RHOSK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|77387239|gb|ABA78424.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rhodobacter sphaeroides 2.4.1]
 gi|126103377|gb|ABN76055.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rhodobacter sphaeroides ATCC 17029]
 gi|221159470|gb|ACM00450.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rhodobacter sphaeroides KD131]
 gi|332275421|gb|EGJ20736.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhodobacter
          sphaeroides WS8N]
          Length = 95

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 64/95 (67%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID+   +R+AH +RI + E D+P     L+  L+ +E+++EV+VEG+EPM SV PM++
Sbjct: 1  MSIDIETARRVAHLARIRVDEADLPALAGELSGILTFMEQLNEVDVEGIEPMTSVTPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DGD  + +LSNAP   + FF VPK VE
Sbjct: 61 KRRQDVVTDGDMQDKVLSNAPDAREGFFAVPKVVE 95


>gi|209884928|ref|YP_002288785.1| C subunit of glutamyl-tRNA(Gln) amidotransferase [Oligotropha
          carboxidovorans OM5]
 gi|229487527|sp|B6JFW0|GATC_OLICO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|209873124|gb|ACI92920.1| C subunit of glutamyl-tRNA(Gln) amidotransferase [Oligotropha
          carboxidovorans OM5]
          Length = 95

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 69/95 (72%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIA  +RI++K+E++P     LN  L+ +E++SEV++EGVEPM SV+PM+M
Sbjct: 1  MSVDAATVRRIAQLARIAVKDEEVPHLQGELNAMLAFIEQLSEVDIEGVEPMTSVIPMEM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+  + +L+NAP  E +FF+VPK VE
Sbjct: 61 KKRQDVVNDGEIADLVLANAPATEDHFFLVPKVVE 95


>gi|146278263|ref|YP_001168422.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhodobacter
          sphaeroides ATCC 17025]
 gi|166218176|sp|A4WUQ3|GATC_RHOS5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|145556504|gb|ABP71117.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rhodobacter sphaeroides ATCC 17025]
          Length = 95

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 64/95 (67%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID+   +R+AH +RI + E D+P     L+  L+ +E+++EV+VEGVEPM SV PM++
Sbjct: 1  MSIDIETARRVAHLARIRVDEADLPALAGELSGILTFMEQLNEVDVEGVEPMTSVTPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DGD  + +L+NAP   + FF VPK VE
Sbjct: 61 KRRQDVVTDGDMQDKVLANAPDAREGFFAVPKVVE 95


>gi|13470865|ref|NP_102434.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Mesorhizobium
          loti MAFF303099]
 gi|18202654|sp|Q98M93|GATC_RHILO RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|14021608|dbj|BAB48220.1| Glu-tRNA(Gln) amidotransferase subunit C [Mesorhizobium loti
          MAFF303099]
          Length = 95

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 48/95 (50%), Positives = 65/95 (68%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI++ EED       LN  L  +E+++EV+V GVEPM SV PM+M
Sbjct: 1  MSVDLQTVKRVARLARIAVSEEDAERMTGELNAILGFVEQLNEVDVSGVEPMTSVTPMEM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+K   I++NAP  E+NFF+VPK VE
Sbjct: 61 KKRQDVVTDGNKAADIVANAPATEENFFLVPKVVE 95


>gi|222085626|ref|YP_002544156.1| glutamyl-tRNA amidotransferase subunit C protein [Agrobacterium
          radiobacter K84]
 gi|254790977|sp|B9JDM9|GATC_AGRRK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|221723074|gb|ACM26230.1| glutamyl-tRNA amidotransferase subunit C protein [Agrobacterium
          radiobacter K84]
          Length = 95

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 65/95 (68%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+AH +RI++ E++    +  LN  L  +E++SEVNV+GVE M SV PM M
Sbjct: 1  MSVDLATVKRVAHLARIAVNEDEAQRMVGELNGMLGFVEQLSEVNVDGVEAMTSVTPMAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG K   I++NAP+ ++NFF+VPK VE
Sbjct: 61 KKRTDEVTDGSKAADIVANAPNTDQNFFLVPKVVE 95


>gi|260459189|ref|ZP_05807444.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Mesorhizobium
          opportunistum WSM2075]
 gi|259034743|gb|EEW35999.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Mesorhizobium
          opportunistum WSM2075]
          Length = 95

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 48/95 (50%), Positives = 65/95 (68%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI++ EED       LN  L  +E+++EV+V GVEPM SV PM+M
Sbjct: 1  MSVDLQTVKRVARLARIAVSEEDAERMTGELNAILGFVEQLNEVDVSGVEPMTSVTPMEM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+K   I++NAP  E+NFF+VPK VE
Sbjct: 61 KKRGDVVTDGNKAADIVANAPATEENFFLVPKVVE 95


>gi|27380201|ref|NP_771730.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bradyrhizobium
          japonicum USDA 110]
 gi|39931534|sp|Q89K28|GATC_BRAJA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|27353355|dbj|BAC50355.1| glutamyl-tRNA-Gln-amidotransferase chain C [Bradyrhizobium
          japonicum USDA 110]
          Length = 95

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 48/95 (50%), Positives = 66/95 (69%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI++ E ++P     LN  L+ +E++SEVNVEGVE M SV PM+M
Sbjct: 1  MSVDAATVRRIAHLARIAVSEGEVPHLQGELNAMLAFVEQLSEVNVEGVEAMTSVTPMQM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+  + I++NAP  E +FF+VPK VE
Sbjct: 61 KKRQDVVNDGEIADDIVANAPATEGHFFLVPKVVE 95


>gi|192291891|ref|YP_001992496.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Rhodopseudomonas palustris TIE-1]
 gi|229487537|sp|B3Q9W8|GATC_RHOPT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|192285640|gb|ACF02021.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhodopseudomonas
          palustris TIE-1]
          Length = 95

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 68/95 (71%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI++ E+++P     LN  L+ +E++SEV+V+GVEPM SV PM+M
Sbjct: 1  MSVDAATVRRIAHLARIAVTEDEVPHLQGELNAMLAFVEQLSEVDVDGVEPMTSVTPMQM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+  + +++NAP  E +FF+VPK VE
Sbjct: 61 KKRADVVNDGEIADQVVANAPSTEDHFFLVPKVVE 95


>gi|316933657|ref|YP_004108639.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Rhodopseudomonas
          palustris DX-1]
 gi|315601371|gb|ADU43906.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhodopseudomonas
          palustris DX-1]
          Length = 95

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 68/95 (71%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI++ ++++P     LN  L+ +E++SEV+VEGVEPM SV PM+M
Sbjct: 1  MSVDAATVRRIAHLARIAVTDDEVPHLQGELNAMLAFVEQLSEVDVEGVEPMTSVTPMQM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+  + +++NAP  E +FF+VPK VE
Sbjct: 61 KKRADVVDDGEITDQVVANAPSTEDHFFLVPKVVE 95


>gi|146341401|ref|YP_001206449.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bradyrhizobium
          sp. ORS278]
 gi|166198843|sp|A4YWF3|GATC_BRASO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|146194207|emb|CAL78229.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Bradyrhizobium sp.
          ORS278]
          Length = 95

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V++IA  +RI++ + ++P     LN  L+ +E++SEVNVEGVEPM SV PM M
Sbjct: 1  MSVDAATVRKIAQLARIAVTDAEVPHLQGELNAMLAFVEQLSEVNVEGVEPMTSVTPMAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV +GD  + I+ NAP  E NFF+VPK VE
Sbjct: 61 KKRQDVVTEGDIADDIVKNAPMTENNFFLVPKVVE 95


>gi|163759346|ref|ZP_02166432.1| putative glutamyl-trna(gln) amidotransferase subunit c protein
          [Hoeflea phototrophica DFL-43]
 gi|162283750|gb|EDQ34035.1| putative glutamyl-trna(gln) amidotransferase subunit c protein
          [Hoeflea phototrophica DFL-43]
          Length = 95

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/95 (50%), Positives = 65/95 (68%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+AH +RI++ EE+       LN  L  +E++SEV+V+GVEPM SV+PM M
Sbjct: 1  MSVDLATVKRVAHLARIAVSEEEAARMEGELNVILGFVEQLSEVDVDGVEPMTSVMPMAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG K E I++NAP    +FF+VPK VE
Sbjct: 61 KKREDVVTDGSKAEDIVANAPETTDSFFMVPKVVE 95


>gi|188582762|ref|YP_001926207.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylobacterium
          populi BJ001]
 gi|229487517|sp|B1ZLM0|GATC_METPB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|179346260|gb|ACB81672.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylobacterium
          populi BJ001]
          Length = 95

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 64/95 (67%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI++ +ED+      LN  L+ +E++  V+VEGVEPM SV PM+M
Sbjct: 1  MSVDETTVRRIAHLARIAVADEDVGPLQGELNAILAFVEQLGAVDVEGVEPMTSVTPMRM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG +   I++NAP  E N+F+VPK VE
Sbjct: 61 KKRADVVNDGGRASDIVANAPETEDNYFLVPKVVE 95


>gi|86749554|ref|YP_486050.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Rhodopseudomonas palustris HaA2]
 gi|123408159|sp|Q2IXC1|GATC_RHOP2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|86572582|gb|ABD07139.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rhodopseudomonas palustris HaA2]
          Length = 95

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 68/95 (71%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI++ ++++P     LN  L+ +E++SEV+V+GVEPM SV PM+M
Sbjct: 1  MSVDAATVRRIAHLARIAVTDDEVPHLQGELNAMLAFVEQLSEVDVDGVEPMTSVTPMQM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+  + +++NAP  E +FF+VPK VE
Sbjct: 61 KKRADVVNDGEIADQVVANAPATEDHFFLVPKVVE 95


>gi|114707195|ref|ZP_01440093.1| Glu-tRNA(Gln) amidotransferase subunit C [Fulvimarina pelagi
          HTCC2506]
 gi|114537391|gb|EAU40517.1| Glu-tRNA(Gln) amidotransferase subunit C [Fulvimarina pelagi
          HTCC2506]
          Length = 95

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/95 (50%), Positives = 63/95 (66%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+R+A  SRI++ +ED+P     LN  L  +E++SEV+V  VEPM SV PM+M
Sbjct: 1  MSVDADTVRRVAKLSRIALSDEDVPAMQEELNAILGFVEQLSEVDVSSVEPMTSVTPMEM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DGDK   I++NAP  E NFF+VPK VE
Sbjct: 61 KKRKDGVTDGDKAADIVANAPVSEDNFFMVPKVVE 95


>gi|115525363|ref|YP_782274.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Rhodopseudomonas palustris BisA53]
 gi|122295579|sp|Q07L90|GATC_RHOP5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|115519310|gb|ABJ07294.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rhodopseudomonas palustris BisA53]
          Length = 95

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 68/95 (71%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI++ ++++P     LN  L+ +E++SEV+VEGVEPM SV PM+M
Sbjct: 1  MSVDATTVRRIAHLARIAVTDDEVPHLQGELNAMLAFVEQLSEVDVEGVEPMTSVTPMQM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D+V DG+  + +++NAP  E +FF+VPK VE
Sbjct: 61 KKRADLVDDGEITDKVVANAPASEDHFFLVPKVVE 95


>gi|294678275|ref|YP_003578890.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Rhodobacter
          capsulatus SB 1003]
 gi|294477095|gb|ADE86483.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhodobacter
          capsulatus SB 1003]
          Length = 95

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 65/95 (68%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID+   +++AH +RI + E D+P    +L+  L+ +E+++EVNV+G+EPM SV PM++
Sbjct: 1  MSIDIDTARKVAHLARIRVPESDLPKLAEQLSGILTFMEQLNEVNVDGIEPMTSVTPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+  E++L NAP   + FF VPK VE
Sbjct: 61 KRRADVVTDGNYPEAVLKNAPDAREGFFAVPKVVE 95


>gi|182678846|ref|YP_001832992.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Beijerinckia
          indica subsp. indica ATCC 9039]
 gi|229487481|sp|B2IEA5|GATC_BEII9 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|182634729|gb|ACB95503.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Beijerinckia
          indica subsp. indica ATCC 9039]
          Length = 95

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 66/95 (69%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D V V++IAH +RI + + D+P     LN  L+ +E+++ V+VEGVEPM SV+PM M
Sbjct: 1  MSVDAVTVRKIAHLARIKVNDADVPHVQEELNAILAFVEQLASVDVEGVEPMTSVMPMPM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D+V DG   ++I++NAP  E +FFVVPK VE
Sbjct: 61 TKREDIVTDGGIADAIVANAPATEDHFFVVPKVVE 95


>gi|89069143|ref|ZP_01156516.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Oceanicola
          granulosus HTCC2516]
 gi|89045316|gb|EAR51382.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Oceanicola
          granulosus HTCC2516]
          Length = 95

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 63/95 (66%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID    +++AH +RI ++++ +P      N+ L  +E++ EV+VEGVEPMVSV PM++
Sbjct: 1  MSIDTETARKVAHLARIRVEDDALPALAREFNDILGFIEQLQEVDVEGVEPMVSVTPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DGD+   +L+NAP   + FF VPK VE
Sbjct: 61 KRREDVVTDGDQQARVLANAPDAREGFFAVPKVVE 95


>gi|222148319|ref|YP_002549276.1| glutamyl-tRNA-Gln-amidotransferase chain C [Agrobacterium vitis
          S4]
 gi|254790978|sp|B9JVJ0|GATC_AGRVS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|221735307|gb|ACM36270.1| glutamyl-tRNA-Gln-amidotransferase chain C [Agrobacterium vitis
          S4]
          Length = 95

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 66/95 (69%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI++ E++    +  LN  L  +E++SEVNV+GVEPM SV+PM M
Sbjct: 1  MSVDLATVKRVAKLARIALPEDEAERVMGELNGILGFVEQLSEVNVDGVEPMTSVMPMAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG K + I++NAP  +++FF+VPK VE
Sbjct: 61 RKRKDAVTDGGKADDIVANAPETDRHFFLVPKVVE 95


>gi|218680910|ref|ZP_03528807.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhizobium etli
          CIAT 894]
          Length = 95

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 63/95 (66%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+AH +RI++ E++    +  LN  L  +E++SEVNV+GVE M SV PM M
Sbjct: 1  MSVDLATVKRVAHLARIAVSEDEANRMVGELNGILGFVEQLSEVNVDGVEAMTSVTPMAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG K   +++NAP  + NFF+VPK VE
Sbjct: 61 KKRTDAVTDGSKAADVVANAPVTDHNFFLVPKVVE 95


>gi|148256061|ref|YP_001240646.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bradyrhizobium
          sp. BTAi1]
 gi|166198842|sp|A5EKP6|GATC_BRASB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|146408234|gb|ABQ36740.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bradyrhizobium sp. BTAi1]
          Length = 95

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIA  +RI++ + ++P     LN  L+ +E++SEVNVEGVEPM SV PM M
Sbjct: 1  MSVDAATVRRIAQLARIAVTDAEVPHLQGELNAMLNFVEQLSEVNVEGVEPMTSVTPMAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+  + I+ NAP  E +FF+VPK VE
Sbjct: 61 KKRQDVVNDGEIADDIVKNAPATENHFFLVPKVVE 95


>gi|260574593|ref|ZP_05842596.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhodobacter sp.
          SW2]
 gi|259023010|gb|EEW26303.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhodobacter sp.
          SW2]
          Length = 95

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 63/95 (66%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID+   +R+AH +RI ++E+D+      L+  L+ +E++ EV+V G+EPM SV PM++
Sbjct: 1  MAIDIDTARRVAHLARIRVEEDDLAALAGELSGILNFMEQLGEVDVTGIEPMTSVTPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R DVV DG+    IL+NAP   + FF VPK VE
Sbjct: 61 VRRADVVTDGNIQAQILANAPDAREGFFAVPKVVE 95


>gi|163852737|ref|YP_001640780.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylobacterium
          extorquens PA1]
 gi|218531578|ref|YP_002422394.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Methylobacterium
          chloromethanicum CM4]
 gi|240140072|ref|YP_002964549.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          (Asp/Glu-ADT subunit C) [Methylobacterium extorquens
          AM1]
 gi|254562497|ref|YP_003069592.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Methylobacterium extorquens DM4]
 gi|226799833|sp|A9W747|GATC_METEP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|254791003|sp|B7KWA9|GATC_METC4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|163664342|gb|ABY31709.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylobacterium
          extorquens PA1]
 gi|218523881|gb|ACK84466.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylobacterium
          chloromethanicum CM4]
 gi|240010046|gb|ACS41272.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          (Asp/Glu-ADT subunit C) [Methylobacterium extorquens
          AM1]
 gi|254269775|emb|CAX25747.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          (Asp/Glu-ADT subunit C) [Methylobacterium extorquens
          DM4]
          Length = 95

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 64/95 (67%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI++ +E++      LN  L+ +E++  V+VEGVEPM SV PM+M
Sbjct: 1  MSVDETTVRRIAHLARIAVTDEEVGPLKGELNAILAFVEQLGAVDVEGVEPMTSVTPMRM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG +   I++NAP  E N+F+VPK VE
Sbjct: 61 KKRADVVNDGGRASDIVANAPETEDNYFLVPKVVE 95


>gi|190891544|ref|YP_001978086.1| glutamyl-tRNA amidotransferase, C subunit [Rhizobium etli CIAT
          652]
 gi|229487535|sp|B3PXX2|GATC_RHIE6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|190696823|gb|ACE90908.1| glutamyl-tRNA amidotransferase protein, C subunit [Rhizobium etli
          CIAT 652]
          Length = 95

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 63/95 (66%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI++ E++    +  LN  L  +E++SEVNVEGVE M SV PM M
Sbjct: 1  MSVDLATVKRVAKLARIAVSEDEANRMVGELNGILGFVEQLSEVNVEGVEAMTSVTPMAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG+K   I++NAP  + NFF+VPK VE
Sbjct: 61 KKRADAVTDGNKAADIVANAPVTDHNFFLVPKVVE 95


>gi|299135132|ref|ZP_07028323.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Afipia sp. 1NLS2]
 gi|298590109|gb|EFI50313.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Afipia sp. 1NLS2]
          Length = 95

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 68/95 (71%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIA  +RI++K+E++P     LN  L+ +E++SEV+VEG+EPM SV+PM+M
Sbjct: 1  MSVDAATVRRIAQLARIAVKDEEVPHLQGELNAMLAFIEQLSEVDVEGIEPMTSVMPMEM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+    +L+NAP  E +FF+VPK VE
Sbjct: 61 KKRHDVVNDGEISGLVLANAPVTEDHFFLVPKVVE 95


>gi|209549120|ref|YP_002281037.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhizobium
          leguminosarum bv. trifolii WSM2304]
 gi|226799834|sp|B5ZMI9|GATC_RHILW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|209534876|gb|ACI54811.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhizobium
          leguminosarum bv. trifolii WSM2304]
          Length = 95

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 63/95 (66%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+AH +RI++ E++    +  LN  L  +E++SEVNV+GVE M SV PM M
Sbjct: 1  MSVDLATVKRVAHLARIAVSEDEANRMVGELNGILGFVEQLSEVNVDGVEAMTSVTPMAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG K   I++NAP  + NFF+VPK VE
Sbjct: 61 KKRTDEVTDGSKAADIVANAPVTDHNFFLVPKVVE 95


>gi|85716410|ref|ZP_01047382.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Nitrobacter sp.
          Nb-311A]
 gi|85696767|gb|EAQ34653.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Nitrobacter sp.
          Nb-311A]
          Length = 95

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 64/95 (67%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI++ + ++P     LN  L+ +E++ EVNV+GVEPM SV PM M
Sbjct: 1  MSVDAATVRRIAHLARIAVDDAEVPHLQGELNAILAFVEQLQEVNVDGVEPMTSVTPMAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD V DG+  + I++NAP    +FF+VPK VE
Sbjct: 61 KMRPDAVNDGEIADKIVANAPVTHDHFFLVPKVVE 95


>gi|91977486|ref|YP_570145.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Rhodopseudomonas palustris BisB5]
 gi|123748960|sp|Q135J5|GATC_RHOPS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|91683942|gb|ABE40244.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rhodopseudomonas palustris BisB5]
          Length = 95

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 67/95 (70%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI++ ++++P     LN  L+ +E+++EV+V+GVEPM SV PM+M
Sbjct: 1  MSVDAATVRRIAHLARIAVTDDEVPHLQGELNAMLAFVEQLAEVDVDGVEPMTSVTPMQM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG+  + +++NAP  E +FF+VPK VE
Sbjct: 61 KKRADGVNDGEIADHVVANAPATEDHFFLVPKVVE 95


>gi|92117800|ref|YP_577529.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Nitrobacter
          hamburgensis X14]
 gi|122417648|sp|Q1QL28|GATC_NITHX RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|91800694|gb|ABE63069.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Nitrobacter hamburgensis X14]
          Length = 95

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 65/95 (68%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI++ + ++P     LN  L+ +E++ EVNV+GVEPM SV+PM+M
Sbjct: 1  MTVDAATVRRIAHLARIAVDDAEVPHLQGELNAILAFVEQLQEVNVDGVEPMTSVMPMEM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG   + I+ NAP  + +FF+VPK VE
Sbjct: 61 KKRADVVNDGGIADKIVGNAPVTDDHFFLVPKVVE 95


>gi|218672208|ref|ZP_03521877.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhizobium etli
          GR56]
 gi|327192103|gb|EGE59081.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhizobium etli
          CNPAF512]
          Length = 95

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 63/95 (66%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI++ E++    +  LN  L  +E++SEVNV+GVE M SV PM M
Sbjct: 1  MSVDLATVKRVAKLARIAVSEDEANRMVGELNGILGFVEQLSEVNVDGVEAMTSVTPMAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG+K   I++NAP  + NFF+VPK VE
Sbjct: 61 KKRTDAVTDGNKAADIVANAPVTDHNFFLVPKVVE 95


>gi|323136212|ref|ZP_08071294.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylocystis sp.
          ATCC 49242]
 gi|322398286|gb|EFY00806.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylocystis sp.
          ATCC 49242]
          Length = 95

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/95 (50%), Positives = 66/95 (69%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI+++E ++      +N  LS +E +S V+VEGVEP+ SV+PM+M
Sbjct: 1  MSVDSAVVRRIAHLARIAVEENEVERLGGEINAILSFVETLSAVDVEGVEPLTSVLPMQM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG  V+ IL+NAP  E N+FVVPK VE
Sbjct: 61 KKRADVVTDGGIVDDILANAPVREDNYFVVPKVVE 95


>gi|90423763|ref|YP_532133.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Rhodopseudomonas palustris BisB18]
 gi|122476406|sp|Q215X2|GATC_RHOPB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|90105777|gb|ABD87814.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rhodopseudomonas palustris BisB18]
          Length = 95

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 65/95 (68%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI++ + ++P     LN  L+ +E++ EV+V+GVEPM SV PM+M
Sbjct: 1  MSVDATTVRRIAHLARIAVTDAEVPHLQGELNAMLAFVEQLGEVDVDGVEPMTSVTPMQM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG+  + +++NAP  E +FF+VPK VE
Sbjct: 61 KKRVDAVNDGEIADQVVANAPATEDHFFLVPKVVE 95


>gi|126727517|ref|ZP_01743351.1| Glu-tRNA (Gln) amidotransferase, subunit C [Rhodobacterales
          bacterium HTCC2150]
 gi|126703297|gb|EBA02396.1| Glu-tRNA (Gln) amidotransferase, subunit C [Rhodobacterales
          bacterium HTCC2150]
          Length = 95

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 64/95 (67%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID+   +R+A  +RI++ E+++P     L+N +  +E+++EV+VEGVEPM SV P  +
Sbjct: 1  MSIDIDTARRVAKLARIAVPEDNLPGLASELSNIIGFMEQLNEVDVEGVEPMTSVTPQAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG + E++L+NAP   + FF VPK VE
Sbjct: 61 KRRDDVVTDGGQQEAVLANAPDAREGFFAVPKVVE 95


>gi|110633716|ref|YP_673924.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Mesorhizobium sp. BNC1]
 gi|123057995|sp|Q11IL6|GATC_MESSB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|110284700|gb|ABG62759.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Chelativorans sp. BNC1]
          Length = 95

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 63/95 (66%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI++ EED       LN  L  +E+++EV+V GVEPM SV+P  M
Sbjct: 1  MSVDIDTVKRVARLARIAVDEEDASRMTGELNAILGFVEQLNEVDVTGVEPMTSVIPTTM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG K E I++NAP  E++FF+VPK VE
Sbjct: 61 KMRVDEVTDGSKAEDIVANAPQTEEHFFLVPKVVE 95


>gi|46203459|ref|ZP_00051494.2| COG0721: Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit
          [Magnetospirillum magnetotacticum MS-1]
          Length = 95

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 65/95 (68%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI++ +E++      LN  L+ +E++  V+V+GVEPM SV+PM+M
Sbjct: 1  MSVDEKTVRRIAHLARIAVTDEEVGPLQGELNAILAFVEQLGAVDVDGVEPMTSVMPMRM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG +   +++NAP  E N+F+VPK VE
Sbjct: 61 KKRADVVNDGGRARDVVANAPETEDNYFLVPKVVE 95


>gi|86357481|ref|YP_469373.1| glutamyl-tRNA amidotransferase subunit C protein [Rhizobium etli
          CFN 42]
 gi|123512143|sp|Q2K940|GATC_RHIEC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|86281583|gb|ABC90646.1| glutamyl-tRNA amidotransferase subunit C protein [Rhizobium etli
          CFN 42]
          Length = 95

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 63/95 (66%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI++ E++    +  LN  L  +E++SEVNV+GVE M SV PM M
Sbjct: 1  MSVDLATVKRVAKLARIAVSEDEANRMVGELNGILGFVEQLSEVNVDGVEAMTSVTPMAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG+K   I++NAP  + NFF+VPK VE
Sbjct: 61 KKRADEVTDGNKAADIVANAPVTDHNFFLVPKVVE 95


>gi|260428598|ref|ZP_05782577.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Citreicella sp.
          SE45]
 gi|260423090|gb|EEX16341.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Citreicella sp.
          SE45]
          Length = 95

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 62/95 (65%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     R+A  +RI ++++ +P      +N L  +E+++EV+VEGVEPMVSV PM++
Sbjct: 1  MSIDTDTAARVAKLARIRVEDDQLPALAQEFSNILDFIEQLNEVDVEGVEPMVSVTPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG++ + ILSNAP   + FF VPK VE
Sbjct: 61 KRRQDGVTDGNQQDKILSNAPDAREGFFAVPKVVE 95


>gi|218461374|ref|ZP_03501465.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhizobium etli
          Kim 5]
          Length = 95

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 63/95 (66%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI++ E++    +  LN  L  +E++SEVNV+GVE M SV PM M
Sbjct: 1  MSVDLATVKRVAKLARIAVSEDEANRMVGELNGILGFVEQLSEVNVDGVEAMTSVTPMAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG+K   I++NAP  + NFF+VPK VE
Sbjct: 61 KKRTDEVTDGNKAADIVANAPVTDHNFFLVPKVVE 95


>gi|126728943|ref|ZP_01744758.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sagittula
          stellata E-37]
 gi|126710873|gb|EBA09924.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sagittula
          stellata E-37]
          Length = 95

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 62/95 (65%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID+    R+A  +RI ++E+D+P      N+ L  +E+++EV+V+GVEPMVSV PM++
Sbjct: 1  MSIDIETAARVAKLARIKVEEDDLPALANAFNDILGFIEQLNEVDVDGVEPMVSVTPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG   + +LSNAP   + FF VPK VE
Sbjct: 61 KRRQDGVTDGGMQDKVLSNAPDAREGFFAVPKVVE 95


>gi|241204445|ref|YP_002975541.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhizobium
          leguminosarum bv. trifolii WSM1325]
 gi|240858335|gb|ACS56002.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhizobium
          leguminosarum bv. trifolii WSM1325]
          Length = 95

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 62/95 (65%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI++ E++    +  LN  L  +E++SEVNV+GVE M SV PM M
Sbjct: 1  MSVDLATVKRVARLARIAVSEDEANRMVGELNGILGFVEQLSEVNVDGVEAMTSVTPMAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG K   I++NAP  + NFF+VPK VE
Sbjct: 61 KKRTDEVTDGSKAADIVANAPVTDHNFFLVPKVVE 95


>gi|75676193|ref|YP_318614.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Nitrobacter
          winogradskyi Nb-255]
 gi|123613190|sp|Q3SR29|GATC_NITWN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|74421063|gb|ABA05262.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Nitrobacter winogradskyi Nb-255]
          Length = 95

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 64/95 (67%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI++ + ++P     LN  L+ +E++ EVNV+GVEPM SV PM M
Sbjct: 1  MSVDAATVRRIAHLARIAVDDAEVPHLQDELNAILAFVEQLQEVNVDGVEPMTSVTPMAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+  + I++NAP    +FF+VPK VE
Sbjct: 61 KMRTDVVNDGEIADRIVANAPVTHDHFFLVPKVVE 95


>gi|84515290|ref|ZP_01002652.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Loktanella
          vestfoldensis SKA53]
 gi|84510573|gb|EAQ07028.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Loktanella
          vestfoldensis SKA53]
          Length = 95

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 59/95 (62%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID    +R+A  +RI + EE +P      N  L  +E+++EV+V+GVEPM SV P ++
Sbjct: 1  MSIDTETARRVAKLARIEVAEEALPALASEFNAILGFIEQLNEVDVDGVEPMTSVTPQRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG++  ++L NAP   + FF VPK VE
Sbjct: 61 TRRADVVTDGNQQAAVLKNAPDAREGFFAVPKVVE 95


>gi|163745932|ref|ZP_02153291.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Oceanibulbus
          indolifex HEL-45]
 gi|161380677|gb|EDQ05087.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Oceanibulbus
          indolifex HEL-45]
          Length = 95

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 60/95 (63%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     R+A  +RI ++ + +P      NN L  +E++SEV+VEGVEPM SV P ++
Sbjct: 1  MSIDENTAARVAKLARIKVEPDALPALAEEFNNILGFIEQLSEVDVEGVEPMTSVTPQRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DGD+ +++L NAP   + FF VPK VE
Sbjct: 61 KRREDVVSDGDQQDAVLKNAPDAREGFFAVPKVVE 95


>gi|304391700|ref|ZP_07373642.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Ahrensia sp.
          R2A130]
 gi|303295929|gb|EFL90287.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Ahrensia sp.
          R2A130]
          Length = 95

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 61/95 (64%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  SRI + +E     +  LN  L  +E++ EV+VEGVEPM SVV M M
Sbjct: 1  MSVDLATVKRVAALSRIRVSDERAEELVPELNTILGFVEQLQEVDVEGVEPMTSVVDMDM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+  E++ +NAP  + NFF VPK VE
Sbjct: 61 RKRADVVTDGEMAEAVTANAPGSDDNFFAVPKVVE 95


>gi|85704311|ref|ZP_01035414.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseovarius sp.
           217]
 gi|85671631|gb|EAQ26489.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseovarius sp.
           217]
          Length = 122

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 62/95 (65%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M ID+    ++A  +RI++K+E +P      N  L  +E+++EV+V GVEPM SV PM++
Sbjct: 28  MSIDLETAAKVAKLARIAVKDEALPALADEFNTILGFIEQLNEVDVSGVEPMTSVTPMRL 87

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R DVV DG++  ++LSNAP   + FF VPK VE
Sbjct: 88  RRREDVVNDGNQQTAVLSNAPDAREGFFAVPKVVE 122


>gi|84499717|ref|ZP_00998005.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Oceanicola
          batsensis HTCC2597]
 gi|84392861|gb|EAQ05072.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Oceanicola
          batsensis HTCC2597]
          Length = 95

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 60/95 (63%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     R+A  +RI +++ ++P      N  L  +E+++EV+VEGVEPM SV PM++
Sbjct: 1  MSIDEGTAARVAKLARIKVEDAELPALAKEFNTILGFIEQLNEVDVEGVEPMTSVTPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG + + +LSNAP   + FF VPK VE
Sbjct: 61 KRREDVVTDGSQQDKVLSNAPDAREGFFAVPKVVE 95


>gi|255262199|ref|ZP_05341541.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thalassiobium sp.
          R2A62]
 gi|255104534|gb|EET47208.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thalassiobium sp.
          R2A62]
          Length = 95

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 61/95 (64%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID    +R+A  +RI ++E+ +P      +  L  +E+++EV+VEGVEPM SV P ++
Sbjct: 1  MSIDTETARRVAKLARIKVEEDALPALAQEFSAILGFIEQLNEVDVEGVEPMTSVTPQRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG + +++LSNAP   + FF VPK VE
Sbjct: 61 KRREDVVTDGSQPQAVLSNAPDAREGFFAVPKVVE 95


>gi|159045326|ref|YP_001534120.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Dinoroseobacter shibae DFL 12]
 gi|189045163|sp|A8LJ24|GATC_DINSH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|157913086|gb|ABV94519.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Dinoroseobacter
          shibae DFL 12]
          Length = 95

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 63/95 (66%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID+   +R+A  +RI ++++ +P      N+ L  +E+++EV+V+ VEPM SV PM++
Sbjct: 1  MSIDIETARRVAKLARIKVEDDALPALAGEFNHILGFIEQLNEVDVDDVEPMTSVTPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DGD+  ++LSNAP   + FF VPK VE
Sbjct: 61 KRREDVVTDGDQQAAVLSNAPDAREGFFAVPKVVE 95


>gi|114764626|ref|ZP_01443830.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Pelagibaca
          bermudensis HTCC2601]
 gi|114543002|gb|EAU46022.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseovarius sp.
          HTCC2601]
          Length = 95

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 62/95 (65%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     R+A  +RI ++++ +P      +N L  +E+++EV+V+GVEPMVSV PM++
Sbjct: 1  MSIDTDTAARVAKLARIRVEDDQLPALAQEFSNILEFIEQLNEVDVDGVEPMVSVTPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG++ + +LSNAP   + FF VPK VE
Sbjct: 61 KRRQDGVTDGNQQDKVLSNAPDAREGFFAVPKVVE 95


>gi|119383327|ref|YP_914383.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Paracoccus
          denitrificans PD1222]
 gi|166199382|sp|A1AZJ3|GATC_PARDP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|119373094|gb|ABL68687.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Paracoccus denitrificans PD1222]
          Length = 95

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 62/95 (65%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   + +++AH +RI++K+ D+P     LN  L  +E+++EV+VEGV+PM  V PM++
Sbjct: 1  MAITEDEARKVAHLARIAVKDADLPALAQELNGILHFMEQLNEVDVEGVQPMTGVEPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D+V DG+  + IL NAP   + FF VPK VE
Sbjct: 61 KRRQDIVTDGEMQDLILKNAPDAREGFFAVPKVVE 95


>gi|260432954|ref|ZP_05786925.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Silicibacter
          lacuscaerulensis ITI-1157]
 gi|260416782|gb|EEX10041.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Silicibacter
          lacuscaerulensis ITI-1157]
          Length = 95

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 61/95 (64%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     ++A  +RI ++++ +P      N  L  +E+++EV+VEGVEPMVSV PM++
Sbjct: 1  MSIDQSTAAKVAKLARIKVEDDALPALASEFNTILGFIEQLNEVDVEGVEPMVSVTPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+  + ILSNAP   + FF VPK VE
Sbjct: 61 KRREDVVTDGNMQDKILSNAPDAREGFFAVPKVVE 95


>gi|56697806|ref|YP_168177.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Ruegeria
          pomeroyi DSS-3]
 gi|81558359|sp|Q5LP79|GATC_SILPO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|56679543|gb|AAV96209.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Ruegeria pomeroyi
          DSS-3]
          Length = 95

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 60/95 (63%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     ++A  +RI ++++ +P      N  L  +E+++EVNV+GVEPMVSV PM++
Sbjct: 1  MSIDQSTAAKVAKLARIKVEQDALPALAAEFNTILGFIEQLNEVNVDGVEPMVSVTPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG++   +LSNAP   + FF VPK VE
Sbjct: 61 KRRTDGVSDGNQQAKVLSNAPDAREGFFAVPKVVE 95


>gi|298291515|ref|YP_003693454.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Starkeya novella
          DSM 506]
 gi|296928026|gb|ADH88835.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Starkeya novella
          DSM 506]
          Length = 95

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 62/95 (65%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+R+AH SRI++ E+++      LN  L+ +++++EV+  GVEPM SV+PMK+
Sbjct: 1  MSVDQATVRRVAHLSRIAVTEDEVAHLQGELNAILAFVDELAEVDTAGVEPMTSVIPMKL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG     +L+NAP  E  FF VPK VE
Sbjct: 61 PLRADVVNDGGDAARVLANAPLAEDGFFAVPKVVE 95


>gi|49475588|ref|YP_033629.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Bartonella
          henselae str. Houston-1]
 gi|81647907|sp|Q6G3F0|GATC_BARHE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|49238395|emb|CAF27622.1| Glutamyl-tRNA (gln) amidotransferase subunit C [Bartonella
          henselae str. Houston-1]
          Length = 95

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 65/95 (68%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   VKR++H +RI++  +++ L    LN  L  +E++SEV+V GVEP+ SV+PM +
Sbjct: 1  MSVDQETVKRVSHLARIALHNDEVELMTKELNVILGFVEQLSEVDVSGVEPLTSVMPMTL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DGDKV  I++NAP  E+NFF+V K VE
Sbjct: 61 RMREDSVTDGDKVADIVANAPVTEENFFLVSKVVE 95


>gi|116251835|ref|YP_767673.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhizobium
          leguminosarum bv. viciae 3841]
 gi|166218174|sp|Q1MHJ6|GATC_RHIL3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|115256483|emb|CAK07567.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C [Rhizobium
          leguminosarum bv. viciae 3841]
          Length = 95

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 61/95 (64%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI++ E++    +  LN  L  +E++SEVNV+GVE M SV P  M
Sbjct: 1  MSVDLATVKRVARLARIAVSEDEANRMVGELNGILGFVEQLSEVNVDGVEAMTSVTPTAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG K   I++NAP  + NFF+VPK VE
Sbjct: 61 KKRTDEVTDGSKAADIVANAPVTDHNFFLVPKVVE 95


>gi|84686239|ref|ZP_01014134.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Maritimibacter
          alkaliphilus HTCC2654]
 gi|84665766|gb|EAQ12241.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhodobacterales
          bacterium HTCC2654]
          Length = 95

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 61/95 (64%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID    +++AH +RI ++++ +P      N  L  +E+++EVNV+G+EPM SV P ++
Sbjct: 1  MSIDKDTARKVAHLARIRVEDDALPALADEFNTILGFIEELNEVNVDGIEPMTSVTPQRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV +GD+ + IL NAP   + FF VPK VE
Sbjct: 61 KRREDVVTEGDQADKILRNAPDAREGFFAVPKVVE 95


>gi|310816861|ref|YP_003964825.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Ketogulonicigenium
          vulgare Y25]
 gi|308755596|gb|ADO43525.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Ketogulonicigenium
          vulgare Y25]
          Length = 95

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 62/95 (65%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID+   +R+A  +RI ++ E +P      +  L  +E+++EV+VEGVEPM SV PM++
Sbjct: 1  MSIDIETARRVAKLARIRVEPEALPALASEFSAILGFIEQLNEVDVEGVEPMTSVTPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D+V DG++  ++L+NAP   + FF VPK VE
Sbjct: 61 KRREDIVTDGEQQAAVLANAPDAREGFFAVPKVVE 95


>gi|220923241|ref|YP_002498543.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Methylobacterium
          nodulans ORS 2060]
 gi|254791004|sp|B8IL52|GATC_METNO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|219947848|gb|ACL58240.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylobacterium
          nodulans ORS 2060]
          Length = 95

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 59/95 (62%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI++ + ++P     LN  L+ +E++  V+V GVEPM SV PM M
Sbjct: 1  MSVDAQTVRRIAHLARIAVSDAEVPPLQDELNAILAFVEQLGAVDVSGVEPMTSVTPMAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG     I+ NAP  E N+F+VPK VE
Sbjct: 61 KQREDAVTDGGYARDIVFNAPLTEDNYFLVPKVVE 95


>gi|254460133|ref|ZP_05073549.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhodobacterales
          bacterium HTCC2083]
 gi|206676722|gb|EDZ41209.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhodobacteraceae
          bacterium HTCC2083]
          Length = 95

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 58/95 (61%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     R+A  +RI ++ E +P       N L  +E+++EV+VEGVEPM SV P ++
Sbjct: 1  MSIDEQTAARVAKLARIKVEPEALPALAQEFTNILGFIEQLNEVDVEGVEPMTSVTPQRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DGD+ E +L NAP   + FF VPK VE
Sbjct: 61 KRRVDVVTDGDQPEKVLKNAPDAREGFFAVPKVVE 95


>gi|149201746|ref|ZP_01878720.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseovarius sp.
          TM1035]
 gi|149144794|gb|EDM32823.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseovarius sp.
          TM1035]
          Length = 95

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 61/95 (64%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID+    ++A  +RI++ +E +P      N  L  +E+++EV+V GVEPM SV PM++
Sbjct: 1  MSIDLETAAKVAKLARIAVPQEALPALANEFNTILGFIEQLNEVDVTGVEPMTSVTPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG++  ++LSNAP   + FF VPK VE
Sbjct: 61 KRREDVVSDGNQQAAVLSNAPDAREGFFAVPKVVE 95


>gi|170742461|ref|YP_001771116.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylobacterium
          sp. 4-46]
 gi|229487519|sp|B0UHC7|GATC_METS4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|168196735|gb|ACA18682.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylobacterium
          sp. 4-46]
          Length = 95

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 59/95 (62%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI++ + ++P     LN  L+ +E++  V+V GVEPM SV PM M
Sbjct: 1  MSVDAQTVRRIAHLARIAVSDAEVPPLQDELNAILAFVEQLGAVDVSGVEPMTSVTPMAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG     I+ NAP  E N+F+VPK VE
Sbjct: 61 KQRDDAVTDGGYAREIVFNAPLSEDNYFLVPKVVE 95


>gi|90417719|ref|ZP_01225631.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Aurantimonas manganoxydans SI85-9A1]
 gi|90337391|gb|EAS51042.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Aurantimonas manganoxydans SI85-9A1]
          Length = 95

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 62/95 (65%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+R+A  SRI++ ++++      LN  L  +E + EV+VEGVEPM SV+PM M
Sbjct: 1  MSVDASTVRRVARLSRIAVTDDEVVAMESELNAILGFVEHLGEVDVEGVEPMTSVIPMVM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG K + I++NAP  E +FFVVPK VE
Sbjct: 61 KKRADEVTDGAKADDIVANAPASEDHFFVVPKVVE 95


>gi|126739252|ref|ZP_01754946.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseobacter sp.
          SK209-2-6]
 gi|126719869|gb|EBA16577.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseobacter sp.
          SK209-2-6]
          Length = 95

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 60/95 (63%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     ++A  +RI ++E+ +P      N  L  +E+++EV+VEGVEPM SV P ++
Sbjct: 1  MSIDQNTAAKVAKLARIKVEEDALPALAEEFNTILGFIEQLNEVDVEGVEPMTSVTPQRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG++ + ILSNAP   + FF VPK VE
Sbjct: 61 KRREDVVNDGNQQDKILSNAPDAREGFFAVPKVVE 95


>gi|99081760|ref|YP_613914.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Ruegeria sp.
          TM1040]
 gi|259416870|ref|ZP_05740790.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Silicibacter sp.
          TrichCH4B]
 gi|122397786|sp|Q1GFB4|GATC_SILST RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|99038040|gb|ABF64652.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Ruegeria sp. TM1040]
 gi|259348309|gb|EEW60086.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Silicibacter sp.
          TrichCH4B]
          Length = 95

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 60/95 (63%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     ++A  +RI ++E+ +P      N  L  +E+++EV+VEGVEPM SV P ++
Sbjct: 1  MSIDQSTAAKVAKLARIKVEEDALPALAEEFNTILGFIEQLNEVDVEGVEPMTSVTPQRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG++ + +L+NAP   + FF VPK VE
Sbjct: 61 KRREDVVTDGNQQDKVLANAPDAREGFFAVPKVVE 95


>gi|294012196|ref|YP_003545656.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
           [Sphingobium japonicum UT26S]
 gi|292675526|dbj|BAI97044.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
           [Sphingobium japonicum UT26S]
          Length = 123

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 62/95 (65%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M ID+  VK+IA  SRIS+ + +    +  LNN L  +E++ EV+V GVEPM +V+P K+
Sbjct: 29  MSIDLQTVKKIASLSRISVTDAEAEAMVPELNNILGWVEQLGEVDVTGVEPMTAVIPNKL 88

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R DVV DG+  + +L+NAP  E  FF VPK +E
Sbjct: 89  RLRDDVVTDGNVRDRVLANAPQAEHGFFAVPKVIE 123


>gi|254454150|ref|ZP_05067587.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Octadecabacter
          antarcticus 238]
 gi|198268556|gb|EDY92826.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Octadecabacter
          antarcticus 238]
          Length = 95

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 60/95 (63%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID+   +R+A  +RI++ E D+P      +  L  +E+++EV+VEG+EPM SV P ++
Sbjct: 1  MSIDIQTARRVAKLARIAVPEADLPELAKEFSAMLGFIEQLNEVDVEGIEPMTSVTPQRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG +   IL+NAP   + FF VPK VE
Sbjct: 61 KRRTDVVTDGGQPIEILANAPDAREGFFAVPKVVE 95


>gi|254510004|ref|ZP_05122071.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhodobacteraceae
          bacterium KLH11]
 gi|221533715|gb|EEE36703.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhodobacteraceae
          bacterium KLH11]
          Length = 95

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 61/95 (64%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     ++A  +RI ++++ +P      N  L  +E+++EV+V+GVEPMVSV PM++
Sbjct: 1  MSIDQSTAAKVAKLARIKVEDDALPALASEFNTILGFIEQLNEVDVDGVEPMVSVTPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG++ + +LSNAP   + FF VPK VE
Sbjct: 61 KRRQDQVTDGNQQDKVLSNAPDAREGFFAVPKVVE 95


>gi|170746912|ref|YP_001753172.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylobacterium
          radiotolerans JCM 2831]
 gi|229487518|sp|B1LUA9|GATC_METRJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|170653434|gb|ACB22489.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylobacterium
          radiotolerans JCM 2831]
          Length = 95

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 62/95 (65%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI++ ++++      LN  L+ +E++  V+V GVEPM SV PM M
Sbjct: 1  MSVDEKTVRRIAHLARIAVTDDEVGPLQGELNAILAFVEQLGTVDVAGVEPMTSVTPMAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV +G +   +++NAP  E N+F+VPK VE
Sbjct: 61 KKREDVVTEGGRAADVVANAPETEDNYFLVPKVVE 95


>gi|307946451|ref|ZP_07661786.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseibium sp.
          TrichSKD4]
 gi|307770115|gb|EFO29341.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseibium sp.
          TrichSKD4]
          Length = 95

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 57/95 (60%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   VKR+A  +RI + EE+       LN  L  +E++ EVN++GVEP+ SVV   M
Sbjct: 1  MSVDTDTVKRVARLARIKVSEEEATRMTGELNGILGFVEQLDEVNIDGVEPLTSVVEQAM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG K   I +NAP  E NFF+VPK VE
Sbjct: 61 KKRVDGVTDGGKANDITANAPASEDNFFMVPKVVE 95


>gi|114800240|ref|YP_760994.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Hyphomonas
          neptunium ATCC 15444]
 gi|123027877|sp|Q0BZU9|GATC_HYPNA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|114740414|gb|ABI78539.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Hyphomonas
          neptunium ATCC 15444]
          Length = 95

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 61/89 (68%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+++A  SRI++ EE +      LN  L  +++++EV+VEGVEPM SVV  K+  R DV
Sbjct: 7  DVRKVARLSRIAVPEERLDELAGELNGILGWIDQLNEVDVEGVEPMTSVVETKLPMRDDV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V DG+  + +L+NAP  E  FFVVPKAVE
Sbjct: 67 VTDGNIQDQVLANAPRSEHGFFVVPKAVE 95


>gi|254502480|ref|ZP_05114631.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Labrenzia
          alexandrii DFL-11]
 gi|222438551|gb|EEE45230.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Labrenzia
          alexandrii DFL-11]
          Length = 95

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 57/95 (60%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   VKR+A  +RI + E++       LN  L  +E++ EVN++GVEPM SVV   M
Sbjct: 1  MSVDTATVKRVARLARIKVSEDEATRMTGELNAILGFVEQLDEVNIDGVEPMTSVVETTM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG+K   I  NAP  E +FF+VPK VE
Sbjct: 61 KKRADGVTDGNKAADITKNAPASEDSFFMVPKVVE 95


>gi|254440687|ref|ZP_05054180.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Octadecabacter
          antarcticus 307]
 gi|198250765|gb|EDY75080.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Octadecabacter
          antarcticus 307]
          Length = 95

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 59/95 (62%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID+   +R+A  +RI++ E D+P      +  L  +E+++EV+VEG+EPM SV P ++
Sbjct: 1  MSIDIQTARRVAKLARIAVPEADLPELAKEFSAILGFIEQLNEVDVEGIEPMTSVTPQRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG +   IL NAP   + FF VPK VE
Sbjct: 61 KRRKDVVTDGGQPVEILKNAPDAREGFFAVPKVVE 95


>gi|240850655|ref|YP_002972055.1| glutamyl-tRNA (gln) amidotransferase subunit C [Bartonella
          grahamii as4aup]
 gi|240267778|gb|ACS51366.1| glutamyl-tRNA (gln) amidotransferase subunit C [Bartonella
          grahamii as4aup]
          Length = 95

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 64/95 (67%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   VKR+AH +RI+I +++I     + N  L  +E+++EV+V GVEP+ SV+PM +
Sbjct: 1  MSVDQETVKRVAHLARIAIHDDEIEPVTKKFNAILGFVEQLNEVDVSGVEPLTSVMPMTL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DGDK   I++NAP  E+NFF+V K VE
Sbjct: 61 RMREDSVTDGDKAADIVANAPVTEENFFLVSKIVE 95


>gi|296445896|ref|ZP_06887847.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylosinus
          trichosporium OB3b]
 gi|296256564|gb|EFH03640.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylosinus
          trichosporium OB3b]
          Length = 95

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 65/95 (68%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI+++++++      LN  L+ + ++S V+V+GVEP+ S +PM+M
Sbjct: 1  MSVDQATVRRIAHLARIAVEDDEVERLGGELNAILAFVAELSSVDVDGVEPLTSALPMQM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG   + +L+NAP  E ++FVVPK +E
Sbjct: 61 KKRQDVVTDGGFADDVLANAPEREDHYFVVPKVIE 95


>gi|307292655|ref|ZP_07572501.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sphingobium
          chlorophenolicum L-1]
 gi|306880721|gb|EFN11937.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sphingobium
          chlorophenolicum L-1]
          Length = 95

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 61/95 (64%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID+  VK+IA  SRIS+ + +    +  LNN L  +E++ EV+V GVEPM +V+P K+
Sbjct: 1  MSIDLQTVKKIASLSRISVTDAEAEAMVPELNNILGWVEQLGEVDVTGVEPMTAVIPNKL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG+  + +L+NAP  E  FF VPK +E
Sbjct: 61 RLRDDAVTDGNVRDKVLANAPQAEHGFFAVPKVIE 95


>gi|217976925|ref|YP_002361072.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylocella
          silvestris BL2]
 gi|254791005|sp|B8EPC2|GATC_METSB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|217502301|gb|ACK49710.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylocella
          silvestris BL2]
          Length = 95

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 63/95 (66%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIAH +RI + +ED+P     LN  L  +E+++ V+VEGVE M SV+PM M
Sbjct: 1  MSVDQATVRRIAHLARIKVSDEDVPHLQDELNAILRFVEELAAVDVEGVEAMTSVMPMPM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D+V +G+  + IL+NAP  E +FF VPK VE
Sbjct: 61 KKRQDIVTEGEIPDVILANAPEREDHFFKVPKVVE 95


>gi|49474240|ref|YP_032282.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Bartonella
          quintana str. Toulouse]
 gi|81647051|sp|Q6FZS8|GATC_BARQU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|49239744|emb|CAF26126.1| Glutamyl-tRNA (gln) amidotransferase subunit C [Bartonella
          quintana str. Toulouse]
          Length = 95

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 65/95 (68%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   VKR++H +RI+I +++I      LN  L  +E+++EV+V G+EP+ SV+PM +
Sbjct: 1  MSVDQETVKRVSHLARIAIHDDEIEPMTKELNVILGFVEQLNEVDVNGIEPLTSVMPMAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DGDKV  I++NAP  E+NFF+V K VE
Sbjct: 61 RMREDSVTDGDKVADIVANAPVTEENFFLVSKVVE 95


>gi|225686381|ref|YP_002734353.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          melitensis ATCC 23457]
 gi|256262479|ref|ZP_05465011.1| glutamyl-tRNA(gln) amidotransferase [Brucella melitensis bv. 2
          str. 63/9]
 gi|254790987|sp|C0RLB6|GATC_BRUMB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|225642486|gb|ACO02399.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Brucella
          melitensis ATCC 23457]
 gi|263092214|gb|EEZ16511.1| glutamyl-tRNA(gln) amidotransferase [Brucella melitensis bv. 2
          str. 63/9]
 gi|326410752|gb|ADZ67816.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          melitensis M28]
 gi|326554044|gb|ADZ88683.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          melitensis M5-90]
          Length = 95

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/95 (50%), Positives = 64/95 (67%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+AH +RI++ EED       LN  L  +E+++EV+VEG+EPM SV PMKM
Sbjct: 1  MSVDISTVKRVAHLARIAVSEEDAERMTGELNAILGFVEQLNEVDVEGIEPMTSVTPMKM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG    ++++NAP  E NFFVVPK VE
Sbjct: 61 RMREDKVTDGGIAAAVVANAPVTEDNFFVVPKVVE 95


>gi|254463703|ref|ZP_05077114.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhodobacterales
          bacterium Y4I]
 gi|206684611|gb|EDZ45093.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhodobacterales
          bacterium Y4I]
          Length = 95

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 59/95 (62%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     ++A  +RI +++  +P      NN L  +E+++EV+VEGVEPM SV P ++
Sbjct: 1  MSIDQSTAAKVAKLARIKVEDAALPALADEFNNILGFIEQLNEVDVEGVEPMTSVTPQRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG++ + IL+NAP   + FF VPK VE
Sbjct: 61 KRRKDEVTDGNQQDKILANAPDAREGFFAVPKVVE 95


>gi|83949859|ref|ZP_00958592.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseovarius
          nubinhibens ISM]
 gi|83837758|gb|EAP77054.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseovarius
          nubinhibens ISM]
          Length = 95

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 59/95 (62%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     ++A  +RI ++E+ +P      N  L  +E+++EV+V+G+EPM SV PM++
Sbjct: 1  MSIDTETAAKVAKLARIRVEEDALPALAQEFNTILGFIEQLNEVDVDGIEPMTSVTPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DGD+   +LSNAP   + FF VPK VE
Sbjct: 61 PRRVDEVNDGDQQAKVLSNAPDAREGFFAVPKVVE 95


>gi|154247848|ref|YP_001418806.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Xanthobacter
          autotrophicus Py2]
 gi|229487563|sp|A7IMA6|GATC_XANP2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|154161933|gb|ABS69149.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Xanthobacter
          autotrophicus Py2]
          Length = 95

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 64/95 (67%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+R+AH +RIS++E+++      LN  L  +E++++++V GVEP+ SVVP+++
Sbjct: 1  MSVDQATVRRVAHLARISVREDELGHLQNELNAILEFVEQLADLDVSGVEPLTSVVPVEL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG   E +L+NAP  E  FF VPK VE
Sbjct: 61 PMREDVVTDGHCPEKVLANAPDAEGGFFTVPKVVE 95


>gi|329889394|ref|ZP_08267737.1| glutamyl-tRNAGln amidotransferase subunit C [Brevundimonas
          diminuta ATCC 11568]
 gi|328844695|gb|EGF94259.1| glutamyl-tRNAGln amidotransferase subunit C [Brevundimonas
          diminuta ATCC 11568]
          Length = 95

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 58/95 (61%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   V+++AH +RI   E+ +      LN  L  +E++ EV+V+GVEPM S V   +
Sbjct: 1  MAIDAATVRKVAHLARIKTPEDRLEPLAQELNGILKWIEQLDEVDVQGVEPMTSNVSQPL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D+V DGDKV  +LSNAP     FFVVPK VE
Sbjct: 61 RMRDDLVTDGDKVADVLSNAPKSADGFFVVPKVVE 95


>gi|86140020|ref|ZP_01058584.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseobacter sp.
           MED193]
 gi|85823270|gb|EAQ43481.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseobacter sp.
           MED193]
          Length = 140

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 60/95 (63%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M ID     ++A  +RI +++E +P      N  L  +E+++EV+VEGV+PM SV P ++
Sbjct: 46  MSIDQNTASKVAKLARIKVEDEALPGLAAEFNTILDFIEQLNEVDVEGVDPMTSVTPQRL 105

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R DVV DG++ + +LSNAP   + FF VPK +E
Sbjct: 106 KRRDDVVTDGNQADKVLSNAPDAREGFFAVPKVME 140


>gi|126735089|ref|ZP_01750835.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseobacter sp.
          CCS2]
 gi|126715644|gb|EBA12509.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseobacter sp.
          CCS2]
          Length = 95

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID    +R+A  +RI ++++ +P      +  L  +E+++EV+VEGV PM SV P ++
Sbjct: 1  MSIDTETARRVAKLARIKVEDDALPALASEFSAILGFIEQLNEVDVEGVAPMTSVTPQRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG + E++L NAP   + FF VPK VE
Sbjct: 61 KRRDDVVTDGGQQEAVLKNAPDAREGFFAVPKVVE 95


>gi|158424467|ref|YP_001525759.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Azorhizobium
          caulinodans ORS 571]
 gi|172047971|sp|A8I9X4|GATC_AZOC5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|158331356|dbj|BAF88841.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Azorhizobium
          caulinodans ORS 571]
          Length = 95

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 61/95 (64%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+R+AH +RI++ EE++      LN  L+ +E+++ ++V  VEPM  V+PM++
Sbjct: 1  MSVDQATVRRVAHLARIAVSEEELEPLKGELNAILAFVEQLANLDVADVEPMTGVIPMEL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG   E IL+NAP  E  FF VPK VE
Sbjct: 61 PMREDVVTDGHYPEKILANAPEAEGGFFTVPKVVE 95


>gi|254419277|ref|ZP_05033001.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Brevundimonas sp.
          BAL3]
 gi|196185454|gb|EDX80430.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Brevundimonas sp.
          BAL3]
          Length = 95

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 60/95 (63%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   V+++AH +RI   E+ +      LN  L  +E+++EV+V+GVEPM S V   +
Sbjct: 1  MAIDAATVRKVAHLARIKTPEDRLEPLAQELNGILQWIEQLNEVDVDGVEPMTSNVAQPL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG K++++LSNAP     FFVVPK VE
Sbjct: 61 RLREDVVTDGGKIDAVLSNAPKSADGFFVVPKVVE 95


>gi|114773342|ref|ZP_01450546.1| Glu-tRNA (Gln) amidotransferase, subunit C [alpha proteobacterium
          HTCC2255]
 gi|114546276|gb|EAU49187.1| Glu-tRNA (Gln) amidotransferase, subunit C [alpha proteobacterium
          HTCC2255]
          Length = 95

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 60/95 (63%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID    +R AH +RI++ EE++      L+  +  +E++ EV+VEG+EP+ SV PM +
Sbjct: 1  MSIDKETARRAAHLARIAVPEEELENLAQELSGIVGFMEQLLEVDVEGIEPLTSVSPMAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DGD+++ IL NAP   + FF VPK +E
Sbjct: 61 PRRTDAVTDGDQIKKILKNAPDSREGFFAVPKVME 95


>gi|83955338|ref|ZP_00963993.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sulfitobacter sp.
           NAS-14.1]
 gi|83840331|gb|EAP79505.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sulfitobacter sp.
           NAS-14.1]
          Length = 129

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 58/95 (61%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M ID     R+A  +RI ++ + +P      NN L  +E+++EV+V+GVEPM SV P  +
Sbjct: 35  MSIDESTAARVAKLARIKVEPDALPALAQEFNNILGFIEQLNEVDVDGVEPMTSVTPQVL 94

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R DVV DGD+   +L+NAP   + FF VPK VE
Sbjct: 95  KKREDVVRDGDQQAKVLANAPDAREGFFAVPKVVE 129


>gi|254486354|ref|ZP_05099559.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseobacter sp.
          GAI101]
 gi|214043223|gb|EEB83861.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseobacter sp.
          GAI101]
          Length = 95

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     R+A  +RI +    +P      NN L  +E+++EV+VEGVEPM SV P  +
Sbjct: 1  MSIDETTAARVAKLARIKVDPAALPALAQEFNNILGFIEQLNEVDVEGVEPMTSVTPQVL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG + + IL+NAP   + FF VPK VE
Sbjct: 61 KQRDDVVRDGGQQDKILANAPDAREGFFAVPKVVE 95


>gi|89053713|ref|YP_509164.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Jannaschia sp.
          CCS1]
 gi|122499217|sp|Q28T23|GATC_JANSC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|88863262|gb|ABD54139.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Jannaschia sp. CCS1]
          Length = 95

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 59/95 (62%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     ++A  +RI ++++ +P      N  L  +E++ EV+VEGV+PMVSV PM +
Sbjct: 1  MSIDESTAAKVAKLARIKVEDDALPALANEFNAILGFIEQLEEVDVEGVDPMVSVTPMAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DGD+   +L+NAP   + FF VPK VE
Sbjct: 61 PRREDVVTDGDQQTRVLTNAPDAREGFFSVPKVVE 95


>gi|254476618|ref|ZP_05090004.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Ruegeria sp. R11]
 gi|214030861|gb|EEB71696.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Ruegeria sp. R11]
          Length = 95

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 59/95 (62%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     ++A  +RI ++E+ +P      N  L  +E+++EV+VEGVEPM SV P ++
Sbjct: 1  MSIDQSTAAKVAKLARIKVEEDALPALADEFNTILGFIEQLNEVDVEGVEPMTSVTPQRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG++ + IL+NAP   + FF VPK VE
Sbjct: 61 KRRVDEVTDGNQQDKILANAPDAREGFFAVPKVVE 95


>gi|17989019|ref|NP_541652.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          melitensis bv. 1 str. 16M]
 gi|23500339|ref|NP_699779.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella suis
          1330]
 gi|62317548|ref|YP_223401.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          abortus bv. 1 str. 9-941]
 gi|83269529|ref|YP_418820.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          melitensis biovar Abortus 2308]
 gi|148558745|ref|YP_001257582.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella ovis
          ATCC 25840]
 gi|161620657|ref|YP_001594543.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella canis
          ATCC 23365]
 gi|163844747|ref|YP_001622402.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella suis
          ATCC 23445]
 gi|189022803|ref|YP_001932544.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          abortus S19]
 gi|225629088|ref|ZP_03787121.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Brucella ceti
          str. Cudo]
 gi|237817096|ref|ZP_04596088.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Brucella abortus str. 2308 A]
 gi|254691046|ref|ZP_05154300.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          abortus bv. 6 str. 870]
 gi|254695648|ref|ZP_05157476.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          abortus bv. 3 str. Tulya]
 gi|254698830|ref|ZP_05160658.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          abortus bv. 2 str. 86/8/59]
 gi|254699831|ref|ZP_05161659.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella suis
          bv. 5 str. 513]
 gi|254702969|ref|ZP_05164797.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella suis
          bv. 3 str. 686]
 gi|254705910|ref|ZP_05167738.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          pinnipedialis M163/99/10]
 gi|254711137|ref|ZP_05172948.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          pinnipedialis B2/94]
 gi|254712405|ref|ZP_05174216.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella ceti
          M644/93/1]
 gi|254715477|ref|ZP_05177288.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella ceti
          M13/05/1]
 gi|254720419|ref|ZP_05182230.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella sp.
          83/13]
 gi|254732277|ref|ZP_05190855.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          abortus bv. 4 str. 292]
 gi|256015372|ref|YP_003105381.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Brucella microti
          CCM 4915]
 gi|256029518|ref|ZP_05443132.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          pinnipedialis M292/94/1]
 gi|256043492|ref|ZP_05446419.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          melitensis bv. 1 str. Rev.1]
 gi|256059213|ref|ZP_05449419.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          neotomae 5K33]
 gi|256157713|ref|ZP_05455631.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella ceti
          M490/95/1]
 gi|256253316|ref|ZP_05458852.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella ceti
          B1/94]
 gi|256256231|ref|ZP_05461767.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          abortus bv. 9 str. C68]
 gi|260167392|ref|ZP_05754203.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella sp.
          F5/99]
 gi|260544784|ref|ZP_05820605.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          abortus NCTC 8038]
 gi|260564687|ref|ZP_05835172.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Brucella
          melitensis bv. 1 str. 16M]
 gi|260568117|ref|ZP_05838586.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella suis
          bv. 4 str. 40]
 gi|260756641|ref|ZP_05868989.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella abortus bv.
          6 str. 870]
 gi|260760071|ref|ZP_05872419.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella abortus bv.
          4 str. 292]
 gi|260763310|ref|ZP_05875642.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella abortus bv.
          2 str. 86/8/59]
 gi|260882458|ref|ZP_05894072.1| glutamyl-tRNA(gln) amidotransferase [Brucella abortus bv. 9 str.
          C68]
 gi|261216048|ref|ZP_05930329.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella abortus bv.
          3 str. Tulya]
 gi|261217212|ref|ZP_05931493.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella ceti
          M13/05/1]
 gi|261220432|ref|ZP_05934713.1| glutamyl-tRNA(gln) amidotransferase [Brucella ceti B1/94]
 gi|261313338|ref|ZP_05952535.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella
          pinnipedialis M163/99/10]
 gi|261318727|ref|ZP_05957924.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella
          pinnipedialis B2/94]
 gi|261320083|ref|ZP_05959280.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella ceti
          M644/93/1]
 gi|261323161|ref|ZP_05962358.1| glutamyl-tRNA(gln) amidotransferase [Brucella neotomae 5K33]
 gi|261750305|ref|ZP_05994014.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella suis bv. 5
          str. 513]
 gi|261753578|ref|ZP_05997287.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella suis bv. 3
          str. 686]
 gi|261756802|ref|ZP_06000511.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella sp. F5/99]
 gi|265985437|ref|ZP_06098172.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella sp. 83/13]
 gi|265986525|ref|ZP_06099082.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella
          pinnipedialis M292/94/1]
 gi|265989910|ref|ZP_06102467.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella melitensis
          bv. 1 str. Rev.1]
 gi|265996217|ref|ZP_06108774.1| glutamyl-tRNA(gln) amidotransferase [Brucella ceti M490/95/1]
 gi|297249587|ref|ZP_06933288.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Brucella abortus bv. 5 str. B3196]
 gi|306839004|ref|ZP_07471825.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Brucella sp. NF 2653]
 gi|306841758|ref|ZP_07474444.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Brucella sp. BO2]
 gi|306845928|ref|ZP_07478495.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Brucella sp. BO1]
 gi|54037157|sp|P64204|GATC_BRUSU RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|54041291|sp|P64203|GATC_BRUME RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|75495583|sp|Q577Z4|GATC_BRUAB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|123545917|sp|Q2YKL4|GATC_BRUA2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|166198844|sp|A5VUS7|GATC_BRUO2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|189045157|sp|A9MBN5|GATC_BRUC2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|189045158|sp|A9WYR4|GATC_BRUSI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|229487453|sp|B2SB61|GATC_BRUA1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|17984858|gb|AAL53916.1| glutamyl-tRNA(gln) amidotransferase subunit c [Brucella
          melitensis bv. 1 str. 16M]
 gi|23463954|gb|AAN33784.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Brucella suis
          1330]
 gi|62197741|gb|AAX76040.1| GatC, glutamyl-tRNA(Gln) amidotransferase, C subunit [Brucella
          abortus bv. 1 str. 9-941]
 gi|82939803|emb|CAJ12811.1| Glu-tRNAGln amidotransferase, C subunit:Glutamyl-tRNA(Gln)
          amidotransferase C subunit [Brucella melitensis biovar
          Abortus 2308]
 gi|148370030|gb|ABQ62902.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Brucella ovis
          ATCC 25840]
 gi|161337468|gb|ABX63772.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Brucella canis ATCC 23365]
 gi|163675470|gb|ABY39580.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Brucella suis ATCC 23445]
 gi|189021377|gb|ACD74098.1| Glu-tRNAGln amidotransferase, C subunit [Brucella abortus S19]
 gi|225615584|gb|EEH12633.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Brucella ceti
          str. Cudo]
 gi|237787909|gb|EEP62125.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Brucella abortus str. 2308 A]
 gi|255998032|gb|ACU49719.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Brucella microti
          CCM 4915]
 gi|260098055|gb|EEW81929.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          abortus NCTC 8038]
 gi|260152330|gb|EEW87423.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Brucella
          melitensis bv. 1 str. 16M]
 gi|260154782|gb|EEW89863.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella suis
          bv. 4 str. 40]
 gi|260670389|gb|EEX57329.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella abortus bv.
          4 str. 292]
 gi|260673731|gb|EEX60552.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella abortus bv.
          2 str. 86/8/59]
 gi|260676749|gb|EEX63570.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella abortus bv.
          6 str. 870]
 gi|260871986|gb|EEX79055.1| glutamyl-tRNA(gln) amidotransferase [Brucella abortus bv. 9 str.
          C68]
 gi|260917655|gb|EEX84516.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella abortus bv.
          3 str. Tulya]
 gi|260919016|gb|EEX85669.1| glutamyl-tRNA(gln) amidotransferase [Brucella ceti B1/94]
 gi|260922301|gb|EEX88869.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella ceti
          M13/05/1]
 gi|261292773|gb|EEX96269.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella ceti
          M644/93/1]
 gi|261297950|gb|EEY01447.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella
          pinnipedialis B2/94]
 gi|261299141|gb|EEY02638.1| glutamyl-tRNA(gln) amidotransferase [Brucella neotomae 5K33]
 gi|261302364|gb|EEY05861.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella
          pinnipedialis M163/99/10]
 gi|261736786|gb|EEY24782.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella sp. F5/99]
 gi|261740058|gb|EEY27984.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella suis bv. 5
          str. 513]
 gi|261743331|gb|EEY31257.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella suis bv. 3
          str. 686]
 gi|262550514|gb|EEZ06675.1| glutamyl-tRNA(gln) amidotransferase [Brucella ceti M490/95/1]
 gi|263000579|gb|EEZ13269.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella melitensis
          bv. 1 str. Rev.1]
 gi|264658722|gb|EEZ28983.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella
          pinnipedialis M292/94/1]
 gi|264664029|gb|EEZ34290.1| glutamyl-tRNA(gln) amidotransferase chain C [Brucella sp. 83/13]
 gi|297173456|gb|EFH32820.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Brucella abortus bv. 5 str. B3196]
 gi|306273563|gb|EFM55408.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Brucella sp. BO1]
 gi|306288163|gb|EFM59550.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Brucella sp. BO2]
 gi|306405910|gb|EFM62168.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Brucella sp. NF 2653]
          Length = 95

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+AH +RI++ E+D       LN  L  +E+++EV+VEG+EPM SV PMKM
Sbjct: 1  MSVDISTVKRVAHLARIAVSEDDAERMTGELNAILGFVEQLNEVDVEGIEPMTSVTPMKM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG    ++++NAP  E NFFVVPK VE
Sbjct: 61 RMREDKVTDGGIAAAVVANAPVTEDNFFVVPKVVE 95


>gi|256111489|ref|ZP_05452503.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brucella
          melitensis bv. 3 str. Ether]
 gi|265992985|ref|ZP_06105542.1| glutamyl-tRNA(gln) amidotransferase [Brucella melitensis bv. 3
          str. Ether]
 gi|262763855|gb|EEZ09887.1| glutamyl-tRNA(gln) amidotransferase [Brucella melitensis bv. 3
          str. Ether]
          Length = 95

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+AH +RI++ E+D       LN  L  +E+++EV+VEG+EPM SV PMKM
Sbjct: 1  MSVDISTVKRVAHLARIAVSEDDAESMTGELNAILGFVEQLNEVDVEGIEPMTSVTPMKM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG    ++++NAP  E NFFVVPK VE
Sbjct: 61 RMREDKVTDGGIAAAVVANAPVTEDNFFVVPKVVE 95


>gi|94497359|ref|ZP_01303930.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sphingomonas sp.
          SKA58]
 gi|94423222|gb|EAT08252.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sphingomonas sp.
          SKA58]
          Length = 95

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 60/95 (63%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID+  VK+IA  SRIS+ + +    +  LNN L  +E++ EV+V GVEPM +V+P   
Sbjct: 1  MSIDLQTVKKIASLSRISVTDTEAEAMVPELNNILGWVEQLGEVDVSGVEPMTAVIPNHQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+  + +L+NAP  E  FF VPK +E
Sbjct: 61 RLRDDVVTDGNVRDKVLANAPQAEHGFFAVPKVIE 95


>gi|83944518|ref|ZP_00956970.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sulfitobacter sp.
          EE-36]
 gi|83844624|gb|EAP82509.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sulfitobacter sp.
          EE-36]
          Length = 95

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 58/95 (61%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     R+A  +RI ++ + +P      NN L  +E+++EV+V+GVEPM SV P  +
Sbjct: 1  MSIDESTAARVAKLARIKVEPDALPALAQEFNNILGFIEQLNEVDVDGVEPMTSVTPQVL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DGD+   +L+NAP   + FF VPK VE
Sbjct: 61 KKREDVVRDGDQQAKVLANAPDAREGFFAVPKVVE 95


>gi|319407284|emb|CBI80925.1| Glu-tRNA(Gln) amidotransferase subunit C [Bartonella sp. 1-1C]
          Length = 95

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 62/95 (65%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   VKR+A  +RI+I  +++       N  L  ++++ EV+V+GVEP+ SV+PM +
Sbjct: 1  MSVDSKTVKRVAKLARIAIHNDEVERITEEFNTVLDFIKQLDEVDVDGVEPLTSVIPMTL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG+K   I++NAP  E+NFF+VPK VE
Sbjct: 61 RKREDEVTDGNKAADIIANAPLAEENFFLVPKVVE 95


>gi|294853608|ref|ZP_06794280.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Brucella sp. NVSL
          07-0026]
 gi|294819263|gb|EFG36263.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Brucella sp. NVSL
          07-0026]
          Length = 95

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+AH +RI++ E+D       LN  L  +E+++EV+VEG+EPM SV PMKM
Sbjct: 1  MSVDISTVKRVAHLARIAVSEDDAERMTGELNAILGFVEQLNEVDVEGIEPMTSVTPMKM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG    ++++NAP  E NFFVVPK VE
Sbjct: 61 RMREDKVTDGGIAAAVVANAPVTEDNFFVVPKIVE 95


>gi|163737473|ref|ZP_02144890.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Phaeobacter
          gallaeciensis BS107]
 gi|163740843|ref|ZP_02148236.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Phaeobacter
          gallaeciensis 2.10]
 gi|161385834|gb|EDQ10210.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Phaeobacter
          gallaeciensis 2.10]
 gi|161388999|gb|EDQ13351.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Phaeobacter
          gallaeciensis BS107]
          Length = 95

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 58/95 (61%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     ++A  +RI ++E+ +P      N  L  +E+++EV+VEGVEPM SV P ++
Sbjct: 1  MSIDQSTAAKVAKLARIKVEEDALPALADEFNTILGFIEQLNEVDVEGVEPMTSVTPQRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG + + IL+NAP   + FF VPK VE
Sbjct: 61 KRRVDEVTDGSQQDKILANAPDAREGFFAVPKVVE 95


>gi|110679284|ref|YP_682291.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Roseobacter
          denitrificans OCh 114]
 gi|123172584|sp|Q168I8|GATC_ROSDO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|109455400|gb|ABG31605.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseobacter
          denitrificans OCh 114]
          Length = 95

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     R+A  +RI ++   +P      N  L  +E+++EV+++GVEPM SV P  +
Sbjct: 1  MSIDESTAARVAKLARIKVEPAALPALAGEFNTILGFIEQLNEVDIDGVEPMTSVTPQVL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DGD+   +LSNAP   + FF VPK VE
Sbjct: 61 KRRADVVADGDQQARVLSNAPDAREGFFAVPKVVE 95


>gi|118588856|ref|ZP_01546264.1| Glu-tRNA(Gln) amidotransferase subunit C [Stappia aggregata IAM
          12614]
 gi|118438842|gb|EAV45475.1| Glu-tRNA(Gln) amidotransferase subunit C [Stappia aggregata IAM
          12614]
          Length = 95

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 57/95 (60%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   VKR+A  +RI + EED       LN  L  +E++ EV++ GVEP+ SVV   M
Sbjct: 1  MSVDTDTVKRVARLARIKVSEEDATRMTGELNAILGFVEQLDEVDISGVEPLTSVVEQTM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG+K + I  NAP  E +FF+VPK VE
Sbjct: 61 KKRADGVTDGNKADDITLNAPASEDHFFMVPKVVE 95


>gi|163733426|ref|ZP_02140869.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseobacter
          litoralis Och 149]
 gi|161393214|gb|EDQ17540.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseobacter
          litoralis Och 149]
          Length = 95

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     R+A  +RI ++   +P      N  L  +E+++EV+++GVEPM SV P  +
Sbjct: 1  MSIDESTAARVAKLARIKVEPAALPALAGEFNTILGFIEQLNEVDIDGVEPMTSVTPQVL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DGD+   +LSNAP   + FF VPK VE
Sbjct: 61 KRRADVVTDGDQQARVLSNAPDAREGFFAVPKVVE 95


>gi|149914088|ref|ZP_01902620.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseobacter sp.
          AzwK-3b]
 gi|149812372|gb|EDM72203.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseobacter sp.
          AzwK-3b]
          Length = 95

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 59/95 (62%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID     ++A  +RI ++++ +P      N+ L  +E+++EV+V+G+EPM SV PM++
Sbjct: 1  MSIDKDTAAKVAKLARIRVEDDALPALAQEFNDILGFIEQLNEVDVDGIEPMTSVTPMRL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV +G     +LSNAP   + FF VPK VE
Sbjct: 61 KRREDVVTEGGMAGRVLSNAPDAREGFFAVPKVVE 95


>gi|254474177|ref|ZP_05087568.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Pseudovibrio sp.
          JE062]
 gi|211956707|gb|EEA91916.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Pseudovibrio sp.
          JE062]
          Length = 95

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI + +E        LN  L  +E++ EVN+EGVEPM SVV   M
Sbjct: 1  MSVDLNTVKRVAGLARIKVDDEQAEKMTGELNAILGFVEQLDEVNIEGVEPMTSVVEQSM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D   DG   + ++SNAP  E NFF VPK VE
Sbjct: 61 KKRADGQTDGGYADKVVSNAPVHEDNFFTVPKVVE 95


>gi|319408540|emb|CBI82193.1| Glu-tRNA(Gln) amidotransferase subunit C [Bartonella
          schoenbuchensis R1]
          Length = 95

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 62/95 (65%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   VKR+AH +RI+I +++        N  L  +E+++EV++ GVEP+ SV+PM +
Sbjct: 1  MSVDNKTVKRVAHLARIAIHDDETERMTKEFNAILEFVEQLNEVDINGVEPLTSVMPMAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D + DG+K   I++NAP  E+NFF+V K VE
Sbjct: 61 RMREDNITDGNKAAEIVANAPITEENFFLVSKVVE 95


>gi|153010983|ref|YP_001372197.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Ochrobactrum
          anthropi ATCC 49188]
 gi|166199381|sp|A6X564|GATC_OCHA4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|151562871|gb|ABS16368.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Ochrobactrum
          anthropi ATCC 49188]
          Length = 95

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 63/95 (66%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+AH +RI++ ++D       LN  L  +E+++EVNV+G+EPM SV PM M
Sbjct: 1  MSVDISTVKRVAHLARIAVNDDDAERMTGELNAILGFVEQLNEVNVDGIEPMTSVTPMDM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG    ++++NAP  E NFFVVPK VE
Sbjct: 61 RMRQDKVTDGGIAAAVVANAPVTEDNFFVVPKVVE 95


>gi|328544236|ref|YP_004304345.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [polymorphum gilvum SL003B-26A1]
 gi|326413978|gb|ADZ71041.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Polymorphum gilvum SL003B-26A1]
          Length = 95

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 57/95 (60%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+  VKR+A  +RI + E D       LN  L  +E++ EV++ GVEP+ SVV   M
Sbjct: 1  MSVDIDTVKRVARLARIKVSEGDAERMTGELNAILGFVEQLDEVDIAGVEPLTSVVEQTM 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG   E +++NAP  E +FFVVPK VE
Sbjct: 61 KKRADGVTDGGYPEKVVANAPASEDDFFVVPKVVE 95


>gi|148553523|ref|YP_001261105.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Sphingomonas
          wittichii RW1]
 gi|166218183|sp|A5V3V1|GATC_SPHWW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|148498713|gb|ABQ66967.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Sphingomonas wittichii RW1]
          Length = 95

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 59/95 (62%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V++IA  +RI++ + D+   +  LNN L  +E++ EV+ +GV P+ +V+P   
Sbjct: 1  MSVDAATVRKIASLARIAVTDGDVEAMVPELNNILGWIEQLGEVDTDGVAPLAAVIPNHQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG+  + +L+NAP  E  FF VPK +E
Sbjct: 61 RLRDDVVTDGNIRDKVLANAPQAEHGFFAVPKVIE 95


>gi|239833962|ref|ZP_04682290.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
           subunit [Ochrobactrum intermedium LMG 3301]
 gi|239822025|gb|EEQ93594.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
           subunit [Ochrobactrum intermedium LMG 3301]
          Length = 147

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 63/95 (66%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M +D+  VKR+AH +RI++ ++D       LN  L  +E+++EV+V+G+EPM SV PM M
Sbjct: 53  MSVDISTVKRVAHLARIAVSDDDAERMTGELNAILGFVEQLNEVDVDGIEPMTSVTPMDM 112

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R D V DG    ++++NAP  E NFFVVPK VE
Sbjct: 113 RMREDKVTDGGIAAAVVANAPVTEDNFFVVPKVVE 147


>gi|254294340|ref|YP_003060363.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Hirschia
          baltica ATCC 49814]
 gi|254042871|gb|ACT59666.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Hirschia baltica
          ATCC 49814]
          Length = 95

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 58/89 (65%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV++ A  SRI IK+E +      LN  L  +E+++EV+VEG+EPM SVV + +  R D 
Sbjct: 7  DVRKAARLSRIKIKDERVEPMAQELNGILGWIEQLNEVDVEGIEPMTSVVEVSLPMRADE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V DG++   +L+NAP+    FFVVPK VE
Sbjct: 67 VNDGNRQAEVLANAPNSADGFFVVPKVVE 95


>gi|329851401|ref|ZP_08266158.1| glutamyl-tRNA and/or aspartyl-tRNA amidotransferase, C subunit
          [Asticcacaulis biprosthecum C19]
 gi|328840247|gb|EGF89819.1| glutamyl-tRNA and/or aspartyl-tRNA amidotransferase, C subunit
          [Asticcacaulis biprosthecum C19]
          Length = 95

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 58/95 (61%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M IDV  VK++A  SR+   E+ +      L+  L  +E+++EV+V GVEPM + V    
Sbjct: 1  MAIDVATVKKVASLSRLREPEDRLQALSGELSGILGWIEQLNEVDVAGVEPMTTAVEQPT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DGDKV  +++NAP   + FF+VPK VE
Sbjct: 61 PLRDDVVSDGDKVAQVVANAPKTAEGFFIVPKVVE 95


>gi|332186864|ref|ZP_08388606.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Sphingomonas sp. S17]
 gi|332013197|gb|EGI55260.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Sphingomonas sp. S17]
          Length = 88

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 55/88 (62%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          +K+IA  +RI+I EED       L N L  +E++ EV+ +GVEPM +V+P ++  R DVV
Sbjct: 1  MKKIASLARIAITEEDATRLAPELGNILGWIEQLGEVDTQGVEPMTAVIPNQLRLRDDVV 60

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           DG   + ++ NAP  E  FF VPK +E
Sbjct: 61 NDGGIRDLLMQNAPQAEHGFFTVPKVIE 88


>gi|319898951|ref|YP_004159044.1| Glu-tRNA(Gln) amidotransferase subunit C [Bartonella clarridgeiae
          73]
 gi|319402915|emb|CBI76466.1| Glu-tRNA(Gln) amidotransferase subunit C [Bartonella clarridgeiae
          73]
          Length = 95

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 61/95 (64%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   VKR+A  +RI+I  +++       N  L  +++++E++V GVE + SV+PM +
Sbjct: 1  MSVDSKTVKRVAKLARIAIHNDEVERITEEFNTVLDFVKQLNEIDVNGVELLTSVIPMAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG+K   I++NAP  E+NFF+VPK VE
Sbjct: 61 RRREDKVTDGNKATDIIANAPLAEENFFLVPKVVE 95


>gi|319404279|emb|CBI77872.1| Glu-tRNA(Gln) amidotransferase subunit C [Bartonella rochalimae
          ATCC BAA-1498]
          Length = 95

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 59/88 (67%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VKR+A  +RI+I  +++       N  L  ++++ EV+V+GVEP+ SV+PM +  R D V
Sbjct: 8  VKRVAKLARIAIHNDEVERITEEFNTVLDFVKQLDEVDVDGVEPLTSVIPMTLRKREDEV 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           DG+KV  I++NAP  E+N F+VPK VE
Sbjct: 68 TDGNKVVDIIANAPLAEENLFLVPKVVE 95


>gi|209545483|ref|YP_002277712.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|209533160|gb|ACI53097.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Gluconacetobacter
          diazotrophicus PAl 5]
          Length = 95

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIA  +RI I E D+      LN  L  +E+++EV+++GVEPMV      +
Sbjct: 1  MSLDPATVRRIARLARIGINESDLHALQGELNGILGWIEQLNEVDIDGVEPMVGTGHAAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG   +++LSNAP     F+ VPK VE
Sbjct: 61 RMREDVVTDGAARDAVLSNAPDAAGPFYTVPKVVE 95


>gi|162148751|ref|YP_001603212.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|189045165|sp|A9HRJ1|GATC_GLUDA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|161787328|emb|CAP56922.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Gluconacetobacter
          diazotrophicus PAl 5]
          Length = 95

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIA  +RI I E D+      LN  L  +E+++EV+++GVEPMV      +
Sbjct: 1  MSLDPATVRRIARLARIGIDESDLHALQGELNGILGWIEQLNEVDIDGVEPMVGTGHAAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG   +++LSNAP     F+ VPK VE
Sbjct: 61 RMREDVVTDGAARDAVLSNAPDAAGPFYTVPKVVE 95


>gi|302382950|ref|YP_003818773.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Brevundimonas
          subvibrioides ATCC 15264]
 gi|302193578|gb|ADL01150.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Brevundimonas
          subvibrioides ATCC 15264]
          Length = 95

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   V+++AH +RI   ++ +      LN  ++ +++++EV+V GVEPM S V   +
Sbjct: 1  MAIDAATVRKVAHLARIKTPDDRLEPLAGELNAIMAWIDQLNEVDVAGVEPMTSNVAQPL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG +VE++LSNAP     F+VVPK VE
Sbjct: 61 RLRDDAVTDGARVEAVLSNAPKSADGFYVVPKVVE 95


>gi|121601899|ref|YP_989124.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Bartonella bacilliformis KC583]
 gi|166198840|sp|A1UT21|GATC_BARBK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|120614076|gb|ABM44677.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Bartonella bacilliformis KC583]
          Length = 95

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 58/88 (65%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          +KRIAH +RI+I + +      + N  L   +++ E++V GV+P++SV+PM +  R D +
Sbjct: 8  IKRIAHLARIAIHDNETERITKKFNAILDFAKQLDEIDVTGVDPLISVIPMTLRTREDSI 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           DG+K   I++NAP  E+NFF+V K VE
Sbjct: 68 TDGNKAADIVANAPVTEENFFLVSKIVE 95


>gi|229597124|ref|YP_001609509.2| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bartonella
          tribocorum CIP 105476]
          Length = 95

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 62/95 (65%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   VKR+A  +RI+I++ ++     + N  L  +E+++EV+V  VEP+ SV+PM +
Sbjct: 1  MSVDQETVKRVARLARIAIRDNEVEPITKKFNAILGFVEQLNEVDVSEVEPLTSVIPMTL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG+K   I++NAP  E+NFF+V K VE
Sbjct: 61 RMREDNVTDGNKAADIVANAPVTEENFFLVSKIVE 95


>gi|161017956|emb|CAK01514.1| Glu-tRNA(Gln) amidotransferase subunit C [Bartonella tribocorum CIP
           105476]
          Length = 102

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 62/95 (65%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M +D   VKR+A  +RI+I++ ++     + N  L  +E+++EV+V  VEP+ SV+PM +
Sbjct: 8   MSVDQETVKRVARLARIAIRDNEVEPITKKFNAILGFVEQLNEVDVSEVEPLTSVIPMTL 67

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R D V DG+K   I++NAP  E+NFF+V K VE
Sbjct: 68  RMREDNVTDGNKAADIVANAPVTEENFFLVSKIVE 102


>gi|319405722|emb|CBI79345.1| Glu-tRNA(Gln) amidotransferase subunit C [Bartonella sp. AR 15-3]
          Length = 95

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   VKR+A  +RI+I  +++       N  L  ++++ E++V  VEP+ SV+PM +
Sbjct: 1  MSVDSKTVKRVAKLARIAIHNDEVERITEEFNTILDFVKQLDEIDVNEVEPLTSVIPMAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG+K   I+ NAP  E+NFF+VPK VE
Sbjct: 61 RKREDEVTDGNKATDIIENAPLAEENFFLVPKVVE 95


>gi|296535595|ref|ZP_06897776.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Roseomonas
          cervicalis ATCC 49957]
 gi|296264111|gb|EFH10555.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Roseomonas
          cervicalis ATCC 49957]
          Length = 95

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 54/95 (56%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+R+A  +R+ ++E+D+P     LN  L  +E++  V+  GVEPM      ++
Sbjct: 1  MSLDTATVRRVASLARLRVEEQDLPRLEAELNGILGWIEQLQAVDTSGVEPMAGGGAERL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DGD  + +L+NAP     FF VPK VE
Sbjct: 61 RLREDKVTDGDLQQQVLANAPDRADTFFAVPKVVE 95


>gi|315500164|ref|YP_004088967.1| glutamyl-tRNA(gln) amidotransferase, c subunit [Asticcacaulis
          excentricus CB 48]
 gi|315418176|gb|ADU14816.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Asticcacaulis
          excentricus CB 48]
          Length = 95

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 57/95 (60%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M IDV  V+++A  SR+   +E +     +LN  L  +E+++EV+V  V+PM S V M  
Sbjct: 1  MAIDVATVRKVASLSRLRESDESLESLAGQLNGILGWIEQLNEVDVSDVQPMTSCVEMTQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG KV  ++SNAP     FF+VPK VE
Sbjct: 61 PLRDDVVTDGGKVADVVSNAPKSLDGFFIVPKVVE 95


>gi|312114340|ref|YP_004011936.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Rhodomicrobium
          vannielii ATCC 17100]
 gi|311219469|gb|ADP70837.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhodomicrobium
          vannielii ATCC 17100]
          Length = 98

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/93 (41%), Positives = 56/93 (60%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          ID   V+RIAH +R+ +  E+       LN  LS +E+++ +  +GVEP+ SV   K+  
Sbjct: 6  IDEATVRRIAHLARVKVTAEEAKSLQRELNGILSWVEELNAIPTDGVEPLTSVGGAKLHM 65

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          R DVV DG+K   +L NAP  E  FF+VPK +E
Sbjct: 66 REDVVTDGNKPADVLKNAPKSEDGFFLVPKVIE 98


>gi|114570257|ref|YP_756937.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Maricaulis
          maris MCS10]
 gi|122315854|sp|Q0ANY8|GATC_MARMM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|114340719|gb|ABI65999.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Maricaulis maris MCS10]
          Length = 95

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 61/95 (64%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DV+RIA  +RI+   + I   +  LN  LS +E+++EV+V+GVEPM + V   +
Sbjct: 1  MSVTADDVRRIARLARIAEPTDRIDTLVGELNGILSWIEQLNEVDVDGVEPMTTPVKFPL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG+  + +L+NAP  ++ FFVVPK+VE
Sbjct: 61 PQRADEVTDGNCRDKVLANAPKSDEGFFVVPKSVE 95


>gi|197104789|ref|YP_002130166.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Phenylobacterium
          zucineum HLK1]
 gi|229487530|sp|B4R967|GATC_PHEZH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|196478209|gb|ACG77737.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Phenylobacterium
          zucineum HLK1]
          Length = 95

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 58/95 (61%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   V+++A  +RI+  EE +      L+  L+ +E+++EV+ +GVEPM + V   +
Sbjct: 1  MAIDAATVRKVARLARIAEPEEKLEPLAKELSGILNWIEQLNEVDTDGVEPMTTSVETTL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV +G     +L+NAP   KNFFVVPK VE
Sbjct: 61 PMRDDVVTEGGDPAKVLANAPKAAKNFFVVPKVVE 95


>gi|209964819|ref|YP_002297734.1| glutamyl-tRNA(Gln) amidotransferase, C subunit GatC
          [Rhodospirillum centenum SW]
 gi|229487536|sp|B6IN24|GATC_RHOCS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|209958285|gb|ACI98921.1| glutamyl-tRNA(Gln) amidotransferase, C subunit GatC
          [Rhodospirillum centenum SW]
          Length = 95

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V +IAH +RI + EE+       LN  L  +E++ EV+ +GV+P+ S V   +
Sbjct: 1  MSLDKATVAKIAHLARIRVPEEEQEHLAQELNGILGWVEQLGEVDTDGVQPITSNVAQTL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV DG   E +++NAP   ++FF VPK VE
Sbjct: 61 RRRQDVVTDGGYPEKVVANAPEGAEHFFAVPKVVE 95


>gi|46201775|ref|ZP_00054401.2| COG0721: Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit
          [Magnetospirillum magnetotacticum MS-1]
          Length = 95

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 57/95 (60%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+ IA  +RI +K+E++      L+N L  +E++SEVN +GV PM SV  +  
Sbjct: 1  MSLDKATVRAIAELARIEVKDEELDHLAGELSNILHFVEQLSEVNTDGVAPMTSVADITA 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DV+ DG   + +L+NAP   + FF VPK VE
Sbjct: 61 PMRADVINDGGYPDLVLANAPEAAEGFFTVPKVVE 95


>gi|83945530|ref|ZP_00957877.1| Glu-tRNA(Gln) amidotransferase subunit C [Oceanicaulis alexandrii
          HTCC2633]
 gi|83851106|gb|EAP88964.1| Glu-tRNA(Gln) amidotransferase subunit C [Oceanicaulis alexandrii
          HTCC2633]
          Length = 95

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 56/89 (62%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+RIA  +RI+   + +      LN  L  +E+++EV+V GVEPM + V   +  R D 
Sbjct: 7  DVRRIARLARIAEPADRLDSLTNELNGILDWVEQLNEVDVTGVEPMTTPVQTPLPLRADE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          + DG K + IL+NAP  E+ FFVVPK+VE
Sbjct: 67 ITDGGKRDDILANAPKAEEGFFVVPKSVE 95


>gi|148259883|ref|YP_001234010.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acidiphilium
          cryptum JF-5]
 gi|166198834|sp|A5FWV9|GATC_ACICJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|146401564|gb|ABQ30091.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Acidiphilium cryptum JF-5]
          Length = 95

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIA  +RI + EE++P     LN  L  +E+++EV+VEGV P+     M +
Sbjct: 1  MSLDHATVRRIAKLARIRLDEEEVPRLAGELNAILGYVEQLAEVDVEGVAPLSGGAQMAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG   + +L+NAP    +FF VPK VE
Sbjct: 61 RMREDEVTDGRYPDRVLANAPERIGDFFAVPKVVE 95


>gi|87200846|ref|YP_498103.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Novosphingobium aromaticivorans DSM 12444]
 gi|123488373|sp|Q2G4F4|GATC_NOVAD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit C; Short=Asp/Glu-ADT subunit C
 gi|87136527|gb|ABD27269.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 100

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 5/100 (5%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M +D   V +IA  +RI + E ++   +  LN  L+ +E++ EV+V G+EPM +V+P K 
Sbjct: 1   MSVDTATVAKIASLARIKVSEAELGAMVPELNGILAWVEQLGEVDVTGIEPMTAVIPNKQ 60

Query: 61  VHRPDVV-----CDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R DVV       GD  +++L+NAP  E  FF VPK +E
Sbjct: 61  RLRDDVVNADPLTGGDMRDAVLANAPAPEHGFFGVPKVIE 100


>gi|295690145|ref|YP_003593838.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Caulobacter
          segnis ATCC 21756]
 gi|295432048|gb|ADG11220.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Caulobacter
          segnis ATCC 21756]
          Length = 95

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   V+++A  +RI+  EE I      LN  ++ +E+++EV+ EG EP+ SVV   +
Sbjct: 1  MAIDAATVRKVARLARIAEPEERIEALANELNGIMTWIEQLAEVDTEGCEPLTSVVAAGL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV  G     + SNAP    NFFVVPK VE
Sbjct: 61 PLRDDVVTMGGDPAKVTSNAPKSVGNFFVVPKVVE 95


>gi|288958767|ref|YP_003449108.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Azospirillum sp. B510]
 gi|288911075|dbj|BAI72564.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Azospirillum sp. B510]
          Length = 95

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V +IAH +RI + +E++      L+  L+ +E+++EV+ + V PM SV   K+
Sbjct: 1  MSLDKATVAKIAHLARIKVPDEELESLAGELSRILTFVEQLNEVDTKDVPPMTSVAAQKL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG     +LSN P   + FFVVPK VE
Sbjct: 61 RRRKDEVTDGGYAAQVLSNGPETAEGFFVVPKVVE 95


>gi|152995960|ref|YP_001340795.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Marinomonas sp.
           MWYL1]
 gi|150836884|gb|ABR70860.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Marinomonas sp.
           MWYL1]
          Length = 108

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 61/95 (64%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M ID  DV++IAH +R+++ E D   +   L++ L+++E++  VN +GVEP+ + + M  
Sbjct: 14  MSIDKQDVQKIAHLARLALTETDADQYQHSLSSVLALVEQMQSVNTDGVEPLSNPLEMTQ 73

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R D+V + ++ ++ L+NAP  E   F+VPK ++
Sbjct: 74  RLREDIVTEENRRDAFLANAPQTEAGLFLVPKVID 108


>gi|296115810|ref|ZP_06834436.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295977787|gb|EFG84539.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 121

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 55/95 (57%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M +D   V+RIA  +RI I E D+      LN  L  +E+++EVNV+G+ PMV      +
Sbjct: 27  MSLDPATVRRIARLARIGIDESDLQSLPGELNGILGWIEQLNEVNVDGIAPMVGTETAVL 86

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R DVV DG+  +++LSNA      ++ VPK VE
Sbjct: 87  RMREDVVTDGNIRDAVLSNATDTAGPYYTVPKVVE 121


>gi|16126677|ref|NP_421241.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Caulobacter
          crescentus CB15]
 gi|221235456|ref|YP_002517893.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Caulobacter
          crescentus NA1000]
 gi|18202697|sp|Q9A5K9|GATC_CAUCR RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|254790989|sp|B8GZJ6|GATC_CAUCN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|13423983|gb|AAK24409.1| glutamyl-tRNA(Gln) amidotransferase subunit C, putative
          [Caulobacter crescentus CB15]
 gi|220964629|gb|ACL95985.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Caulobacter crescentus NA1000]
          Length = 95

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   V+++A  +RI+  EE +      LN  ++ +E+++EV+ +G EP+ SVV   +
Sbjct: 1  MAIDAATVRKVARLARIATPEERLEPLAQELNGIMTWIEQLAEVDTDGCEPLTSVVAAGL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV  G     + SNAP    NFFVVPK VE
Sbjct: 61 PLREDVVTMGGDPARVTSNAPKSINNFFVVPKVVE 95


>gi|85707672|ref|ZP_01038738.1| putative glutamyl-trna(gln) amidotransferase subunit c protein
           [Erythrobacter sp. NAP1]
 gi|85689206|gb|EAQ29209.1| putative glutamyl-trna(gln) amidotransferase subunit c protein
           [Erythrobacter sp. NAP1]
          Length = 100

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 60/100 (60%), Gaps = 5/100 (5%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M +D   V +IA  +RI + +E++   +  LN  L+ +E++ EV+VEGVEPM +V+P  +
Sbjct: 1   MSVDKQTVAKIASLARIKMGDEELERMVPELNGILNWVEQLGEVDVEGVEPMSAVIPNTL 60

Query: 61  VHRPDVV-----CDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R DVV       G K + +L+NAP  E  FF VPK +E
Sbjct: 61  RLRDDVVDADPKTGGGKRDEVLANAPAAEHGFFGVPKVIE 100


>gi|326403187|ref|YP_004283268.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Acidiphilium multivorum AIU301]
 gi|325050048|dbj|BAJ80386.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Acidiphilium multivorum AIU301]
          Length = 95

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+RIA  +RI + E+ +P     LN  L  +E+++EV+VEGV P+     M +
Sbjct: 1  MSLDHATVRRIAKLARIRLDEDAVPRLAGELNAILGYVEQLAEVDVEGVAPLSGGAQMAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG   + +L+NAP    +FF VPK VE
Sbjct: 61 RMREDEVTDGRYPDRVLANAPERIGDFFAVPKVVE 95


>gi|103486330|ref|YP_615891.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Sphingopyxis
           alaskensis RB2256]
 gi|123253435|sp|Q1GUW4|GATC_SPHAL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit C; Short=Asp/Glu-ADT subunit C
 gi|98976407|gb|ABF52558.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Sphingopyxis alaskensis RB2256]
          Length = 100

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 57/100 (57%), Gaps = 5/100 (5%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M ID   V++IA  +RI+I + +       LN  L  +E++ EV+V GVEPM +V+P  +
Sbjct: 1   MAIDQATVRKIASLARIAISDAEAAAMEGELNGILGWVEQLGEVDVSGVEPMTAVIPNTL 60

Query: 61  VHRPDVV-----CDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R DVV       G++ + IL+NAP     FF VPK +E
Sbjct: 61  RLRDDVVDADPLTGGNRRDDILANAPAAMHGFFGVPKVIE 100


>gi|87120474|ref|ZP_01076368.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Marinomonas sp.
          MED121]
 gi|86164117|gb|EAQ65388.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Marinomonas sp.
          MED121]
          Length = 95

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 60/95 (63%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D  DV++IAH +R+++ EED   +   L++ L ++E++  V+ EGVEP+ + + M  
Sbjct: 1  MSLDKQDVQKIAHLARLALTEEDASEYQSSLSSVLELVEQMQSVDTEGVEPLSNPLEMTQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + ++ ++ L+NAP  E   F+VPK ++
Sbjct: 61 RLRADEVTEENRRDAFLANAPSTEAGLFLVPKVID 95


>gi|167645484|ref|YP_001683147.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Caulobacter
          sp. K31]
 gi|189045159|sp|B0T192|GATC_CAUSK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|167347914|gb|ABZ70649.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Caulobacter sp.
          K31]
          Length = 95

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   V+++A  +RI+  E+ +      LN  ++ +E++++V+ +GVEP+ SVV   +
Sbjct: 1  MAIDAATVRKVARLARIATPEDRLEPLAQELNGIMTWIEQLAQVDTDGVEPLTSVVHAGL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV  G   + I +NAP     FFVVPK VE
Sbjct: 61 PLREDVVTMGGDADLITANAPKSTGGFFVVPKVVE 95


>gi|329113629|ref|ZP_08242407.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acetobacter pomorum DM001]
 gi|326697036|gb|EGE48699.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acetobacter pomorum DM001]
          Length = 124

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 56/95 (58%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M +D+   +RIA  +RI ++E ++     +LN  L  +++++EV+VEGV PMV      +
Sbjct: 30  MSLDLATTRRIAKLARIGLEEHELEAARQKLNGILGWIDQLAEVDVEGVPPMVGTETETL 89

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R D V DG+  +++L+ AP     F+ VPK VE
Sbjct: 90  RQREDKVTDGNYRDALLACAPETSGPFYTVPKVVE 124


>gi|326795035|ref|YP_004312855.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Marinomonas mediterranea MMB-1]
 gi|326545799|gb|ADZ91019.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Marinomonas mediterranea MMB-1]
          Length = 95

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 60/95 (63%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV++IAH +R+S+ ++D   +   L++ L ++E++  V+ +GVEP+ + +    
Sbjct: 1  MSLEKQDVQKIAHLARLSLSDQDAEEYQHSLSSVLDLVEQMQSVDTDGVEPLSNPLEATQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV + D+ E+ LSNAP  E   F+VP+ ++
Sbjct: 61 RLREDVVTEQDRREAFLSNAPQTESGLFLVPQVID 95


>gi|258543588|ref|YP_003189021.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Acetobacter
          pasteurianus IFO 3283-01]
 gi|256634666|dbj|BAI00642.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Acetobacter
          pasteurianus IFO 3283-01]
 gi|256637722|dbj|BAI03691.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Acetobacter
          pasteurianus IFO 3283-03]
 gi|256640776|dbj|BAI06738.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Acetobacter
          pasteurianus IFO 3283-07]
 gi|256643831|dbj|BAI09786.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Acetobacter
          pasteurianus IFO 3283-22]
 gi|256646886|dbj|BAI12834.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Acetobacter
          pasteurianus IFO 3283-26]
 gi|256649939|dbj|BAI15880.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Acetobacter
          pasteurianus IFO 3283-32]
 gi|256652929|dbj|BAI18863.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Acetobacter
          pasteurianus IFO 3283-01-42C]
 gi|256655983|dbj|BAI21910.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Acetobacter
          pasteurianus IFO 3283-12]
          Length = 95

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D+   +RIA  +RI ++E ++     +LN  L  +++++EV+VEGV PMV      +
Sbjct: 1  MSLDLATTRRIAKLARIGLEEHELEATRQKLNGILGWIDQLAEVDVEGVPPMVGTETETL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG+  +++L+ AP     F+ VPK VE
Sbjct: 61 RQREDKVTDGNCRDALLACAPETSGPFYTVPKVVE 95


>gi|83594507|ref|YP_428259.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rhodospirillum rubrum ATCC 11170]
 gi|123525727|sp|Q2RPH3|GATC_RHORT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|83577421|gb|ABC23972.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rhodospirillum rubrum ATCC 11170]
          Length = 95

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 53/95 (55%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V +IA  +R+ I+E+ +      L+  L  +E+++EV+  GV  M SV  + +
Sbjct: 1  MALDKTTVAKIATLARLDIEEDRMEALAGELSGILDWIEQLAEVDTSGVAAMTSVADLAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG   + +L+NAP  +   F+VPK VE
Sbjct: 61 AWREDAVTDGGYADRVLANAPESQDGCFLVPKVVE 95


>gi|330814159|ref|YP_004358398.1| aspartyl-tRNA(Asn) amidotransferase subunit C /
          Glutamyl-tRNA(Gln) amidotransferase subunit C
          [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487254|gb|AEA81659.1| aspartyl-tRNA(Asn) amidotransferase subunit C /
          Glutamyl-tRNA(Gln) amidotransferase subunit C
          [Candidatus Pelagibacter sp. IMCC9063]
          Length = 95

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 59/95 (62%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I+   VK+I+  SRI+  +E     +  LN  L  +++++EV+ + +EP+ SVV  K+
Sbjct: 1  MTINKEAVKKISKLSRIASNDEFETSMIKDLNTILKFVDQLNEVDTKDIEPLSSVVEQKL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV   ++ E IL N+PH  KN+FVVPK +E
Sbjct: 61 FQREDVVKKMNEKEEILKNSPHKNKNYFVVPKVIE 95


>gi|254491548|ref|ZP_05104727.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylophaga
          thiooxidans DMS010]
 gi|224463026|gb|EEF79296.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylophaga
          thiooxydans DMS010]
          Length = 95

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 59/95 (62%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D  DV++IAH +R+SI+E+DIP +   LNN L+++E++S V+   + PM   +    
Sbjct: 1  MSLDKHDVEKIAHLARLSIQEDDIPHYARDLNNILNLVEQMSAVDTNDILPMAHPLDAHQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD V + D+ E+  + AP  E   ++VPK +E
Sbjct: 61 RLRPDSVNEVDQREAFQAIAPKTEAGVYLVPKVIE 95


>gi|149187020|ref|ZP_01865327.1| glutamyl-tRNA(gln) amidotransferase subunit C [Erythrobacter sp.
           SD-21]
 gi|148829309|gb|EDL47753.1| glutamyl-tRNA(gln) amidotransferase subunit C [Erythrobacter sp.
           SD-21]
          Length = 100

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (59%), Gaps = 5/94 (5%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           +V +IA  +RI + +E++   +  LNN L  +E++ EV+  GVEPM +V+P  +  R DV
Sbjct: 7   EVAKIASLARIKMGDEELDRMVPELNNILDWVEQLGEVDTSGVEPMTAVIPNTLRLRDDV 66

Query: 67  V-----CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           V       G + E +L+NAP  E  FF VPK +E
Sbjct: 67  VDAIPETSGGRREDVLANAPVAEHGFFGVPKVIE 100


>gi|294084180|ref|YP_003550938.1| glutamyl-tRNA(Gln) amidotransferasesubunit C [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663753|gb|ADE38854.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 112

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (54%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M +D   V +IA  +RI + E         LN  L+ + ++ EVN + VEP+ SV    +
Sbjct: 18  MSVDKSTVAKIARLARIHVDEARQEAIADELNGILAWIAELDEVNTDNVEPLASVTGHSL 77

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R DVV DG  V+ +L+NAP     FFVVPK VE
Sbjct: 78  PMREDVVTDGGYVDDVLANAPESASGFFVVPKVVE 112


>gi|15599678|ref|NP_253172.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          aeruginosa PAO1]
 gi|107099933|ref|ZP_01363851.1| hypothetical protein PaerPA_01000954 [Pseudomonas aeruginosa
          PACS2]
 gi|254238857|ref|ZP_04932180.1| Glu-tRNA(Gln) amidotransferase subunit C [Pseudomonas aeruginosa
          C3719]
 gi|254244705|ref|ZP_04938027.1| Glu-tRNA(Gln) amidotransferase subunit C [Pseudomonas aeruginosa
          2192]
 gi|18203003|sp|Q9HVT9|GATC_PSEAE RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|9950720|gb|AAG07870.1|AE004862_4 Glu-tRNA(Gln) amidotransferase subunit C [Pseudomonas aeruginosa
          PAO1]
 gi|126170788|gb|EAZ56299.1| Glu-tRNA(Gln) amidotransferase subunit C [Pseudomonas aeruginosa
          C3719]
 gi|126198083|gb|EAZ62146.1| Glu-tRNA(Gln) amidotransferase subunit C [Pseudomonas aeruginosa
          2192]
          Length = 96

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV++IAH +R+ + E D+P     LNN L +++++  V+  GVEP+   +    
Sbjct: 1  MALERSDVEKIAHLARLGLSEADLPRTTETLNNILGLIDQMQAVDTSGVEPLAHPLEATQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD V + D  ++  + AP VE+  ++VPK +E
Sbjct: 61 RLRPDAVTETDHRDAYQTIAPAVEEGLYLVPKVIE 95


>gi|116052514|ref|YP_792827.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          aeruginosa UCBPP-PA14]
 gi|152987108|ref|YP_001350432.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          aeruginosa PA7]
 gi|218893574|ref|YP_002442443.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          aeruginosa LESB58]
 gi|296391192|ref|ZP_06880667.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          aeruginosa PAb1]
 gi|313107069|ref|ZP_07793270.1| Glu-tRNA(Gln) amidotransferase subunit C [Pseudomonas aeruginosa
          39016]
 gi|122257479|sp|Q02GV9|GATC_PSEAB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|166199390|sp|A6VBJ7|GATC_PSEA7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|226709620|sp|B7V022|GATC_PSEA8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|115587735|gb|ABJ13750.1| Glu-tRNA(Gln) amidotransferase subunit C [Pseudomonas aeruginosa
          UCBPP-PA14]
 gi|150962266|gb|ABR84291.1| Glu-tRNA(Gln) amidotransferase subunit C [Pseudomonas aeruginosa
          PA7]
 gi|218773802|emb|CAW29616.1| Glu-tRNA(Gln) amidotransferase subunit C [Pseudomonas aeruginosa
          LESB58]
 gi|310879772|gb|EFQ38366.1| Glu-tRNA(Gln) amidotransferase subunit C [Pseudomonas aeruginosa
          39016]
          Length = 95

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV++IAH +R+ + E D+P     LNN L +++++  V+  GVEP+   +    
Sbjct: 1  MALERSDVEKIAHLARLGLSEADLPRTTETLNNILGLIDQMQAVDTSGVEPLAHPLEATQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD V + D  ++  + AP VE+  ++VPK +E
Sbjct: 61 RLRPDAVTETDHRDAYQTIAPAVEEGLYLVPKVIE 95


>gi|307823385|ref|ZP_07653614.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylobacter
          tundripaludum SV96]
 gi|307735370|gb|EFO06218.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylobacter
          tundripaludum SV96]
          Length = 95

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 55/91 (60%), Gaps = 4/91 (4%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH--RP 64
          DVK+IAH +R+ I+E+D+  +   L+  L ++ ++S+++ +GVEPM    PM  V   R 
Sbjct: 7  DVKKIAHLARLGIEEQDVASYAKDLSGMLDLMTRMSDLDTDGVEPMAH--PMDQVQRLRA 64

Query: 65 DVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          D V + D  E   + AP VE   ++VPK +E
Sbjct: 65 DAVTEQDNREKFQAIAPQVEAGLYLVPKVIE 95


>gi|162219160|ref|YP_747802.2| aspartyl/glutamyl-tRNA amidotransferase subunit C [Nitrosomonas
          eutropha C91]
          Length = 95

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + D+KR+A  +RI I E D    L++L+   S++E++  V+ +G++PM     M  
Sbjct: 1  MTLSLSDIKRVAKLARIEISETDAQQSLIQLSGIFSLIEQMQAVDTQGIKPMSHSQDMTQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D+V + D+     S AP VE  +++VPK +E
Sbjct: 61 RLREDIVTESDQHIQFQSIAPQVEDGYYLVPKVIE 95


>gi|114308594|gb|ABI59837.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Nitrosomonas eutropha C91]
          Length = 110

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 55/95 (57%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M + + D+KR+A  +RI I E D    L++L+   S++E++  V+ +G++PM     M  
Sbjct: 16  MTLSLSDIKRVAKLARIEISETDAQQSLIQLSGIFSLIEQMQAVDTQGIKPMSHSQDMTQ 75

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R D+V + D+     S AP VE  +++VPK +E
Sbjct: 76  RLREDIVTESDQHIQFQSIAPQVEDGYYLVPKVIE 110


>gi|58040807|ref|YP_192771.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Gluconobacter
          oxydans 621H]
 gi|81556900|sp|Q5FND2|GATC_GLUOX RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|58003221|gb|AAW62115.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Gluconobacter
          oxydans 621H]
          Length = 95

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 54/95 (56%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V RIA  +RI ++ E+I      + + +  +E++ EV+V GV+PM+     K 
Sbjct: 1  MSLDAKTVTRIARLARIGLQPEEIETLGKDMGSIIDWVEQLKEVDVTGVDPMIGTGLAKP 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG+  + +LSNAP  E  F+ VPK VE
Sbjct: 61 RLREDRVTDGNCRDKVLSNAPEREGPFYTVPKVVE 95


>gi|154253282|ref|YP_001414106.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Parvibaculum
           lavamentivorans DS-1]
 gi|154157232|gb|ABS64449.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Parvibaculum
           lavamentivorans DS-1]
          Length = 124

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 54/95 (56%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M +D   V+ IA  +RI+++++++      LN  L  +E++ EV+  GVEPM S V + M
Sbjct: 30  MSVDQKTVRHIARLARIAVRDDELEALAKELNGILDWVEQLGEVDTSGVEPMTSAVAVAM 89

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R DVV   +    +  NAP  E  F+VVPK VE
Sbjct: 90  KMRDDVVEVQNLQAEVTRNAPGSEDGFYVVPKVVE 124


>gi|161611267|ref|YP_294301.2| aspartyl/glutamyl-tRNA amidotransferase subunit C [Ralstonia
          eutropha JMP134]
          Length = 99

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 54/99 (54%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVE----PMVSVV 56
          M +D+ DVKRIAH +RI   +E+    L +LNN  S++E++  V+  G+E    P+ +V 
Sbjct: 1  MALDLSDVKRIAHLARIETSDEEASQTLAQLNNFFSLVEQMQAVDTTGIEPLAHPLATVR 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           M    R D V + D  E     AP  +   ++VPK +E
Sbjct: 61 DMVQRLRDDAVTESDHREDYQRPAPATQNGLYLVPKVIE 99


>gi|72117194|gb|AAZ59457.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Ralstonia eutropha JMP134]
          Length = 108

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 54/99 (54%), Gaps = 4/99 (4%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVE----PMVSVV 56
           M +D+ DVKRIAH +RI   +E+    L +LNN  S++E++  V+  G+E    P+ +V 
Sbjct: 10  MALDLSDVKRIAHLARIETSDEEASQTLAQLNNFFSLVEQMQAVDTTGIEPLAHPLATVR 69

Query: 57  PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            M    R D V + D  E     AP  +   ++VPK +E
Sbjct: 70  DMVQRLRDDAVTESDHREDYQRPAPATQNGLYLVPKVIE 108


>gi|296284579|ref|ZP_06862577.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Citromicrobium
           bathyomarinum JL354]
          Length = 100

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 55/100 (55%), Gaps = 5/100 (5%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M I   +V +IA  +RI + + ++   +  LNN L  +E++ EV+   VEPM +V+P   
Sbjct: 1   MSITREEVAKIASLARIRMDDAELDRMVPELNNILGWVEQLGEVDTSSVEPMTAVIPQAT 60

Query: 61  VHRPDVV-----CDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R DVV       G + E +L+NAP  E  FF VPK +E
Sbjct: 61  RLRDDVVDADPLTAGGRREDVLANAPAAEHGFFGVPKVIE 100


>gi|34499811|ref|NP_904026.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Chromobacterium violaceum ATCC 12472]
 gi|39931348|sp|Q7NPY6|GATC_CHRVO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|34105661|gb|AAQ62015.1| Glu-tRNA(Gln) amidotransferase subunit C [Chromobacterium
          violaceum ATCC 12472]
          Length = 95

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 53/89 (59%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV RIA  +RI++ E +I     +LNN   ++EK+  V+  G+EPM     + +  R DV
Sbjct: 7  DVARIAKLARINVSEAEIAATADQLNNIFGLIEKMQAVDTAGIEPMAHPQDVSLRLRDDV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V + ++ E+  + AP VEK  F+VPK +E
Sbjct: 67 VTEPNRREAFQAVAPQVEKGLFLVPKVIE 95


>gi|157691434|ref|YP_001485896.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          pumilus SAFR-032]
 gi|194015828|ref|ZP_03054443.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus pumilus
          ATCC 7061]
 gi|166989683|sp|A8FAR9|GATC_BACP2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|157680192|gb|ABV61336.1| glutamyl-tRNA amidotransferase subunit C [Bacillus pumilus
          SAFR-032]
 gi|194012183|gb|EDW21750.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus pumilus
          ATCC 7061]
          Length = 96

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 56/89 (62%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I + +VK +AH +R++I EE+  +F  +L++ +S  E+++EV+ E VEP   V+ MK V 
Sbjct: 4  ISIEEVKHVAHLARLAITEEEAEMFTEQLDSIISFAEQLNEVDTENVEPTTHVLKMKNVM 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          R DV   G  +E+++ NAP  +  +  VP
Sbjct: 64 REDVPNKGLSIEAVIKNAPDHKDGYIRVP 92


>gi|78045230|ref|YP_359947.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Carboxydothermus
          hydrogenoformans Z-2901]
 gi|123576416|sp|Q3AD37|GATC_CARHZ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|77997345|gb|ABB16244.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Carboxydothermus
          hydrogenoformans Z-2901]
          Length = 94

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 56/94 (59%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I + DV+ +A  +R+ + +E+  ++  +LN+ L   E++ E++ E V+P   V+P+K 
Sbjct: 1  MTISLKDVEHVAMLARLKLSDEEKEMYTKQLNDILKYAEQLQELDTENVKPTAHVLPIKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R D V      E  L+NAP  E+NFF VPK +
Sbjct: 61 VFREDKVHQHLDPEKALANAPEREENFFKVPKII 94


>gi|121997795|ref|YP_001002582.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Halorhodospira
          halophila SL1]
 gi|166199149|sp|A1WVR8|GATC_HALHL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|121589200|gb|ABM61780.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Halorhodospira halophila SL1]
          Length = 95

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID  +V++IAH +RI I EE +  +   L   L+ +E++  V+ +GVEPM        
Sbjct: 1  MAIDADEVQQIAHLARIRIDEEAVSGYARDLTGILAFVEQMGNVDTDGVEPMAHPWDATQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD V + +  E   S AP VE   ++VP+ VE
Sbjct: 61 RLRPDEVTEPNLREHYQSGAPAVEAGLYLVPRVVE 95


>gi|224826066|ref|ZP_03699169.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lutiella
          nitroferrum 2002]
 gi|224601703|gb|EEG07883.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lutiella
          nitroferrum 2002]
          Length = 95

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 53/89 (59%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV RIA  +RI++ +E+I     +LNN   ++E++  V+ +G+EPM     + +  R DV
Sbjct: 7  DVARIAKLARIAVTDEEIVAVGAQLNNIFGLIEQMQAVDTDGIEPMAHPQDVSLRLRDDV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V + D+  +  + AP VE   F+VPK +E
Sbjct: 67 VTESDRRAAFQAIAPQVENGLFLVPKVIE 95


>gi|56551680|ref|YP_162519.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Zymomonas mobilis
          subsp. mobilis ZM4]
 gi|241761199|ref|ZP_04759287.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Zymomonas mobilis
          subsp. mobilis ATCC 10988]
 gi|260752738|ref|YP_003225631.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Zymomonas mobilis
          subsp. mobilis NCIMB 11163]
 gi|56543254|gb|AAV89408.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Zymomonas mobilis
          subsp. mobilis ZM4]
 gi|241374106|gb|EER63603.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Zymomonas mobilis
          subsp. mobilis ATCC 10988]
 gi|258552101|gb|ACV75047.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Zymomonas mobilis
          subsp. mobilis NCIMB 11163]
          Length = 96

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 52/88 (59%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V++IA  + I++ EE++   +  LN  L   E++S +N +GVEP+ SV+      R D V
Sbjct: 9  VRKIAKLASIAVTEEEVTAMVPELNAILGWGEQLSAINTDGVEPLTSVIAQSQRLREDEV 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
             D  +++++NAP  E  FF VPK +E
Sbjct: 69 TVPDIRDALMANAPEAEHGFFTVPKVIE 96


>gi|229588406|ref|YP_002870525.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          fluorescens SBW25]
 gi|259647255|sp|C3K6Y5|GATC_PSEFS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|229360272|emb|CAY47129.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Pseudomonas
          fluorescens SBW25]
          Length = 95

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV++IAH + + + E+D+P     LN+ L +++++  VN +G+EP+   +    
Sbjct: 1  MTLERSDVEKIAHLASLGLNEDDLPQTTAALNSILGLVDQMQAVNTDGIEPLAHPLEASQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV + +  E+  S AP VE   ++VPK ++
Sbjct: 61 RLRADVVTESNNREAYQSIAPAVENGLYLVPKVID 95


>gi|188590847|ref|YP_001795447.1| aspartyl/glutamyl-tRNA amidotransferase subunit c [Cupriavidus
          taiwanensis LMG 19424]
 gi|229487468|sp|B2AG26|GATC_CUPTR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|170937741|emb|CAP62725.1| Glutamyl-tRNA(Gln) amidotransferase subunit C (Glu-ADT subunit C)
          [Cupriavidus taiwanensis LMG 19424]
          Length = 99

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 54/99 (54%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMV----SVV 56
          M +D+ DVKRIAH +RI   +++    L +LNN  S++E++  V+  G+EP      +V 
Sbjct: 1  MALDLSDVKRIAHLARIETSDDEAAQTLAQLNNFFSLVEQMQAVDTTGIEPQAHPLSAVR 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           M    R DVV + D+       AP  E   ++VPK +E
Sbjct: 61 DMVQRLREDVVTETDRRADYQRPAPATENGLYLVPKVIE 99


>gi|117923993|ref|YP_864610.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Magnetococcus sp. MC-1]
 gi|166199153|sp|A0L5G1|GATC_MAGSM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|117607749|gb|ABK43204.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Magnetococcus sp. MC-1]
          Length = 95

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 56/88 (63%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+ +A+ +R+   EE+   F  +++  + +++ +S++  EGV+PM   V M +  R DVV
Sbjct: 8  VQHVANLARLQFNEEETERFSGQISRIVDLMDALSKLPTEGVKPMSHAVDMAIPQRDDVV 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +G++ +++L+NAP  EK  F VPK +E
Sbjct: 68 TNGNQRDTMLANAPDAEKGHFRVPKVIE 95


>gi|187930754|ref|YP_001901241.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Ralstonia
          pickettii 12J]
 gi|241664944|ref|YP_002983304.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Ralstonia
          pickettii 12D]
 gi|309780250|ref|ZP_07675001.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Ralstonia sp.
          5_7_47FAA]
 gi|229487534|sp|B2U7V6|GATC_RALPJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|187727644|gb|ACD28809.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Ralstonia
          pickettii 12J]
 gi|240866971|gb|ACS64632.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Ralstonia
          pickettii 12D]
 gi|308920953|gb|EFP66599.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Ralstonia sp.
          5_7_47FAA]
          Length = 99

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 54/101 (53%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +++ DVKRIAH +RI + E +    L +LN   S++E++  V+  G+EPM    P++ 
Sbjct: 1  MALELSDVKRIAHLARIEVSEGEAAQTLTQLNQFFSLVEQMQAVDTTGIEPMAH--PIEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V       R D V + D+       AP  E   ++VPK +E
Sbjct: 59 VQAQAQRLRDDAVTEADRRADYQQCAPATEAGLYLVPKVIE 99


>gi|163792875|ref|ZP_02186851.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [alpha
          proteobacterium BAL199]
 gi|159181521|gb|EDP66033.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [alpha
          proteobacterium BAL199]
          Length = 95

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V  IA  +R+ + E+ +   +  LN  L  +E++++V+ +GVEP+ SV    +
Sbjct: 1  MSLDKATVASIATLARLRVPEDRLEPMVADLNAILGFVEQLNQVDTDGVEPLASVTGHSL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG   + + +NAP     F+ VPK VE
Sbjct: 61 PQREDAVTDGGYPDRVTANAPDGGNGFYAVPKVVE 95


>gi|16077735|ref|NP_388549.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          subtilis subsp. subtilis str. 168]
 gi|221308504|ref|ZP_03590351.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          subtilis subsp. subtilis str. 168]
 gi|221312827|ref|ZP_03594632.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          subtilis subsp. subtilis str. NCIB 3610]
 gi|221317751|ref|ZP_03599045.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          subtilis subsp. subtilis str. JH642]
 gi|221322030|ref|ZP_03603324.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          subtilis subsp. subtilis str. SMY]
 gi|296330126|ref|ZP_06872608.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          subtilis subsp. spizizenii ATCC 6633]
 gi|305673370|ref|YP_003865042.1| glutamyl-tRNA amidotransferase subunit C [Bacillus subtilis
          subsp. spizizenii str. W23]
 gi|321314396|ref|YP_004206683.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          subtilis BSn5]
 gi|6225422|sp|O06492|GATC_BACSU RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|2114425|gb|AAB66514.1| similar to Synechocystis sp. hypothetical protein, encoded by
          GenBank Accession Number D64006 [Bacillus subtilis
          subsp. subtilis str. JH642]
 gi|2589194|gb|AAB83963.1| Glu-tRNAGln amidotransferase subunit C [Bacillus subtilis subsp.
          subtilis str. 168]
 gi|2632981|emb|CAB12487.1| glutamyl-tRNA(Gln) amidotransferase (subunit C) [Bacillus
          subtilis subsp. subtilis str. 168]
 gi|291483109|dbj|BAI84184.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          subtilis subsp. natto BEST195]
 gi|296152715|gb|EFG93582.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          subtilis subsp. spizizenii ATCC 6633]
 gi|305411614|gb|ADM36733.1| glutamyl-tRNA amidotransferase subunit C [Bacillus subtilis
          subsp. spizizenii str. W23]
 gi|320020670|gb|ADV95656.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          subtilis BSn5]
          Length = 96

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 54/89 (60%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I + +VK +AH +R++I EE+  +F  +L++ +S  E+++EVN + VEP   V+ MK V 
Sbjct: 4  ISIEEVKHVAHLARLAITEEEAKMFTEQLDSIISFAEELNEVNTDNVEPTTHVLKMKNVM 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          R D    G  VE ++ NAP  +  +  VP
Sbjct: 64 REDEAGKGLPVEDVMKNAPDHKDGYIRVP 92


>gi|2465557|gb|AAB72183.1| YedA [Bacillus subtilis]
          Length = 101

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 54/89 (60%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I + +VK +AH +R++I EE+  +F  +L++ +S  E+++EVN + VEP   V+ MK V 
Sbjct: 9  ISIEEVKHVAHLARLAITEEEAKMFTEQLDSIISFAEELNEVNTDNVEPTTHVLKMKNVM 68

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          R D    G  VE ++ NAP  +  +  VP
Sbjct: 69 REDEAGKGLPVEDVMKNAPDHKDGYIRVP 97


>gi|264676414|ref|YP_003276320.1| GatC, Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit
          [Comamonas testosteroni CNB-2]
 gi|299533740|ref|ZP_07047112.1| GatC, Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit
          [Comamonas testosteroni S44]
 gi|262206926|gb|ACY31024.1| GatC, Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit
          [Comamonas testosteroni CNB-2]
 gi|298718289|gb|EFI59274.1| GatC, Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit
          [Comamonas testosteroni S44]
          Length = 99

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 59/99 (59%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM----VSVV 56
          M ++  D+ RIA+ +R+ + +++    L +LNN   ++EK+  V+  GV P+     ++ 
Sbjct: 1  MALNDQDIARIANLARLELSQDESKRMLAQLNNFFGIVEKMQAVDTSGVSPLSHPVAAIQ 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + +  R D+V +G+  ++ + NAP  EK +F+VPK +E
Sbjct: 61 DVALRLRDDLVSEGNNRDANMQNAPAAEKGYFLVPKVIE 99


>gi|86609663|ref|YP_478425.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Synechococcus
          sp. JA-2-3B'a(2-13)]
 gi|123501453|sp|Q2JJK5|GATC_SYNJB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|86558205|gb|ABD03162.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Synechococcus sp.
          JA-2-3B'a(2-13)]
          Length = 97

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 55/89 (61%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ +AH +R+ + EE+   F  +L + L+ +E++ E++ EGVEP   V+ M++  RPD 
Sbjct: 6  EVQHVAHLARLELTEEEEIQFTEQLTDILAYVEQLKELDTEGVEPTFHVLDMELPTRPDE 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V     +E IL+NAP     FF VP+ +E
Sbjct: 66 VEPYPDIEGILANAPDRADMFFKVPRILE 94


>gi|30250011|ref|NP_842081.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Nitrosomonas
          europaea ATCC 19718]
 gi|39931492|sp|Q82T57|GATC_NITEU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|30139118|emb|CAD85982.1| Glu-tRNAGln amidotransferase C subunit [Nitrosomonas europaea
          ATCC 19718]
          Length = 95

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 54/95 (56%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + D+KR+A  +RI I E D    L+RL+    ++E++  V+ +G++PM     M  
Sbjct: 1  MTLSLNDIKRVAKLARIEISETDAQQNLVRLSGIFDLIEQMRAVDTQGIKPMSHSQDMVQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D+V + D+     S AP +E  +++VPK +E
Sbjct: 61 RLREDIVTESDQRTLFQSVAPQIEDGYYLVPKVIE 95


>gi|326388344|ref|ZP_08209940.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207076|gb|EGD57897.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Novosphingobium nitrogenifigens DSM 19370]
          Length = 93

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 5/91 (5%)

Query: 10 RIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV-- 67
          +IA  +R+ + + ++   +  LN  L+ +E++ EV+V G+EPM +V+P  +  R DVV  
Sbjct: 3  KIASLARLKVTDAELEAMVPELNGILAWVEQLGEVDVTGIEPMTAVIPNTLRLRDDVVNA 62

Query: 68 ---CDGDKVESILSNAPHVEKNFFVVPKAVE 95
               GD  + +L+NAP  E  FF VPK +E
Sbjct: 63 DPLTGGDIRDKVLANAPVAEHGFFGVPKVIE 93


>gi|113866143|ref|YP_724632.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Ralstonia
          eutropha H16]
 gi|122947218|sp|Q0KFF7|GATC_RALEH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|113524919|emb|CAJ91264.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Ralstonia eutropha
          H16]
          Length = 99

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 55/99 (55%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMV----SVV 56
          M + + DVKRIAH +RI I +++    L +LNN  S++E++  V+  G+EP+     +V 
Sbjct: 1  MALALSDVKRIAHLARIEISDDEAAQTLAQLNNFFSLVEQMQAVDTSGIEPLAHPLSAVR 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           M    R DVV + D+       AP  E   ++VPK +E
Sbjct: 61 DMVQRLREDVVTESDRRADYQRPAPATEDGLYLVPKVIE 99


>gi|91776840|ref|YP_546596.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Methylobacillus flagellatus KT]
 gi|122399417|sp|Q1GYD2|GATC_METFK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|91710827|gb|ABE50755.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Methylobacillus flagellatus KT]
          Length = 95

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 57/95 (60%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DVKRIAH +RI++ EE+    L++L+  L ++E++  V+  G+ PM     +  
Sbjct: 1  MSLNTHDVKRIAHLARIAVSEEEAEATLVKLSGILGLIEEMQAVDTSGIVPMSHSQDVTQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV + ++ + + S AP VE   ++VPK +E
Sbjct: 61 RLREDVVTESNQRDLLQSIAPAVENGLYLVPKVIE 95


>gi|291533230|emb|CBL06343.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Megamonas hypermegale ART12/1]
          Length = 96

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (60%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ +A  SR+SIK+ED+   +  LN+ L  ++++ +V+ E V P   V+P++ V R DV
Sbjct: 7  DVENVALLSRLSIKDEDMDKNISELNDFLEYVDRLQQVDTENVAPTAHVLPVQNVFREDV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V      E  LSNAP  E  +F VPK +E
Sbjct: 67 VKPSLDRELALSNAPQQEDGYFRVPKILE 95


>gi|242279036|ref|YP_002991165.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfovibrio
          salexigens DSM 2638]
 gi|242121930|gb|ACS79626.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfovibrio
          salexigens DSM 2638]
          Length = 97

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 54/92 (58%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          +++ +V R+A  +R+ + EE   LF  +LNN L+ ++K++E++   VEPM S V      
Sbjct: 6  LNLEEVARVARLARLDLSEEKTELFAGQLNNILTYMDKLNEIDTSEVEPMFSPVEHTTRL 65

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          R D V      E +LSNAP  +  +FVVP+ V
Sbjct: 66 RKDEVKKEHTREEVLSNAPDSDGKYFVVPRIV 97


>gi|89093933|ref|ZP_01166878.1| Glu-tRNA(Gln) amidotransferase subunit C [Oceanospirillum sp.
          MED92]
 gi|89081819|gb|EAR61046.1| Glu-tRNA(Gln) amidotransferase subunit C [Oceanospirillum sp.
          MED92]
          Length = 95

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 56/97 (57%), Gaps = 4/97 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D  DV +IAH +R+ I+E+D P +   L+N L +++++  V+   V PM    P+  
Sbjct: 1  MSLDRSDVDKIAHLARLQIEEQDTPEYAQNLSNILDLVDQMQAVDTSDVLPMAH--PLDA 58

Query: 61 VHR--PDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R   D V + +  E++ + AP VEK  F VPK +E
Sbjct: 59 VQRLRSDEVTEANNREALQAVAPQVEKGLFQVPKVIE 95


>gi|330501857|ref|YP_004378726.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          mendocina NK-01]
 gi|328916143|gb|AEB56974.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          mendocina NK-01]
          Length = 95

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  +V++IAH +R+ + E DIP     LNN L +++++  V+ +G+EP+   +    
Sbjct: 1  MALERSEVEKIAHLARLGLNEGDIPQTTETLNNILGLIDQMQAVDTQGIEPLAHPLEATQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV + +  ++  + AP VE   ++VPK +E
Sbjct: 61 RLRADVVNESNHRDAYQAIAPAVESGLYLVPKVIE 95


>gi|229577465|ref|YP_001171553.2| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          stutzeri A1501]
 gi|327479578|gb|AEA82888.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          stutzeri DSM 4166]
          Length = 95

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 57/95 (60%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  +V++IAH +R+ + E D+P     LNN L +++++  V+  G+EP+   +    
Sbjct: 1  MALERTEVEKIAHLARLGLSEADLPRTTETLNNILGLIDRMQAVDTTGIEPLAHPLETTQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV + ++ ++  + AP VE+  ++VP+ +E
Sbjct: 61 RLRADVVTERNQRDAYQAIAPAVEEGLYLVPRVIE 95


>gi|158520169|ref|YP_001528039.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfococcus
          oleovorans Hxd3]
 gi|229487470|sp|A8ZSP9|GATC_DESOH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|158508995|gb|ABW65962.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfococcus
          oleovorans Hxd3]
          Length = 95

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 49/89 (55%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          D++ +A  +R+ I E DI  F+ ++   L  ++ +++V  E VEPM   + +    R D 
Sbjct: 7  DIRHVAKLARLDIAETDINAFVSQIGEILDYVDTLNQVATENVEPMAHAISLTNAFREDT 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V +   VE IL+NAP    N F VPK +E
Sbjct: 67 VREAGPVEKILNNAPAAADNMFCVPKIIE 95


>gi|312958977|ref|ZP_07773496.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Pseudomonas fluorescens WH6]
 gi|311286747|gb|EFQ65309.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Pseudomonas fluorescens WH6]
          Length = 95

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV++IAH + + + E D+P     LN+ L +++++  VN +G+EP+   +    
Sbjct: 1  MALERSDVEKIAHLASLGLNEADLPQTTAALNSILGLVDQMQAVNTDGIEPLAHPLEASQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV + +  E+  S AP VE   ++VPK ++
Sbjct: 61 RLRADVVTERNNREAYQSIAPAVENGLYLVPKVID 95


>gi|221069478|ref|ZP_03545583.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Comamonas
          testosteroni KF-1]
 gi|220714501|gb|EED69869.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Comamonas
          testosteroni KF-1]
          Length = 99

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 59/99 (59%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM----VSVV 56
          M ++  D+ RIA+ +R+ + +++    L +LNN   ++EK+  V+  GV P+     ++ 
Sbjct: 1  MALNDQDIARIANLARLELSQDESERMLAQLNNFFGIVEKMQAVDTSGVSPLSHPVAAIQ 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + +  R D+V +G+  ++ + NAP  EK +F+VPK +E
Sbjct: 61 DVALRLRDDLVREGNNRDANMQNAPAAEKGYFLVPKVIE 99


>gi|145569605|gb|ABP78711.1| Glu-tRNA(Gln) amidotransferase subunit C [Pseudomonas stutzeri
           A1501]
          Length = 123

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 57/95 (60%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M ++  +V++IAH +R+ + E D+P     LNN L +++++  V+  G+EP+   +    
Sbjct: 29  MALERTEVEKIAHLARLGLSEADLPRTTETLNNILGLIDRMQAVDTTGIEPLAHPLETTQ 88

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R DVV + ++ ++  + AP VE+  ++VP+ +E
Sbjct: 89  RLRADVVTERNQRDAYQAIAPAVEEGLYLVPRVIE 123


>gi|226943392|ref|YP_002798465.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Azotobacter
          vinelandii DJ]
 gi|259647243|sp|C1DQ38|GATC_AZOVD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|226718319|gb|ACO77490.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Azotobacter
          vinelandii DJ]
          Length = 95

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV++IAH +R+ + + +IP     LN+ L +++++  V+  G+EP+   +    
Sbjct: 1  MALERSDVEKIAHLARLGLDDAEIPRTTQTLNDILGLIDRMQAVDTHGIEPLAHPLEATQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD V + D  ++  + AP VE   ++VPK +E
Sbjct: 61 RLRPDEVTETDHRDAYQAIAPAVENGLYLVPKVIE 95


>gi|146305890|ref|YP_001186355.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          mendocina ymp]
 gi|166199712|sp|A4XQK7|GATC_PSEMY RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|145574091|gb|ABP83623.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Pseudomonas mendocina ymp]
          Length = 95

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 57/95 (60%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  +V++IAH +R+ + E DIP     LN+ L +++++  V+ +G+EP+   +    
Sbjct: 1  MALERSEVEKIAHLARLGLNESDIPQTTETLNSILGLIDQMQAVDTQGIEPLAHPLEATQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV + ++ ++  + AP VE   ++VPK +E
Sbjct: 61 RLRADVVSEHNQRDAYQAIAPAVESGLYLVPKVIE 95


>gi|299068367|emb|CBJ39591.1| Glutamyl-tRNA(Gln) amidotransferase subunit C (Glu-ADT subunit C)
          [Ralstonia solanacearum CMR15]
          Length = 99

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 54/101 (53%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +++ DVKRIAH +RI + + +    L +LN   +++E++  V+  G+EPM    P++ 
Sbjct: 1  MALELSDVKRIAHLARIEVSDGEAAQTLTQLNQFFTLVEQMQAVDTTGIEPMAH--PIEQ 58

Query: 61 VHRP------DVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V  P      D V + D+       AP  E   ++VPK +E
Sbjct: 59 VQAPAQRLREDAVTEADRRADYQQCAPSTEAGLYLVPKVIE 99


>gi|15613228|ref|NP_241531.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          halodurans C-125]
 gi|18203182|sp|Q9KF29|GATC_BACHD RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|10173279|dbj|BAB04384.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Bacillus
          halodurans C-125]
          Length = 96

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 53/93 (56%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I +  VK +AH +R++I EE+  LF  +L + +   E+++E++ EGVEP   V+ MK V 
Sbjct: 4  ISMEQVKHVAHLARLAITEEEAKLFTEQLGDIIQFAEQLNELDTEGVEPTSHVLDMKNVL 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          R D    G  VE +L NAP  E     VP  +E
Sbjct: 64 REDKPEKGLPVEDVLKNAPDHEDGQIRVPSVLE 96


>gi|71905759|ref|YP_283346.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Dechloromonas aromatica RCB]
 gi|123628422|sp|Q47JV5|GATC_DECAR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|71845380|gb|AAZ44876.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Dechloromonas aromatica RCB]
          Length = 95

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + +  VKRIAH +RI I +++       LN    ++E++  V+  G+EPM     +  
Sbjct: 1  MSLTLEQVKRIAHLARIEISDDEALTTQGHLNGIFQLIEQMQAVDTTGIEPMAHAQDVSQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V +GD+  +  + AP +E   ++VPK +E
Sbjct: 61 RLREDAVSEGDRRAAYQAVAPEIEAGLYLVPKVIE 95


>gi|83748646|ref|ZP_00945664.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Ralstonia solanacearum UW551]
 gi|207727546|ref|YP_002255940.1| glutamyl-trna(gln) amidotransferase subunit c (glu-adtsubunit c)
          protein [Ralstonia solanacearum MolK2]
 gi|207741937|ref|YP_002258329.1| glutamyl-trna(gln) amidotransferase subunit c (glu-adtsubunit c)
          protein [Ralstonia solanacearum IPO1609]
 gi|300705538|ref|YP_003747141.1| glutamyl-tRNA(gln) amidotransferase subunit C [Ralstonia
          solanacearum CFBP2957]
 gi|83724690|gb|EAP71850.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Ralstonia solanacearum UW551]
 gi|206590783|emb|CAQ56395.1| glutamyl-trna(gln) amidotransferase subunit c (glu-adtsubunit c)
          protein [Ralstonia solanacearum MolK2]
 gi|206593323|emb|CAQ60250.1| glutamyl-trna(gln) amidotransferase subunit c (glu-adtsubunit c)
          protein [Ralstonia solanacearum IPO1609]
 gi|299073202|emb|CBJ44560.1| Glutamyl-tRNA(Gln) amidotransferase subunit C (Glu-ADT subunit C)
          [Ralstonia solanacearum CFBP2957]
          Length = 99

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 54/101 (53%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +++ DVKRIAH +RI + + +    L +LN   +++E++  V+  G+EPM    P++ 
Sbjct: 1  MALELSDVKRIAHLARIEVSDAEAAQTLTQLNQFFTLVEQMQAVDTAGIEPMAH--PIEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V       R D V + D+       AP  E   ++VPK +E
Sbjct: 59 VQAQAQRLREDAVTESDRRADYQQCAPATEAGLYLVPKVIE 99


>gi|304320048|ref|YP_003853691.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Parvularcula
          bermudensis HTCC2503]
 gi|303298951|gb|ADM08550.1| glutamyl-tRNA(Gln) amidotransferase subunit C, putative
          [Parvularcula bermudensis HTCC2503]
          Length = 99

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 56/99 (56%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   V ++A  +RI + + D+      L+  L  +E++ EV+VEGV+ M S V   +
Sbjct: 1  MSIDEQTVVKVAKLARIKLDDRDVGPMTQELSAILDWIEQLGEVDVEGVDAMASTVAKSL 60

Query: 61 VHRPDVVC----DGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DV+      G + + I++NAP  + +FFVVPK VE
Sbjct: 61 PMREDVLATDQTGGGRPDEIVANAPKTDDHFFVVPKVVE 99


>gi|284040285|ref|YP_003390215.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Spirosoma linguale
          DSM 74]
 gi|283819578|gb|ADB41416.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Spirosoma
          linguale DSM 74]
          Length = 95

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 54/95 (56%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   + +IAH +R+ +K ++    L  LN  L+ +E+++EV+  GVEP+  +     
Sbjct: 1  MKVDHETLHKIAHLARLEVKPDEEAALLNSLNGVLTWMEQLNEVDTTGVEPLTHMSAETN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R DV  +    E  LSNAP  ++ FF VPK +E
Sbjct: 61 VLREDVAGNHLPREQALSNAPQHDEQFFEVPKVLE 95


>gi|254456236|ref|ZP_05069665.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Candidatus
          Pelagibacter sp. HTCC7211]
 gi|207083238|gb|EDZ60664.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Candidatus
          Pelagibacter sp. HTCC7211]
          Length = 95

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 53/95 (55%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID+  +K I+  SRIS+ E+        LN+    +EK++E+  + VEP+ SV    +
Sbjct: 1  MTIDLKTIKHISKLSRISVDEQKAEKLAGDLNSIFEFIEKLNELKTDNVEPLTSVAETTL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D +   +  E I+ N+P   ++FFVVPK VE
Sbjct: 61 KFRSDEIKSENIREQIIKNSPEDNEDFFVVPKVVE 95


>gi|160878795|ref|YP_001557763.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          phytofermentans ISDg]
 gi|189045161|sp|A9KJ25|GATC_CLOPH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|160427461|gb|ABX41024.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          phytofermentans ISDg]
          Length = 95

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 3  IDVVD--VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          +D+ D  ++ ++  +++S++ E+       L N L  ++K+ E+N +G+EPM  V+PMK 
Sbjct: 1  MDITDQTIEYVSTLAKLSLQPEEKEKAKKDLGNILGYIDKMKELNTDGIEPMSHVLPMKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R DVV + +  E +L NAP      F+VPK V+
Sbjct: 61 VFREDVVTNEENREELLKNAPKQMDGCFMVPKTVD 95


>gi|222053488|ref|YP_002535850.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Geobacter sp.
          FRC-32]
 gi|254790998|sp|B9LZ17|GATC_GEOSF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|221562777|gb|ACM18749.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Geobacter sp.
          FRC-32]
          Length = 95

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 59/95 (62%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I+  +V+++A  +R+ +  E+  +F  +++  L+ ++K++E+N +G+ P    VPM+ 
Sbjct: 1  MKINKDEVEKVALLARLELTGEEAEMFTGQMDAILAYVDKLNELNTDGIVPTAHAVPMEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V D   +++ L+NAP   ++FF VPK +E
Sbjct: 61 AFRADEVRDSIGIDNALANAPKRAESFFRVPKVIE 95


>gi|86606019|ref|YP_474782.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Synechococcus
          sp. JA-3-3Ab]
 gi|123506568|sp|Q2JUT8|GATC_SYNJA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|86554561|gb|ABC99519.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Synechococcus sp.
          JA-3-3Ab]
          Length = 97

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 54/89 (60%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ +AH +R+ + EE+   F  +L + L+ +E++ E++ EGVEP   V+  ++  RPD 
Sbjct: 6  EVQHVAHLARLELTEEEEIQFTEQLADILAYVEQLKELDTEGVEPTFHVLDAELPTRPDQ 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V     +E IL+NAP     FF VP+ +E
Sbjct: 66 VEPYPNIEGILANAPDRADMFFKVPRILE 94


>gi|94501800|ref|ZP_01308313.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Oceanobacter
          sp. RED65]
 gi|94426108|gb|EAT11103.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Oceanobacter
          sp. RED65]
          Length = 95

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D  DVK IA+ +R+++ ++ I  +   L+N L ++E+++ V+   V+P+        
Sbjct: 1  MALDSKDVKNIANLARLALDDQQIEQYRTDLSNILDLVEQMNAVDTGDVQPLAHPTDAVQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV + ++ E  ++NAP  E+  F+VPK VE
Sbjct: 61 RLRADVVTESNQREKYMANAPAQEQGLFLVPKVVE 95


>gi|291612607|ref|YP_003522764.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sideroxydans
          lithotrophicus ES-1]
 gi|291582719|gb|ADE10377.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sideroxydans
          lithotrophicus ES-1]
          Length = 95

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV+++A  +R+++ E++I     +LNN   ++ ++  V+ +GVEPM     +  
Sbjct: 1  MSLSLADVEKVARLARLAMNEQEILAAQAQLNNIFGLIAEMQAVDTKGVEPMSHSQDLAQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV + D+  +  + AP VE+  ++VP+ +E
Sbjct: 61 RLREDVVTEADQRAAFQAVAPQVEQGLYLVPQVIE 95


>gi|110596943|ref|ZP_01385233.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Chlorobium
          ferrooxidans DSM 13031]
 gi|110341630|gb|EAT60090.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Chlorobium
          ferrooxidans DSM 13031]
          Length = 95

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 51/94 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DV  IA  +R+   EE+  +    LNN L  +EK++EV+ EGVEP+ S+     
Sbjct: 1  MSVTSKDVAYIADLARLRFNEEETIVMTSELNNILHYIEKLNEVDTEGVEPLSSIHDQIN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R DV       E+IL NAP  +  FF VPK +
Sbjct: 61 VLREDVELQPLSSEAILKNAPQRQDRFFKVPKVI 94


>gi|254000233|ref|YP_003052296.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Methylovorus
          sp. SIP3-4]
 gi|313202200|ref|YP_004040858.1| glutamyl-tRNA(gln) amidotransferase subunit C [Methylovorus sp.
          MP688]
 gi|253986912|gb|ACT51769.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylovorus sp.
          SIP3-4]
 gi|312441516|gb|ADQ85622.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylovorus sp.
          MP688]
          Length = 95

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 53/95 (55%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DVKRIAH +RI + +++    L +L+  L ++E++  V+  G+ PM     +  
Sbjct: 1  MSLSSSDVKRIAHLARIEVSDQEAEATLQKLSGILGLIEQMQAVDTTGIVPMSHSQDVVQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPDVV + D   +  + AP VE   ++VPK +E
Sbjct: 61 RLRPDVVTETDHRAAFQAIAPAVENGLYLVPKVIE 95


>gi|292490699|ref|YP_003526138.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Nitrosococcus
          halophilus Nc4]
 gi|291579294|gb|ADE13751.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Nitrosococcus
          halophilus Nc4]
          Length = 95

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 58/97 (59%), Gaps = 4/97 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   D++ IAH +R++I  E +P ++  L+  L  +E++++V+  G+EPM    P++ 
Sbjct: 1  MALKTTDIEYIAHLARLAIDAEAVPHYVRDLSRILEFVEQMNKVDTTGIEPMAH--PLEA 58

Query: 61 VH--RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +   RPD V + D+ E   + AP +E   ++VPK ++
Sbjct: 59 IQRLRPDEVTEIDQREIFQATAPQIEAGVYLVPKVID 95


>gi|255532472|ref|YP_003092844.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Pedobacter
          heparinus DSM 2366]
 gi|255345456|gb|ACU04782.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Pedobacter
          heparinus DSM 2366]
          Length = 96

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 58/95 (61%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M+ID   + ++A  +RI++KEE+I   +  +N  L+ +EK++E++ +GVEP+V +   + 
Sbjct: 1  MIIDKQTIYKVADLARIAVKEEEIEALIPDMNKILTFMEKLNELDTQGVEPLVYMNMEEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V     V   L NA    ++FF+VPK +E
Sbjct: 61 VWREDKVKQEISVADGLKNAARHNESFFLVPKIIE 95


>gi|170723444|ref|YP_001751132.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          putida W619]
 gi|229487533|sp|B1JDP0|GATC_PSEPW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|169761447|gb|ACA74763.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Pseudomonas
          putida W619]
          Length = 95

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV++IAH +R+ + E ++P     LN+ L +++++  V+  G+EP+   +    
Sbjct: 1  MALERCDVEKIAHLARLGLNEGELPRITDALNSILGLVDQMQAVDTTGIEPLAHPLEASQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD V + ++ ++  + AP  E   ++VPK +E
Sbjct: 61 RLRPDQVTESNQRDAYQAIAPKTESGLYLVPKVIE 95


>gi|121533513|ref|ZP_01665341.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thermosinus
          carboxydivorans Nor1]
 gi|121308072|gb|EAX48986.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thermosinus
          carboxydivorans Nor1]
          Length = 96

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   DV+++A  SR+ I +++   F  +LN  L  ++ +++V+ EG+EP   V+P+K 
Sbjct: 1  MKISRKDVEQVALLSRLEISDQEAERFTQQLNAILEYMDVLNKVDTEGIEPTAHVLPLKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V         LSNAP  E+ +F VPK +E
Sbjct: 61 VLREDRVQPSLDRRLALSNAPEEEEGYFKVPKILE 95


>gi|311067142|ref|YP_003972065.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          atrophaeus 1942]
 gi|310867659|gb|ADP31134.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          atrophaeus 1942]
          Length = 96

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 54/89 (60%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I + +VK +AH +R++I +E+  +F  +L++ +S  E+++EV+ + VEP   V+ MK V 
Sbjct: 4  ISIEEVKHVAHLARLAITDEEAEMFTEQLDSIISFAEELNEVDTDNVEPTTHVLQMKNVM 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          R D    G  VE ++ NAP  +  +  VP
Sbjct: 64 REDEAGKGLPVEDVMKNAPDHKDGYIRVP 92


>gi|330807534|ref|YP_004351996.1| Amidase, (glutamyl-tRNA(Gln) amidotransferase), subunit C
          [Pseudomonas brassicacearum subsp. brassicacearum
          NFM421]
 gi|327375642|gb|AEA66992.1| Amidase, (glutamyl-tRNA(Gln) amidotransferase), subunit C
          [Pseudomonas brassicacearum subsp. brassicacearum
          NFM421]
          Length = 95

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV++IAH + + + E D+P     LN+ L +++++  VN +G+EP+   +    
Sbjct: 1  MALERSDVEKIAHLACLGLNEADLPHITSALNSILGLVDEMQAVNTDGIEPLAHPLEASQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV + +  E+  S AP VE   ++VPK ++
Sbjct: 61 RLRADVVTESNHREAYQSIAPAVENGLYLVPKVID 95


>gi|77457064|ref|YP_346569.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          fluorescens Pf0-1]
 gi|123605966|sp|Q3KI26|GATC_PSEPF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|77381067|gb|ABA72580.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Pseudomonas
          fluorescens Pf0-1]
          Length = 95

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV++IAH + + + + D+P     LN+ L +++++  VN +G+EP+   +    
Sbjct: 1  MALERSDVEKIAHLASLGLNDADLPHITSALNSILGLVDEMQAVNTDGIEPLAHPLEASQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV + +  E+  S AP VE   ++VPK ++
Sbjct: 61 RLRADVVTESNNREAYQSIAPAVENGLYLVPKVID 95


>gi|17544777|ref|NP_518179.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Ralstonia
          solanacearum GMI1000]
 gi|20138218|sp|Q8Y3C2|GATC_RALSO RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|17427066|emb|CAD13586.1| probable glutamyl-trna(gln) amidotransferase subunit c
          (glu-adtsubunit c) protein [Ralstonia solanacearum
          GMI1000]
          Length = 99

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 54/101 (53%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +++ DVKRIAH +RI + + +    L +LN   +++E++  V+  G+EPM    P++ 
Sbjct: 1  MALELSDVKRIAHLARIEVSDGEAAQTLTQLNQFFTLVEQMQAVDTTGIEPMAH--PIEQ 58

Query: 61 VHRP------DVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V  P      D V + D+       AP  E   ++VPK +E
Sbjct: 59 VQAPAQRLREDAVTEPDRRADYQQCAPSTEAGLYLVPKVIE 99


>gi|196231387|ref|ZP_03130246.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Chthoniobacter
           flavus Ellin428]
 gi|196224723|gb|EDY19234.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Chthoniobacter
           flavus Ellin428]
          Length = 107

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           DV+  A  +R+++ EE+   F  +L+  L+ +EK+ +V+V GVEP      +  V R DV
Sbjct: 19  DVRYTAQLARLNLSEEETAKFQAQLSQVLAYVEKLEKVDVTGVEPTAHANAVFNVFRQDV 78

Query: 67  VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             D    E  LSNAP      FVVPK +E
Sbjct: 79  PRDWFTPEQALSNAPRSANQLFVVPKVIE 107


>gi|300692932|ref|YP_003753927.1| glutamyl-tRNA(Gln) amidotransferase subunit C (glu-ADT subunit C)
          [Ralstonia solanacearum PSI07]
 gi|299079992|emb|CBJ52668.1| Glutamyl-tRNA(Gln) amidotransferase subunit C (Glu-ADT subunit C)
          [Ralstonia solanacearum PSI07]
          Length = 99

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 54/101 (53%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +++ DVKRIAH +RI + + +    L +LN   +++E++  V+  G+EPM    P++ 
Sbjct: 1  MALELSDVKRIAHLARIEVSDAEAAQTLTQLNQFFTLVEQMQAVDTAGIEPMAH--PIEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V       R D V + D+       AP  E   ++VPK +E
Sbjct: 59 VQAQAQRLREDAVTEPDRRADYQQCAPATEAGLYLVPKVIE 99


>gi|88799724|ref|ZP_01115298.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Reinekea sp.
          MED297]
 gi|88777458|gb|EAR08659.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Reinekea sp.
          MED297]
          Length = 95

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+ +A  +R+ ++++++  ++  LN+ L + +++  V+ EGVEP+ + +    
Sbjct: 1  MSLDRSQVETVAKLARLKVEDQELDNYVNSLNSILDLADQLQAVDTEGVEPLANPLDATA 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD V + ++ E +  NAP  E   F+VPK ++
Sbjct: 61 RLRPDTVTETNQREKLQKNAPQAEAGLFLVPKVID 95


>gi|153007176|ref|YP_001381501.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Anaeromyxobacter
          sp. Fw109-5]
 gi|171769402|sp|A7HIH1|GATC_ANADF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|152030749|gb|ABS28517.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Anaeromyxobacter
          sp. Fw109-5]
          Length = 95

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + +V+RIA  +R+ +  E+   F  +L+  L  + +++E++V GVEPM   +   +
Sbjct: 1  MSLTLDEVRRIAALARLRLSPEEERTFAGQLSAILDHVAQLAELDVSGVEPMTHALAEGV 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD V  G   E  L+NAP  E  FFVVP+ +E
Sbjct: 61 PSRPDEVRPGLPPEEALANAPAREGTFFVVPRIIE 95


>gi|302038223|ref|YP_003798545.1| aspartyl/glutamyl-tRNA(asn/Gln) amidotransferase subunit C
          [Candidatus Nitrospira defluvii]
 gi|300606287|emb|CBK42620.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, subunit C
          [Candidatus Nitrospira defluvii]
          Length = 97

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 50/95 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+++A  +R+++ E +   F  +LN  +  ++K+   + EGVEP  +V     
Sbjct: 1  MEITRQEVEKVAKLARLALTEAETTAFSQQLNQIVGYVQKLKSFSTEGVEPTSTVPGQSN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V RPD V      E  LSNAP  E   F VPK ++
Sbjct: 61 VFRPDQVQASLSTEQALSNAPDAEAQCFRVPKIIQ 95


>gi|154685162|ref|YP_001420323.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          amyloliquefaciens FZB42]
 gi|308172553|ref|YP_003919258.1| glutamyl-tRNA(Gln amidotransferase subunit C [Bacillus
          amyloliquefaciens DSM 7]
 gi|166198838|sp|A7Z266|GATC_BACA2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|154351013|gb|ABS73092.1| GatC [Bacillus amyloliquefaciens FZB42]
 gi|307605417|emb|CBI41788.1| glutamyl-tRNA(Gln) amidotransferase (subunit C) [Bacillus
          amyloliquefaciens DSM 7]
 gi|328552318|gb|AEB22810.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          amyloliquefaciens TA208]
 gi|328910662|gb|AEB62258.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus amyloliquefaciens LL3]
          Length = 96

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 54/89 (60%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I + +VK +AH +R++I +E+  +F  +L++ +S  E+++EV+ + VEP   V+ MK V 
Sbjct: 4  ISIEEVKHVAHLARLAITDEEAEMFTEQLDSIISFAEELNEVDTDNVEPTTHVLKMKNVM 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          R D    G  VE ++ NAP  +  +  VP
Sbjct: 64 REDEAGKGLPVEDVMKNAPDHKDGYVRVP 92


>gi|323700748|ref|ZP_08112660.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfovibrio sp.
          ND132]
 gi|323460680|gb|EGB16545.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfovibrio
          desulfuricans ND132]
          Length = 94

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 55/94 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V ++A  SR+ + E+ + LF  +L + L+ ++K+ E++ + VEP+ S V    
Sbjct: 1  MKISPEEVAKVARLSRLDLPEDKLELFAGQLGDILAYMDKLGELDTDDVEPLYSPVKHTT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R D V    + E IL+NAP  +  FF+VP+ V
Sbjct: 61 VLRRDEVRKDYRREEILANAPEQDGQFFIVPRIV 94


>gi|70728277|ref|YP_258026.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          fluorescens Pf-5]
 gi|123658065|sp|Q4KIA7|GATC_PSEF5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|68342576|gb|AAY90182.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Pseudomonas
          fluorescens Pf-5]
          Length = 95

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV++IAH + I + E D+P     LN+ L +++++  V+ +G+EP+   +    
Sbjct: 1  MALERSDVEKIAHLASIKLNEGDLPHITSALNSILGLVDEMQAVDTDGIEPLAHPLEASQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV + +  E+  S AP VE   ++VPK ++
Sbjct: 61 RLRADVVTESNHREAYQSIAPAVESGLYLVPKVID 95


>gi|332974320|gb|EGK11252.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Desmospora sp. 8437]
          Length = 103

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 50/95 (52%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M I    V+ +A  +R+S+ EE+  L+  +LN+ L   EK++E++ EGVEP   V+PM  
Sbjct: 8   MAISKEQVEHVAQLARLSLTEEEARLYTGQLNDILQFAEKLNELDTEGVEPTSHVLPMAN 67

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           V R D        E  L NAP  +   F VP   E
Sbjct: 68  VLREDEKRPSLDREQALQNAPDQKDGMFRVPDVFE 102


>gi|197120004|ref|YP_002140431.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Geobacter bemidjiensis Bem]
 gi|226779782|sp|B5ED18|GATC_GEOBB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|197089364|gb|ACH40635.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Geobacter bemidjiensis Bem]
          Length = 95

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 54/95 (56%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I    V+ +A  +R+ + E ++  F  ++++ LS +EK++ ++ EG+ P    VPM+ 
Sbjct: 1  MKITREQVEHVARLARLELSEAELDTFTGQMDSILSYVEKLNALDTEGIVPTSHAVPMEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D       VE+ L+NAP   ++FF VPK +E
Sbjct: 61 AFRADEATGSIGVEAALANAPLRAQSFFRVPKVIE 95


>gi|222151881|ref|YP_002561041.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Macrococcus
          caseolyticus JCSC5402]
 gi|254791002|sp|B9E827|GATC_MACCJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|222121010|dbj|BAH18345.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Macrococcus
          caseolyticus JCSC5402]
          Length = 99

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 46/84 (54%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK +AH +R+ I EE+   F  +L   L+  +++ EV+ EGVEP   V+ ++ V R DV 
Sbjct: 9  VKHVAHLARLEITEEEATKFSAQLEAILNFADQLEEVDTEGVEPTFHVLDLQNVLREDVA 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVP 91
                E IL NA H E   F VP
Sbjct: 69 ETSLTQEEILKNAAHTEDGQFKVP 92


>gi|16331994|ref|NP_442722.1| hypothetical protein slr0033 [Synechocystis sp. PCC 6803]
 gi|6225430|sp|Q55450|GATC_SYNY3 RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|1001306|dbj|BAA10793.1| slr0033 [Synechocystis sp. PCC 6803]
          Length = 104

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 55/97 (56%), Gaps = 6/97 (6%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          ++D   V++IAH +R+ I  E+   F  +L++ L   ++++E+  EGVEP    + +  +
Sbjct: 1  MLDQSQVQKIAHLARLEITPEEESQFASQLSSILDYFDQLNELPTEGVEPTTRAIELSNI 60

Query: 62 HRPD--VVCDGDKV----ESILSNAPHVEKNFFVVPK 92
           R D  +  DGD      +++L NAP  E +FF VP+
Sbjct: 61 VRGDRQISWDGDNAATTRQALLDNAPEPEGDFFRVPR 97


>gi|153875916|ref|ZP_02003499.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Beggiatoa sp. PS]
 gi|152067620|gb|EDN66501.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Beggiatoa sp. PS]
          Length = 95

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 54/89 (60%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V++IAH + IS+  EDIPL+   L++ L  +E+++ ++  G+ PM   +      RPDV
Sbjct: 7  EVEKIAHLAHISLNNEDIPLYSRHLSDILHFVEQMNNIDTTGIIPMAHPLDAVARLRPDV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V + ++ +   + AP VE   ++VPK +E
Sbjct: 67 VSEINQRDHFQTIAPQVEDGLYLVPKVIE 95


>gi|258404439|ref|YP_003197181.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfohalobium
          retbaense DSM 5692]
 gi|257796666|gb|ACV67603.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfohalobium
          retbaense DSM 5692]
          Length = 94

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 47/92 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID  +V  +A  SR+ + E  +  +  +L+  L  +E + EV+  GVEPM S V    
Sbjct: 1  MKIDTREVAHVATLSRLELDEATLNEYRGQLDAILDYMETLGEVDTTGVEPMYSPVEHHT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          V R D   D    E +L NAP  +  +F VPK
Sbjct: 61 VLREDTAADEFAREEVLGNAPDTDGAYFKVPK 92


>gi|148546215|ref|YP_001266317.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          putida F1]
 gi|161378141|ref|NP_743093.2| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          putida KT2440]
 gi|167031954|ref|YP_001667185.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          putida GB-1]
 gi|325275941|ref|ZP_08141784.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          sp. TJI-51]
 gi|39931527|sp|Q88PB8|GATC_PSEPK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|166199713|sp|A5VZ23|GATC_PSEP1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|189045170|sp|B0KQG1|GATC_PSEPG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|148510273|gb|ABQ77133.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Pseudomonas putida F1]
 gi|166858442|gb|ABY96849.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Pseudomonas
          putida GB-1]
 gi|324098925|gb|EGB96928.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          sp. TJI-51]
          Length = 95

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV++IAH +R+ + + ++P     LN+ L +++++  V+  G+EP+   +    
Sbjct: 1  MALERCDVEKIAHLARLGLNDGELPRITDALNSILGLVDQMQAVDTTGIEPLAHPLEASQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD V + ++ ++  + AP  E   ++VPK +E
Sbjct: 61 RLRPDQVTESNQRDAYQAIAPSTESGLYLVPKVIE 95


>gi|325294686|ref|YP_004281200.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325065134|gb|ADY73141.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 96

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 55/88 (62%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +VK IA  SR++++E +I  F ++L+  L+ +EK++E++ EG++P   ++P + V R D+
Sbjct: 7  EVKHIAMLSRLNLEEGEIEKFQVQLSEILNFVEKLNELDTEGIDPKFQIIPPQNVLREDL 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
                 E +  NAP  +  +F+VPK V
Sbjct: 67 PGVSLSGEKVFMNAPETDGQYFIVPKVV 94


>gi|296122527|ref|YP_003630305.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Planctomyces
           limnophilus DSM 3776]
 gi|296014867|gb|ADG68106.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Planctomyces
           limnophilus DSM 3776]
          Length = 106

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 52/89 (58%)

Query: 3   IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
           + + DV RIA  +R+ + E ++ ++ ++L   L  +  + EV+  G+EPMVS VP + V 
Sbjct: 14  LSLSDVARIARLARLKLTENELAIYSIQLGKILEFMTVLREVDTTGIEPMVSAVPCENVF 73

Query: 63  RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
           R D++ +    +  L+NAP  +   F+VP
Sbjct: 74  REDLIVESLPRKLALANAPKTDGKSFLVP 102


>gi|255065644|ref|ZP_05317499.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria sicca
          ATCC 29256]
 gi|261364023|ref|ZP_05976906.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria mucosa
          ATCC 25996]
 gi|255049962|gb|EET45426.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria sicca
          ATCC 29256]
 gi|288568052|gb|EFC89612.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria mucosa
          ATCC 25996]
          Length = 96

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV++IA  SR+S+ EE+    L  LN+  +++EK+  VN +G+EPM       +
Sbjct: 1  MALSLTDVEKIAKLSRLSLTEEEKGKTLSELNDIFAMVEKMQSVNTDGIEPMAHPHEAAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D      + AP V    ++VP+ +E
Sbjct: 61 RLREDKVTETDHAAEYQAVAPEVRNRLYIVPQVIE 95


>gi|71083766|ref|YP_266486.1| Glu-tRNAGln amidotransferase C subunit [Candidatus Pelagibacter
          ubique HTCC1062]
 gi|91763198|ref|ZP_01265162.1| Glu-tRNA Gln amidotransferase C subunit [Candidatus Pelagibacter
          ubique HTCC1002]
 gi|123646445|sp|Q4FLQ6|GATC_PELUB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|71062879|gb|AAZ21882.1| Glu-tRNAGln amidotransferase C subunit [Candidatus Pelagibacter
          ubique HTCC1062]
 gi|91717611|gb|EAS84262.1| Glu-tRNA Gln amidotransferase C subunit [Candidatus Pelagibacter
          ubique HTCC1002]
          Length = 95

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 53/95 (55%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID+  +K I+  SRIS+ +         LN+    +EK++E+N + +EP+ SV    +
Sbjct: 1  MTIDLKTIKHISKLSRISVDDAKANKLAGDLNSIFDFIEKLNELNTDNIEPLTSVAETTL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V   +  + IL N+P   ++FFVVP+ VE
Sbjct: 61 KLRADEVKSENIRDQILKNSPEENEDFFVVPRVVE 95


>gi|331702038|ref|YP_004398997.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Lactobacillus buchneri NRRL B-30929]
 gi|329129381|gb|AEB73934.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Lactobacillus buchneri NRRL B-30929]
          Length = 103

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 49/88 (55%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK +A  +++ I ++ +P F  +L+  + + E +SEV+ +GVEP  SV     V R D+ 
Sbjct: 10 VKHVAELAKLKIADDQLPYFTTQLDQIIGLFETLSEVDTDGVEPTSSVTDQINVMRDDIA 69

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           D  + +++L NAP     +  VP  ++
Sbjct: 70 EDWHQRQALLDNAPDTADGYIRVPTIID 97


>gi|118581490|ref|YP_902740.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Pelobacter
          propionicus DSM 2379]
 gi|166199383|sp|A1ATL2|GATC_PELPD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|118504200|gb|ABL00683.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Pelobacter propionicus DSM 2379]
          Length = 95

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I + DV+ +A  +R+ + +E+  LF  +++  L  ++K+ E+N +G++P    VPM+ 
Sbjct: 1  MKITIADVEHVARLARLELSDEEKQLFAGQMDTILGYVDKLKELNTDGIQPTSHAVPMEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D           L+NAP     FF VPK +E
Sbjct: 61 AFREDQTRPSIGTAKALANAPDPVLGFFRVPKVIE 95


>gi|94308995|ref|YP_582205.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Cupriavidus
          metallidurans CH34]
 gi|166217908|sp|Q1LSE0|GATC_RALME RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|93352847|gb|ABF06936.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Cupriavidus
          metallidurans CH34]
          Length = 99

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 52/101 (51%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DVKRIAH +RI   + +    L +LNN  S++E++  V+  G+EP+    P+  
Sbjct: 1  MALALSDVKRIAHLARIETSDAEAEQTLAQLNNFFSLVEQMQAVDTTGIEPLAH--PLSA 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V       R D V + D+       AP  E   ++VPK +E
Sbjct: 59 VRDIAQRLREDAVTESDRRADYQRPAPATENGLYLVPKVIE 99


>gi|52079162|ref|YP_077953.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          licheniformis ATCC 14580]
 gi|52784529|ref|YP_090358.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          licheniformis ATCC 14580]
 gi|319647064|ref|ZP_08001290.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus sp. BT1B_CT2]
 gi|81609311|sp|Q65MP9|GATC_BACLD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|52002373|gb|AAU22315.1| glutamyl-tRNA(Gln) amidotransferase (subunit C) [Bacillus
          licheniformis ATCC 14580]
 gi|52347031|gb|AAU39665.1| GatC [Bacillus licheniformis ATCC 14580]
 gi|317390888|gb|EFV71689.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus sp. BT1B_CT2]
          Length = 96

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 55/89 (61%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I + +VK +AH +R++I +E+  +F  +L++ +S  E+++EV+ E V+P   V+ MK + 
Sbjct: 4  ISIEEVKHVAHLARLAITDEEAAMFTEQLDSIISFAEELNEVDTENVKPTTHVLQMKNIM 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          R DV   G  VE ++ NAP  +  +  VP
Sbjct: 64 REDVPDKGLPVEDVVKNAPDHKDGYIRVP 92


>gi|253702338|ref|YP_003023527.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Geobacter sp. M21]
 gi|259647251|sp|C6E6Z1|GATC_GEOSM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|251777188|gb|ACT19769.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Geobacter sp.
          M21]
          Length = 95

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 54/95 (56%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I    V+ +A  +R+ + E ++  F  ++++ LS +EK++ ++ EG+ P    VPM+ 
Sbjct: 1  MKITREQVEHVARLARLELSEAELDTFTGQMDSILSYVEKLNALDTEGIVPTSHAVPMEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D       VE+ L+NAP   ++FF VPK +E
Sbjct: 61 AFRADEATGSIGVEAALANAPLRAESFFRVPKVIE 95


>gi|328952201|ref|YP_004369535.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Desulfobacca acetoxidans DSM 11109]
 gi|328452525|gb|AEB08354.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Desulfobacca acetoxidans DSM 11109]
          Length = 136

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 52/87 (59%)

Query: 8   VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
           V+++A  +R+++   ++ LF  +LN+ L+ +EK+ E++   V PM  V+ ++   R D  
Sbjct: 50  VQQVARLARLTLAASEVELFTRQLNDILNYVEKLGELDTTDVPPMAHVLDVQNAFRDDAT 109

Query: 68  CDGDKVESILSNAPHVEKNFFVVPKAV 94
                VE  L+NAP  ++ FFVVP+ +
Sbjct: 110 QGSLSVEEALANAPAAQRLFFVVPRVI 136


>gi|322421569|ref|YP_004200792.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Geobacter sp. M18]
 gi|320127956|gb|ADW15516.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Geobacter sp.
          M18]
          Length = 95

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  +R+ + + ++  F  +++  L+ +EK++ ++ +G+ P    VPM+ 
Sbjct: 1  MKITRSEVEHVAKLARLELSDSELDTFTGQMDAILAYVEKLNALDTDGIVPTSHAVPMEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD   D   VE+ L+NAP   ++FF VPK +E
Sbjct: 61 AFRPDQPVDSIGVEAALANAPLRAESFFRVPKVIE 95


>gi|304436314|ref|ZP_07396292.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Selenomonas sp.
          oral taxon 149 str. 67H29BP]
 gi|304370719|gb|EFM24366.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Selenomonas sp.
          oral taxon 149 str. 67H29BP]
          Length = 100

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   D++  AH SR+SI  E+    L  L + LS ++ +S V+ E VEP    +P++ 
Sbjct: 5  MKVTEQDLRVTAHLSRLSIPTEEKEEALASLGDFLSYVDNLSHVDTEDVEPTTYALPIEN 64

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V      E+ LSNAP  E  +F VPK +E
Sbjct: 65 VFRADEVRSSLSNEAALSNAPLQEDGYFKVPKVLE 99


>gi|24982352|gb|AAN66557.1|AE016284_5 glutamyl-tRNA(Gln) amidotransferase, C subunit [Pseudomonas putida
           KT2440]
          Length = 102

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 55/95 (57%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M ++  DV++IAH +R+ + + ++P     LN+ L +++++  V+  G+EP+   +    
Sbjct: 8   MALERCDVEKIAHLARLGLNDGELPRITDALNSILGLVDQMQAVDTTGIEPLAHPLEASQ 67

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             RPD V + ++ ++  + AP  E   ++VPK +E
Sbjct: 68  RLRPDQVTESNQRDAYQAIAPSTESGLYLVPKVIE 102


>gi|238916392|ref|YP_002929909.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Eubacterium eligens ATCC 27750]
 gi|238871752|gb|ACR71462.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Eubacterium eligens ATCC 27750]
          Length = 98

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 52/88 (59%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          ++ +   +++ + +E+       + + L  ++K+ E++  GVEPM  V P+  V R DVV
Sbjct: 10 IEYVGILAKLELSDEEKEAAKKDMASMLDYIDKLGELDTTGVEPMSHVFPVNNVMREDVV 69

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +GD  E+ L+NAP   ++ F+VPK VE
Sbjct: 70 TNGDGSEATLANAPECNESGFIVPKTVE 97


>gi|319790612|ref|YP_004152245.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thermovibrio
          ammonificans HB-1]
 gi|317115114|gb|ADU97604.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thermovibrio
          ammonificans HB-1]
          Length = 96

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 54/88 (61%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  IA  +RI ++EE++  F  +L+  L+ +EK++E++ EG++P  SV+P + V R DV
Sbjct: 7  EVLHIAMLARIELREEEVEKFRNQLSEILTFVEKLNELDTEGIDPKFSVIPPENVLREDV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
                 E +  NAP  +  +F+VPK V
Sbjct: 67 PGMSLPREKVFMNAPETDGEYFIVPKVV 94


>gi|325268119|ref|ZP_08134765.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Kingella
          denitrificans ATCC 33394]
 gi|324980504|gb|EGC16170.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Kingella
          denitrificans ATCC 33394]
          Length = 96

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 53/95 (55%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV++IA  SR+S+ E++    L +LN   +++EK+  VN +GVEPM     + +
Sbjct: 1  MSLTLTDVEKIAKLSRLSLNEQEKAATLDKLNAVFAMVEKMQSVNTDGVEPMSHPHDVAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D      + AP V    ++VP+ +E
Sbjct: 61 RLRADQVTETDHAAEYQACAPEVRDRLYIVPQVIE 95


>gi|289207516|ref|YP_003459582.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Thioalkalivibrio
          sp. K90mix]
 gi|288943147|gb|ADC70846.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thioalkalivibrio
          sp. K90mix]
          Length = 95

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 53/95 (55%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  +V+RIAH +R+++ +E    F   L++  + +E++    +EGVEPM   +  + 
Sbjct: 1  MSVEASEVQRIAHLARLAMSDEQAREFAGGLSDIFAFVEQLDGAPIEGVEPMAHPLDAEQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D  E   + AP VE   ++VP+ +E
Sbjct: 61 RLRSDAVTEPDNREGFQAIAPAVEGGLYLVPRVIE 95


>gi|167768560|ref|ZP_02440613.1| hypothetical protein CLOSS21_03119 [Clostridium sp. SS2/1]
 gi|317498683|ref|ZP_07956975.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
          [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167710084|gb|EDS20663.1| hypothetical protein CLOSS21_03119 [Clostridium sp. SS2/1]
 gi|291560521|emb|CBL39321.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [butyrate-producing bacterium SSC/2]
 gi|316894025|gb|EFV16215.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
          [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 97

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 51/92 (55%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          ID   ++ +   +++ +  E+       + + L  ++K++E++   VEPM  V P+K V 
Sbjct: 5  IDDATIEYVGILAKLELSGEEKEQAKKDMESMLDYVDKLNELDTSSVEPMSHVFPVKNVF 64

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          R DVV +GD  E  L NAP  + N FVVPK +
Sbjct: 65 REDVVTNGDGSEDTLKNAPEAQDNAFVVPKTI 96


>gi|22299067|ref|NP_682314.1| glutamyl-tRNA(Gln) amidotransferase subunit C
          [Thermosynechococcus elongatus BP-1]
 gi|39931551|sp|Q8DIQ7|GATC_THEEB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|22295249|dbj|BAC09076.1| glutamyl-tRNA(Gln) amidotransferase subunit C
          [Thermosynechococcus elongatus BP-1]
          Length = 97

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 51/86 (59%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+++AH +R++I E +I     +L++ L  + ++SE++V  V P    + +  V RPDV
Sbjct: 10 DVRKVAHLARLAIDESEIEALTQQLDSILDYVNQLSELDVTEVPPTTRAIEVSNVTRPDV 69

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          +      E +L+ AP  E +FF VPK
Sbjct: 70 LAPWPNREDLLAIAPEREDDFFRVPK 95


>gi|37522851|ref|NP_926228.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Gloeobacter
          violaceus PCC 7421]
 gi|39931341|sp|Q7NG91|GATC_GLOVI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|35213853|dbj|BAC91223.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Gloeobacter
          violaceus PCC 7421]
          Length = 95

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 53/94 (56%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   VK++A  +R+ I E++  +F  +L   L  + ++ +V+ EGV P    + +  V
Sbjct: 1  MIDREQVKKVAFLARLEISEQEQEMFTRQLGAILDYIAELQQVDTEGVPPTTRAIEVHNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           RPD +   +  E IL NAP   ++FF VP+ +E
Sbjct: 61 VRPDALVVFEDREGILENAPERAEDFFKVPRIME 94


>gi|116075647|ref|ZP_01472906.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Synechococcus sp.
          RS9916]
 gi|116066962|gb|EAU72717.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Synechococcus sp.
          RS9916]
          Length = 97

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (54%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+++A  SR+++ EE I  +  +L   L  ++++  V+ EGV P    V +  V R D 
Sbjct: 8  DVRKVAKLSRLNLPEETIATYTGQLERILDYVDQLQAVDTEGVPPTTRAVEVVNVTREDA 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V   D  E +L  AP  E +FF VPK
Sbjct: 68 VVSTDVREELLDQAPQREGDFFRVPK 93


>gi|317472532|ref|ZP_07931851.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
          [Anaerostipes sp. 3_2_56FAA]
 gi|316899941|gb|EFV21936.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
          [Anaerostipes sp. 3_2_56FAA]
          Length = 97

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 43/65 (66%)

Query: 31 LNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVV 90
          + + L  ++K++E++ +GVEPM  V P+  V R D+V +GD  E IL NAP  ++  FVV
Sbjct: 33 MESMLDYVDKLNELDTDGVEPMSHVFPVNNVFREDIVTNGDDREGILKNAPERKEGAFVV 92

Query: 91 PKAVE 95
          PK VE
Sbjct: 93 PKTVE 97


>gi|332525710|ref|ZP_08401859.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rubrivivax
          benzoatilyticus JA2]
 gi|332109269|gb|EGJ10192.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rubrivivax
          benzoatilyticus JA2]
          Length = 99

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 57/101 (56%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DV RIAH +R+ ++ ++    L +LN+   ++EK+S V+  GVEP+ +  P+  
Sbjct: 1  MALTPQDVSRIAHLARLELQPDEEQRMLAQLNDFFGIVEKMSAVDTSGVEPLYT--PLSA 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V       R D V + ++ E+   +AP VE   F+VPK +E
Sbjct: 59 VQDVALRLREDRVTESNEREANQRSAPAVEDGLFLVPKVIE 99


>gi|225851493|ref|YP_002731727.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Persephonella
          marina EX-H1]
 gi|225646057|gb|ACO04243.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Persephonella
          marina EX-H1]
          Length = 96

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 54/93 (58%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   V+++A  +++ + EE++ LF  +L++ L  +EK+ E++ E + P   ++  +  
Sbjct: 1  MIDRQTVEKVAQLAKLRLTEEEVELFSKQLSDILGFIEKLEELDTENILPFYEMIDQEAP 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
           R D+  +G   +  L NAP  E  FFVVP+ V
Sbjct: 61 LREDIPEEGLTNDDALKNAPQSEDGFFVVPRVV 93


>gi|311029286|ref|ZP_07707376.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus sp.
          m3-13]
          Length = 96

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 53/88 (60%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK +AH +R++I E++  +F  +L+  +S  EK++E++ E V+P   V+ MK V R DV 
Sbjct: 9  VKHVAHLARLAISEDEAVMFTSQLDAIISFAEKLNELDTENVQPTSHVLHMKNVMREDVA 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +G  V+ +L NAP  +     VP  +E
Sbjct: 69 KEGLPVDEVLKNAPDHKNGQIRVPSIIE 96


>gi|225847997|ref|YP_002728160.1| glutamyl-tRNA(Gln) amidotransferase subunit C
          [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643988|gb|ACN99038.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 95

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 52/93 (55%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   V ++A  S++ + E ++ LF  + N+ +S +EK+ EV+ EGV P   +   + +
Sbjct: 1  MIDKDTVVKVAQLSKLKLNENEVNLFSKQFNDIISFVEKLKEVDTEGVPPFYELNLEEGI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          +R D        E  LSNAP  E  FF+VP+ V
Sbjct: 61 YREDEPHQSISNEEALSNAPQKEGGFFIVPRVV 93


>gi|212638107|ref|YP_002314627.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Anoxybacillus
          flavithermus WK1]
 gi|212559587|gb|ACJ32642.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Anoxybacillus
          flavithermus WK1]
          Length = 99

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (56%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I +  VK +AH +R++I EE+  +F  +L+  ++  E+++E++ E V P   V+ MK V 
Sbjct: 7  ISIEQVKHVAHLARLAITEEEATMFAKQLDAIITFAEQLNELDTENVPPTSHVLNMKNVM 66

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          R DV   G  +E +L NAP      F VP  +E
Sbjct: 67 REDVPTAGLPLEDVLKNAPDHRDGQFRVPAILE 99


>gi|81301131|ref|YP_401339.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Synechococcus elongatus PCC 7942]
 gi|81170012|gb|ABB58352.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Synechococcus elongatus PCC 7942]
          Length = 96

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 53/92 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I +  V ++AH +R+++  E+   F  +LN+ L  +E++SE+  E V+P    + +  
Sbjct: 1  MSITLEQVHKVAHLARLALTPEEEQQFTTQLNSILEYVEQLSELPTEDVQPTTRAIEVVN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          V RPD V   +  E +LS AP  E +FF VP+
Sbjct: 61 VTRPDDVKPAENREELLSIAPDQEGDFFRVPQ 92


>gi|227509973|ref|ZP_03940022.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
          brevis subsp. gravesensis ATCC 27305]
 gi|227190579|gb|EEI70646.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
          brevis subsp. gravesensis ATCC 27305]
          Length = 103

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 51/88 (57%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK +A  +++ I ++ +P F  +L+  + + E +S+V+ +GVEP  SV     V R DV 
Sbjct: 10 VKHVAELAKLKIDDDQLPYFTTQLDKIIGLFETLSKVDTDGVEPTSSVTDQINVMRDDVA 69

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + ++ +++L NAP  +  +  VP  ++
Sbjct: 70 DNWNQRQALLDNAPDTQDGYIRVPTIID 97


>gi|288942555|ref|YP_003444795.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Allochromatium
          vinosum DSM 180]
 gi|288897927|gb|ADC63763.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Allochromatium
          vinosum DSM 180]
          Length = 95

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D  D+ +IAH +R++I  E    +   L N L ++ ++  V+  GVEPM   + M  
Sbjct: 1  MSLDSSDIDKIAHLARLAIAPEQRARYATDLTNILDLVAQMDAVDTSGVEPMAHPLHMAQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPDV  + ++ E   S AP  E   ++VPK ++
Sbjct: 61 RLRPDVPREPNRRERFQSIAPLTEGGLYLVPKVID 95


>gi|88704051|ref|ZP_01101766.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Congregibacter
          litoralis KT71]
 gi|88701878|gb|EAQ98982.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Congregibacter
          litoralis KT71]
          Length = 95

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 50/88 (56%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          ++ IA  +R+ ++E+++P      N  L + E++     +GVEPM + +  +   R DVV
Sbjct: 8  IREIAQLARLRVEEDELPALTGNFNAILDLFEQLQAAPTDGVEPMANPLDARQTLRDDVV 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + ++ +S+ S AP  E   ++VP+ V+
Sbjct: 68 TESNQRDSLQSTAPLTENGLYLVPRVVD 95


>gi|28871608|ref|NP_794227.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Pseudomonas
          syringae pv. tomato str. DC3000]
 gi|66047391|ref|YP_237232.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. syringae B728a]
 gi|71737931|ref|YP_276295.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. phaseolicola 1448A]
 gi|213966631|ref|ZP_03394782.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. tomato T1]
 gi|257482244|ref|ZP_05636285.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. tabaci ATCC 11528]
 gi|289627549|ref|ZP_06460503.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. aesculi str. NCPPB3681]
 gi|289646977|ref|ZP_06478320.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. aesculi str. 2250]
 gi|298488471|ref|ZP_07006502.1| Aspartyl-tRNA(Asn) amidotransferase subunit C; Glutamyl-tRNA(Gln)
          amidotransferase subunit C [Pseudomonas savastanoi pv.
          savastanoi NCPPB 3335]
 gi|301383141|ref|ZP_07231559.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. tomato Max13]
 gi|302063729|ref|ZP_07255270.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. tomato K40]
 gi|302133797|ref|ZP_07259787.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. tomato NCPPB 1108]
 gi|302185332|ref|ZP_07262005.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. syringae 642]
 gi|39931523|sp|Q87WS0|GATC_PSESM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|75500718|sp|Q4ZNS8|GATC_PSEU2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|123635199|sp|Q48E93|GATC_PSE14 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|28854860|gb|AAO57922.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Pseudomonas
          syringae pv. tomato str. DC3000]
 gi|63258098|gb|AAY39194.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Pseudomonas
          syringae pv. syringae B728a]
 gi|71558484|gb|AAZ37695.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Pseudomonas
          syringae pv. phaseolicola 1448A]
 gi|213928481|gb|EEB62025.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. tomato T1]
 gi|298157096|gb|EFH98185.1| Aspartyl-tRNA(Asn) amidotransferase subunit C; Glutamyl-tRNA(Gln)
          amidotransferase subunit C [Pseudomonas savastanoi pv.
          savastanoi NCPPB 3335]
 gi|320322512|gb|EFW78605.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. glycinea str. B076]
 gi|320330019|gb|EFW86006.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. glycinea str. race 4]
 gi|330868262|gb|EGH02971.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. aesculi str. 0893_23]
 gi|330875177|gb|EGH09326.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. glycinea str. race 4]
 gi|330877211|gb|EGH11360.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. morsprunorum str. M302280PT]
 gi|330888640|gb|EGH21301.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. mori str. 301020]
 gi|330895288|gb|EGH27626.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. japonica str. M301072PT]
 gi|330950288|gb|EGH50548.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae Cit 7]
 gi|330963990|gb|EGH64250.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. actinidiae str. M302091]
 gi|330981109|gb|EGH79212.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. aptata str. DSM 50252]
 gi|330987072|gb|EGH85175.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. lachrymans str. M301315]
 gi|331011515|gb|EGH91571.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. tabaci ATCC 11528]
          Length = 95

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV++IAH +R+ + + DIP     LN+ L +++++  V+  G+EP+   +    
Sbjct: 1  MALERSDVEKIAHLARLGLNDADIPRTTEALNSILGLVDQMQAVDTTGIEPLAHPLEATQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + ++ ++  + AP V+   ++VPK +E
Sbjct: 61 RLREDAVTERNRRDTYQAIAPAVQDGLYLVPKVIE 95


>gi|330958033|gb|EGH58293.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. maculicola str. ES4326]
 gi|330969668|gb|EGH69734.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. aceris str. M302273PT]
          Length = 95

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV++IAH +R+ + + DIP     LN+ L +++++  V+  G+EP+   +    
Sbjct: 1  MALERSDVEKIAHLARLGLNDADIPRTTEALNSILGLVDQMQAVDTAGIEPLAHPLEATQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + ++ ++  + AP V+   ++VPK +E
Sbjct: 61 RLREDAVTERNRRDTYQAIAPAVQDGLYLVPKVIE 95


>gi|331016667|gb|EGH96723.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. lachrymans str. M302278PT]
          Length = 95

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV++IAH +R+ + + DIP     LN+ L +++++  V+  G+EP+   +    
Sbjct: 1  MALERSDVEKIAHLARLGLNDADIPRTTEALNSILGLVDQMQAVDTTGIEPLAHPLEATQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + ++ ++  + AP V+   ++VPK +E
Sbjct: 61 RLREDTVTERNRRDTYQAIAPAVQDGLYLVPKVIE 95


>gi|148266335|ref|YP_001233041.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Geobacter
          uraniireducens Rf4]
 gi|189045164|sp|A5G9K0|GATC_GEOUR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|146399835|gb|ABQ28468.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Geobacter uraniireducens Rf4]
          Length = 95

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  +R+ + E++   F  +++  L+ ++K++E++ +G+ P    VPM+ 
Sbjct: 1  MKITKAEVEHVALLARLELTEQEAETFTGQMDAILAYVDKLNELDTDGIVPTAHAVPMEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V     +E+ L NAP   ++FF VPK +E
Sbjct: 61 AFRADEVTPSIGIENALGNAPKRAESFFRVPKVIE 95


>gi|323141454|ref|ZP_08076343.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Phascolarctobacterium sp. YIT 12067]
 gi|322414034|gb|EFY04864.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Phascolarctobacterium sp. YIT 12067]
          Length = 95

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 53/95 (55%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DVK IA  SR+++   ++ +F  + N  L+  + + +++  G+EP   V+P+  
Sbjct: 1  MKVSAEDVKHIAQLSRLTVPASEMEVFTEQFNQILNYADILEKIDTAGIEPTPYVLPVSN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R DVV +G   E  L NAP V  + F VP+ +E
Sbjct: 61 VLREDVVKEGVSHEEALKNAPAVHNDGFKVPRVIE 95


>gi|319940713|ref|ZP_08015055.1| hypothetical protein HMPREF9464_00274 [Sutterella wadsworthensis
          3_1_45B]
 gi|319805864|gb|EFW02631.1| hypothetical protein HMPREF9464_00274 [Sutterella wadsworthensis
          3_1_45B]
          Length = 95

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 52/97 (53%), Gaps = 4/97 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   D+ RIA   RI I +E + +    LN+   ++E+I  ++  GVEPM +  P   
Sbjct: 1  MALSAGDIHRIADLGRIDISDEQVKVMQGELNDIFQMIEQIRSIDTSGVEPMPN--PHDG 58

Query: 61 VH--RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +   R D+V +GD     + NAP   + +F+VP+ +E
Sbjct: 59 IEHLRDDIVTEGDNRTENMKNAPEKSEGYFLVPQVIE 95


>gi|114778060|ref|ZP_01452960.1| Glu-tRNA(Gln) amidotransferase subunit C [Mariprofundus
          ferrooxydans PV-1]
 gi|114551666|gb|EAU54219.1| Glu-tRNA(Gln) amidotransferase subunit C [Mariprofundus
          ferrooxydans PV-1]
          Length = 92

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 51/90 (56%)

Query: 6  VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD 65
          +DVK++A  +RI + + +      +L   L  +EK+SEVN EGV P        M  R +
Sbjct: 3  IDVKKVAMLARIRLTDSEADELGPQLGGILGYIEKLSEVNTEGVAPTAHPHDAAMPLRAN 62

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          VV + ++ +++ + AP VE   +VVPK +E
Sbjct: 63 VVTNSNRRDALQAIAPRVESGLYVVPKVIE 92


>gi|257060042|ref|YP_003137930.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Cyanothece sp. PCC
          8802]
 gi|256590208|gb|ACV01095.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Cyanothece sp.
          PCC 8802]
          Length = 98

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 50/91 (54%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   V++IAH +R+ I   +   F  +LN+ L   +++SE++ E V PM   + +  +
Sbjct: 1  MIDRQQVEKIAHLARLEITPAEEEAFAPQLNSILQYFDQLSELDTENVPPMTRAIELSNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D        ES+L +AP  E +FF VP+
Sbjct: 61 TRSDRTETYGDRESLLKSAPEQEGDFFRVPQ 91


>gi|119492350|ref|ZP_01623686.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Lyngbya sp. PCC
          8106]
 gi|119453130|gb|EAW34298.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Lyngbya sp. PCC
          8106]
          Length = 96

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 51/91 (56%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   V+++AH +R+ +  E+   F   L + L   E++ E++ E V+P    + +  +
Sbjct: 1  MIDREQVRKVAHLARLKVTPEEEEKFTTELGSILEYFEQLKELDTENVQPTTRAIDVSNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           RPD +   +  ES+L +AP  + ++F VPK
Sbjct: 61 SRPDELKPYENRESLLGSAPSSDGDYFKVPK 91


>gi|302389229|ref|YP_003825050.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Thermosediminibacter oceani DSM 16646]
 gi|302199857|gb|ADL07427.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Thermosediminibacter oceani DSM 16646]
          Length = 96

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I +  V+ +A+ +R+ + E++      +LN+ L  ++K++E++   V P   ++P+K 
Sbjct: 1  MKITIETVEHVANLARLYLSEDEKAEMAQKLNSILDYMDKLNELDTSNVPPTAHIIPIKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V +    E +L NAP  E+ FF VP+ +E
Sbjct: 61 VFREDAVRESLPREEVLRNAPDKERGFFKVPRIIE 95


>gi|227512906|ref|ZP_03942955.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
          buchneri ATCC 11577]
 gi|227523034|ref|ZP_03953083.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
          hilgardii ATCC 8290]
 gi|227083906|gb|EEI19218.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
          buchneri ATCC 11577]
 gi|227089852|gb|EEI25164.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
          hilgardii ATCC 8290]
          Length = 103

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 51/88 (57%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK +A  +++ I ++ +P F  +L+  + + E +S+V+ +GVEP  SV     V R D+ 
Sbjct: 10 VKHVAELAKLKIDDDQLPYFTTQLDKIIGLFETLSKVDTDGVEPTSSVTDQINVMRDDIA 69

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + ++ +++L NAP  +  +  VP  ++
Sbjct: 70 DNWNQRQALLDNAPDTQDGYIRVPTIID 97


>gi|225026151|ref|ZP_03715343.1| hypothetical protein EUBHAL_00392 [Eubacterium hallii DSM 3353]
 gi|224956531|gb|EEG37740.1| hypothetical protein EUBHAL_00392 [Eubacterium hallii DSM 3353]
          Length = 97

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 51/88 (57%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          ++ +   +++ + +E+       + N L  ++ ++E++  GVEPM  V P+  V R DVV
Sbjct: 10 IEYVGILAKLELSDEEKEQAKKDMANMLDYIDTLNELDTSGVEPMSHVFPVNNVFREDVV 69

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +GD  E IL+NAP  ++  FVVPK  +
Sbjct: 70 TNGDDREEILANAPEAKEGAFVVPKTFD 97


>gi|261416925|ref|YP_003250608.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Fibrobacter
          succinogenes subsp. succinogenes S85]
 gi|261373381|gb|ACX76126.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Fibrobacter
          succinogenes subsp. succinogenes S85]
          Length = 93

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V ++A  SR+SI EEDIP     L+  L  LE +  +++  VEPM +V     + R DV
Sbjct: 6  EVLKLAKLSRLSIAEEDIPAIKGHLDKMLDHLEALKALDLSNVEPMTAVENGATILREDV 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
             G  ++   +NAP VE + F +PK
Sbjct: 66 PVQGFTLDQAFANAPAVENDHFAIPK 91


>gi|56751789|ref|YP_172490.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Synechococcus
          elongatus PCC 6301]
 gi|56686748|dbj|BAD79970.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Synechococcus
          elongatus PCC 6301]
          Length = 96

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 53/92 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I +  V ++AH +R+++  E+   F  +LN+ L  +E++SE+  E V+P    + +  
Sbjct: 1  MSITLEQVHKVAHLARLALTPEEEQPFTTQLNSILEYVEQLSELPTEDVQPTTRAIEVVN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          V RPD V   +  E +LS AP  E +FF VP+
Sbjct: 61 VTRPDDVKPAENREELLSIAPDQEGDFFRVPQ 92


>gi|260880988|ref|ZP_05403343.2| glutamyl-tRNA(Gln) amidotransferase subunit C [Mitsuokella
           multacida DSM 20544]
 gi|260850127|gb|EEX70134.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Mitsuokella
           multacida DSM 20544]
          Length = 119

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 54/89 (60%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           D++ +A  SR+S+ E     ++ ++++ L+ ++ +S+V+ E V+P    +PM+ V R DV
Sbjct: 30  DLENVAVLSRLSVPEGKAETYIQQMDSILTYMDNLSKVDTENVKPTTYALPMQNVFREDV 89

Query: 67  VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           V      E+ L+NAP  E  +F VPK +E
Sbjct: 90  VKPSLPREAALANAPLQEDGYFKVPKVLE 118


>gi|167747871|ref|ZP_02419998.1| hypothetical protein ANACAC_02600 [Anaerostipes caccae DSM 14662]
 gi|167652693|gb|EDR96822.1| hypothetical protein ANACAC_02600 [Anaerostipes caccae DSM 14662]
          Length = 97

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 42/65 (64%)

Query: 31 LNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVV 90
          + + L  ++K++E++ +GVEPM  V P+  V R D+V +GD  E IL NAP  +   FVV
Sbjct: 33 MESMLDYVDKLNELDTDGVEPMSHVFPVNNVFREDIVTNGDDREEILKNAPERKDGAFVV 92

Query: 91 PKAVE 95
          PK VE
Sbjct: 93 PKTVE 97


>gi|312898544|ref|ZP_07757934.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Megasphaera
          micronuciformis F0359]
 gi|310620463|gb|EFQ04033.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Megasphaera
          micronuciformis F0359]
          Length = 96

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   +VK+IA  SR+ IKE+ +     +L++ LS +E I + ++  VEP    V M  
Sbjct: 1  MKVSAEEVKKIALLSRLEIKEDRVEAVQQQLSDILSYMELIEQADISEVEPTAHAVSMSN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R DV  +    E  L NAP  E  +F VPK ++
Sbjct: 61 VMRDDVPQESLPNEDALRNAPEAEGGYFKVPKVIQ 95


>gi|158336468|ref|YP_001517642.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Acaryochloris
          marina MBIC11017]
 gi|189045155|sp|B0BZ26|GATC_ACAM1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|158306709|gb|ABW28326.1| aspartyl/glutamyl-tRNA amidotransferase C subunit [Acaryochloris
          marina MBIC11017]
          Length = 96

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 52/91 (57%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +++  +V ++AH +R+S+ + +   F  +L + L   E++SE++V  VEP    + +  V
Sbjct: 1  MLERAEVDKVAHLARLSLTDAESEQFTTQLGDILDYFEQLSELDVAEVEPTTRAIDVSNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D +   D  ESIL+ AP  E  +F VPK
Sbjct: 61 TRVDHLTPYDDRESILACAPDQEDEYFKVPK 91


>gi|114319330|ref|YP_741013.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312677|sp|Q0ACB4|GATC_ALHEH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|114225724|gb|ABI55523.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Alkalilimnicola ehrlichii MLHE-1]
          Length = 95

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 56/97 (57%), Gaps = 4/97 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  +VK IAH +R++I+ +DIP +   L++ L  +E++ +++  GV PM    P+  
Sbjct: 1  MSLEESEVKHIAHLARVAIEADDIPGYARNLSDILDFVEQMKDIDTSGVTPMAH--PLDA 58

Query: 61 VH--RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V   R D V + D+ E   + AP  E   ++VP+ +E
Sbjct: 59 VQRLREDEVTEPDQRERFQAIAPATEAGLYLVPRVIE 95


>gi|239906371|ref|YP_002953112.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Desulfovibrio magneticus RS-1]
 gi|259647249|sp|C4XQ61|GATC_DESMR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|239796237|dbj|BAH75226.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Desulfovibrio magneticus RS-1]
          Length = 94

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 50/94 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   D  ++A  +R+ + ++ +  F  +++  L+ +E +  V+  GVEP+ S V  + 
Sbjct: 1  MPISSEDAAKVAKLARLRLDDDKLERFAGQMDGILAYMETLGSVDTAGVEPLYSPVTHET 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
            R DV       + IL+NAP  +  FF+VPK V
Sbjct: 61 PMRADVAAKACSRDQILANAPATDGQFFIVPKIV 94


>gi|104780289|ref|YP_606787.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          entomophila L48]
 gi|166199391|sp|Q1IED2|GATC_PSEE4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|95109276|emb|CAK13973.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Pseudomonas
          entomophila L48]
          Length = 95

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 53/95 (55%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DV++IAH +R+ + E ++P     LN+ L +++++  V+  G+EP+   +    
Sbjct: 1  MALQRSDVEKIAHLARLGLNEGELPRITDALNSILGLVDQMQAVDTTGIEPLAHPLETTQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD V + ++ +   + AP  E   ++VPK ++
Sbjct: 61 RLRPDQVTESNQRDRYQAVAPSTENGLYLVPKVID 95


>gi|239625352|ref|ZP_04668383.1| conserved hypothetical protein [Clostridiales bacterium
          1_7_47_FAA]
 gi|239519582|gb|EEQ59448.1| conserved hypothetical protein [Clostridiales bacterium
          1_7_47FAA]
          Length = 96

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 53/93 (56%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   ++ +   +++ + EE+       +   L  ++K++E++ EGVEPM  + P+  V
Sbjct: 4  IIDDGTIEYVGILAKLELSEEEKQEAKKDMGRMLDYIDKLNELDTEGVEPMTHIFPVSNV 63

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
           R DVV  G+  ++IL+NAP  +   F VPK V
Sbjct: 64 FREDVVSGGEDRDNILANAPEQKDGAFKVPKTV 96


>gi|206900316|ref|YP_002250887.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Dictyoglomus
          thermophilum H-6-12]
 gi|226709617|sp|B5YEC9|GATC_DICT6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|206739419|gb|ACI18477.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Dictyoglomus
          thermophilum H-6-12]
          Length = 100

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          +K+ AH +R+ +  E+  LF  +L N L   +K+ E++   VEPM  V+P+  + R D V
Sbjct: 10 LKKTAHLARLHLTPEEEELFAKQLQNILDYFKKLQELDTSNVEPMAHVLPLYNIWREDEV 69

Query: 68 CDGDKVESILSNAPHVEKNFFVVPK 92
           +    E  L NAP +E   F +P+
Sbjct: 70 RESISQEEALKNAPEIEDLGFKIPR 94


>gi|304405108|ref|ZP_07386768.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Paenibacillus
          curdlanolyticus YK9]
 gi|304345987|gb|EFM11821.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Paenibacillus
          curdlanolyticus YK9]
          Length = 95

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   DV  +A  +R+S+ +E+   F  +LN  L   EK++E+N + VEP   V+P+  
Sbjct: 1  MSITTNDVDHVAKLARLSLTDEERATFTGQLNAILKYAEKLNELNTDDVEPTSHVLPLAN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V     +E+ + NAP  E   F VP  +E
Sbjct: 61 VTRADEVRPSVPLETAMRNAPDEEDGQFKVPAVLE 95


>gi|302328092|gb|ADL27293.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Fibrobacter
           succinogenes subsp. succinogenes S85]
          Length = 129

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 52/92 (56%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           ++++  +V ++A  SR+SI EEDIP     L+  L  LE +  +++  VEPM +V     
Sbjct: 36  IMLEREEVLKLAKLSRLSIAEEDIPAIKGHLDKMLDHLEALKALDLSNVEPMTAVENGAT 95

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           + R DV   G  ++   +NAP VE + F +PK
Sbjct: 96  ILREDVPVQGFTLDQAFANAPAVENDHFAIPK 127


>gi|255284349|ref|ZP_05348904.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bryantella
          formatexigens DSM 14469]
 gi|255265091|gb|EET58296.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bryantella
          formatexigens DSM 14469]
          Length = 97

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 52/88 (59%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          ++ +   +++ + +E+       +   L  ++K++E++  G+EPM  V P++ V R D+V
Sbjct: 10 IEYVGILAKLELSDEEKEQAKADMGKMLDYIDKLNELDTTGIEPMSHVFPVQNVFREDMV 69

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +GD  E++L NAP  +   FVVP+ VE
Sbjct: 70 TNGDDREAMLKNAPEEKDGAFVVPRTVE 97


>gi|85373100|ref|YP_457162.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Erythrobacter
           litoralis HTCC2594]
 gi|122545278|sp|Q2ND76|GATC_ERYLH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit C; Short=Asp/Glu-ADT subunit C
 gi|84786183|gb|ABC62365.1| glutamyl-tRNA(gln) amidotransferase subunit C [Erythrobacter
           litoralis HTCC2594]
          Length = 100

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 5/100 (5%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M +D   V +IA  +RI + + ++      L+N L  +E++ EV+   VEPM +V+P  +
Sbjct: 1   MSVDKETVAKIASLARIKMTDAELEKMAPELSNILDWVEQLGEVDTSDVEPMTAVIPNTL 60

Query: 61  VHRPDVV-----CDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R D V       G   + +L+NAP  E  FF VPK +E
Sbjct: 61  RLREDEVNADPLTGGGVRDKVLANAPAAEHGFFGVPKVIE 100


>gi|40063057|gb|AAR37913.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [uncultured marine
          bacterium 560]
          Length = 95

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++   VK IA  +++SI + +I    + LNN LS++ ++SE+  + VEPM   + M  
Sbjct: 1  MSLNKEQVKEIAQLAKLSINDSEIEQSTIELNNILSLMAELSEIETDHVEPMAHPLKMSQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV + D  E     AP   K+ F+VP  +E
Sbjct: 61 RLREDVVTETDLSEEFQEIAPKTGKHHFLVPTVIE 95


>gi|68171383|ref|ZP_00544777.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88658453|ref|YP_507811.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Ehrlichia
           chaffeensis str. Arkansas]
 gi|67999208|gb|EAM85864.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88599910|gb|ABD45379.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 111

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 53/90 (58%), Gaps = 1/90 (1%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMV-SVVPMKMVHRPD 65
           D+ + A  +RI + +E+I   L  L   L+ ++ ISEV+ + V PM    V   +  R D
Sbjct: 22  DILQAAKLTRIKLNDEEIDYHLKELEQVLNWIQTISEVDTQDVTPMGHGGVNYALPLRKD 81

Query: 66  VVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           ++ DG+  +++LS +P  E +FFVVPK +E
Sbjct: 82  IINDGNIKDTVLSQSPKQEHDFFVVPKVIE 111


>gi|332981488|ref|YP_004462929.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Mahella australiensis 50-1 BON]
 gi|332699166|gb|AEE96107.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Mahella australiensis 50-1 BON]
          Length = 98

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  IA  SR+ + E++  ++   L+  L   E++SE++ +GVEP   V+P++ 
Sbjct: 4  MRIKPEEVDYIAALSRLFLSEQEKNIYARHLSEILEHAERLSELDTDGVEPTAHVLPLRN 63

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          + R D V    + + +LSNAP VE   F VP+ VE
Sbjct: 64 IFRDDKVKPSLERDILLSNAPEVENGCFKVPRIVE 98


>gi|291280322|ref|YP_003497157.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Deferribacter desulfuricans SSM1]
 gi|290755024|dbj|BAI81401.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Deferribacter desulfuricans SSM1]
          Length = 98

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +I   DVK IA  +R++  +E+I  F   LN  L  + K++E+N + VEP   V+ +  V
Sbjct: 4  IISKKDVKHIAKLARLTFNDEEIEKFTGELNKILDYIHKLNELNTDDVEPTSHVLDITNV 63

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           R D V +    E  L NAP  E   F VP+ +E
Sbjct: 64 FRDDSVKESLANEEALKNAPEKEYEHFKVPRVIE 97


>gi|269119791|ref|YP_003307968.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Sebaldella
          termitidis ATCC 33386]
 gi|268613669|gb|ACZ08037.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sebaldella
          termitidis ATCC 33386]
          Length = 95

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 54/88 (61%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV +IA  S++   +++I  F   L+  L+ + +++E++ EG+ P+ +V+ +  V R D 
Sbjct: 7  DVIKIAILSKLEFNDDEIENFRSDLSEILNYMNELNELDTEGISPLFNVLDLDDVTRKDE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V D  K E +L NAP  ++NF +VPK +
Sbjct: 67 VRDSLKQEEVLKNAPDKDENFIIVPKII 94


>gi|303256312|ref|ZP_07342328.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderiales
          bacterium 1_1_47]
 gi|330999006|ref|ZP_08322731.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Parasutterella excrementihominis YIT 11859]
 gi|302861041|gb|EFL84116.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderiales
          bacterium 1_1_47]
 gi|329575748|gb|EGG57274.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Parasutterella excrementihominis YIT 11859]
          Length = 95

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV+RI+  +RI + EE     +  LN+ LS++E+I  V+  GV PM        
Sbjct: 1  MSLTINDVRRISDLARIDLSEESAKKLMGELNDILSMVEQIQSVDTTGVAPMPHPFGGVQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD V + ++ E  + NAP      F+VPK +E
Sbjct: 61 RLRPDDVTEHNRREENMQNAPDEMDGLFLVPKVIE 95


>gi|144897949|emb|CAM74813.1| Glu-tRNAGln amidotransferase, C subunit [Magnetospirillum
          gryphiswaldense MSR-1]
          Length = 95

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 56/95 (58%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+ IA  +RI + +E++      L+  L  +E+++EV+  G+ PM SV  + +
Sbjct: 1  MSLDKAAVRAIAELARIEVADEELDHLAGELSGILHFVEQLAEVDTNGIAPMSSVADLTL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V DG +V ++L+NAP  +  FF VPK VE
Sbjct: 61 PMRKDEVTDGGQVAAVLANAPAADDGFFTVPKVVE 95


>gi|237798581|ref|ZP_04587042.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. oryzae str. 1_6]
 gi|331021434|gb|EGI01491.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. oryzae str. 1_6]
          Length = 95

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV++IAH +R+ + + DIP     LN+ L +++++  V+  G++P+   +    
Sbjct: 1  MALERSDVEKIAHLARLGLNDADIPRTTEALNSILGLVDQMQAVDTTGIDPLAHPLEATQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + ++ ++  + AP V+   ++VPK +E
Sbjct: 61 RLREDAVTERNRRDTYQAIAPAVQDGLYLVPKVIE 95


>gi|294668794|ref|ZP_06733887.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria elongata
           subsp. glycolytica ATCC 29315]
 gi|291309311|gb|EFE50554.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria elongata
           subsp. glycolytica ATCC 29315]
          Length = 131

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 52/95 (54%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M +++ DV++IA  SR+S+ E +    L  LN+  +++EK+  VN +GVEPM       +
Sbjct: 36  MALNLSDVEKIAKLSRLSLTENEKTKTLSELNDIFAMVEKMQSVNTDGVEPMPHPHETAL 95

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R D V + D      + AP V    ++VP+ +E
Sbjct: 96  RLREDAVTETDHAAEYQAVAPEVRNRLYIVPQVIE 130


>gi|307154594|ref|YP_003889978.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Cyanothece sp. PCC
          7822]
 gi|306984822|gb|ADN16703.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Cyanothece sp.
          PCC 7822]
          Length = 98

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 50/91 (54%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   V++IAH +R+ I  ++   F  +L++ L   E++SE++   V P    + +  +
Sbjct: 1  MIDKEQVRKIAHLARLEITAQEEEQFTSQLSSILEYFEQLSELDTTDVPPTTRAIEITNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           RPD++      E +L  AP  E +FF VP+
Sbjct: 61 TRPDLMKSYASREELLKEAPEQEGDFFKVPQ 91


>gi|261377510|ref|ZP_05982083.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria cinerea
          ATCC 14685]
 gi|269146245|gb|EEZ72663.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria cinerea
          ATCC 14685]
          Length = 96

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 50/95 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV +IA  SR+ +  E+    L  LN+  S++E++  +N +G+EPM       +
Sbjct: 1  MALTLADVDKIARLSRLHLSSEEKEKSLQELNDIFSMVEQMQNINTDGIEPMAHPYEAAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D+     + AP V    ++VP+ +E
Sbjct: 61 RLREDEVTETDRAAEYQAVAPEVRNRLYIVPQVIE 95


>gi|77166093|ref|YP_344618.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Nitrosococcus
          oceani ATCC 19707]
 gi|254434987|ref|ZP_05048494.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Nitrosococcus
          oceani AFC27]
 gi|123593493|sp|Q3J7V8|GATC_NITOC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|76884407|gb|ABA59088.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Nitrosococcus oceani ATCC 19707]
 gi|207088098|gb|EDZ65370.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Nitrosococcus
          oceani AFC27]
          Length = 95

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DV+ IAH +R++I  E IP +   L+  L  + ++++V+   +EPM   +    
Sbjct: 1  MTLKTADVEYIAHLARLAIDSEAIPHYKHDLSRILEFVGQMNKVDTTNIEPMAHPLDAIQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD V + D+  +  S AP VE   +++PK ++
Sbjct: 61 RLRPDEVTESDQWRTFQSIAPQVEAGVYLIPKVID 95


>gi|289676053|ref|ZP_06496943.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. syringae FF5]
 gi|330937963|gb|EGH41750.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Pseudomonas
          syringae pv. pisi str. 1704B]
          Length = 95

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV++IAH +R+ + + DIP     LN+ L +++++  V+  G+EP+   +    
Sbjct: 1  MALERSDVEKIAHLARLGLNDADIPRTTEALNSILGLVDQMQAVDTIGIEPLAHPLEATQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + ++ ++  + AP V+   ++VPK +E
Sbjct: 61 RLREDAVTERNRRDTYQAIAPAVQDGLYLVPKVIE 95


>gi|228989483|ref|ZP_04149468.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus pseudomycoides DSM 12442]
 gi|228995677|ref|ZP_04155340.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus mycoides Rock3-17]
 gi|229003306|ref|ZP_04161136.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus mycoides Rock1-4]
 gi|228757924|gb|EEM07139.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus mycoides Rock1-4]
 gi|228764054|gb|EEM12938.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus mycoides Rock3-17]
 gi|228770208|gb|EEM18787.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus pseudomycoides DSM 12442]
          Length = 96

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 55/93 (59%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I V +VK +AH +R++I +++   F  +L+  ++  E+++E++  GV+P   V+ MK + 
Sbjct: 4  ISVENVKHVAHLARLAITDQEAEKFQKQLDAIVTFAEQLNELDTTGVKPTTHVLDMKNIM 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          R DV   G  VE +L NAP  + N   VP  +E
Sbjct: 64 REDVPEKGLPVEEVLKNAPDHKDNQIRVPAVLE 96


>gi|42521705|ref|NP_967085.1| glutamyl-tRNA(Gln) amidotransferase (subunit C) [Bdellovibrio
          bacteriovorus HD100]
 gi|39574235|emb|CAE77739.1| glutamyl-tRNA(Gln) amidotransferase (subunit C) [Bdellovibrio
          bacteriovorus HD100]
          Length = 93

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 48/90 (53%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   ++ IA  +R+ I E++   +  +L   L+  E+IS++N  G+EPMV+   ++  
Sbjct: 1  MIDKKAIEHIAKLARLHITEDEAQEYSTQLAKALTHFEQISKINTAGIEPMVTPTEIEAY 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
           R DVV      E +  NAP    N F VP
Sbjct: 61 WREDVVKQDFTAEEMTGNAPDRAGNLFKVP 90


>gi|206889251|ref|YP_002249663.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|229487562|sp|B5YHS7|GATC_THEYD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|206741189|gb|ACI20246.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 95

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +VK IA  SR+ + EE+I ++  +L+  L  +EK++E++   VEP   V+ +K 
Sbjct: 1  MKISKEEVKHIAMLSRLELNEEEIGVYQEQLSRILDYIEKLNEIDTTLVEPTSHVIELKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V      +  L NAP     FF VPK +E
Sbjct: 61 VFRDDNVKGSISRDEALKNAPDQTDKFFRVPKIIE 95


>gi|187736270|ref|YP_001878382.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Akkermansia
          muciniphila ATCC BAA-835]
 gi|229487474|sp|B2UMP5|GATC_AKKM8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|187426322|gb|ACD05601.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Akkermansia
          muciniphila ATCC BAA-835]
          Length = 97

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 46/90 (51%)

Query: 6  VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD 65
          +DV  IA  +RI + EE+  LF   L+  L+ + K+   +V G+ PM   +P   V R D
Sbjct: 6  IDVAYIAKLARIDLTEEETALFSKDLDKVLAYITKLESYDVTGIAPMNHPLPAMDVMRED 65

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +   G   E  LSNAP   +  F  PK VE
Sbjct: 66 IPETGFTQEEALSNAPQQSQGQFRTPKVVE 95


>gi|254422873|ref|ZP_05036591.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Synechococcus sp.
          PCC 7335]
 gi|196190362|gb|EDX85326.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Synechococcus sp.
          PCC 7335]
          Length = 96

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 53/91 (58%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID+  V+++A+ +R+ + E +   F  +LN  L  ++++ E++   V P    + +  +
Sbjct: 1  MIDIDQVRKVANLARLELSESEQAQFTDQLNGILEYVQQLDELDTTDVPPTTRAIEVSNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           RPD +    + ESIL +AP  E+NFF VPK
Sbjct: 61 TRPDRLEVFAERESILDSAPDREENFFRVPK 91


>gi|297172137|gb|ADI23118.1| Asp-tRNAAsn/glu-tRNAGln amidotransferase C subunit [uncultured
          gamma proteobacterium HF0770_09E07]
          Length = 93

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 59/93 (63%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          +D +++K +   +RI I++ + P  L +L NT  ++++++E+N++ +EP+ + + +  V 
Sbjct: 1  MDKIELKNLLFLARIGIEDREHPKILEKLKNTFDLIDEMNELNLDNIEPLNNPLELNNVS 60

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          R D   D +  ++ L  +P  ++++F+VPK +E
Sbjct: 61 REDSDNDRNTKKNFLEGSPESDEDYFIVPKIIE 93


>gi|114327614|ref|YP_744772.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Granulibacter bethesdensis CGDNIH1]
 gi|114315788|gb|ABI61848.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Granulibacter bethesdensis CGDNIH1]
          Length = 128

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 56/111 (50%), Gaps = 20/111 (18%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNV---EGVEPM----- 52
           M +D   V+RIA  +RI + E D+      LN  L  ++++  V+V   +G+ PM     
Sbjct: 22  MALDTGVVRRIARLARIHVDEADLGALQGELNAILGWVDQLEAVDVSAVDGIAPMTGPAD 81

Query: 53  --------VSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
                   ++V PM    R DVV +GD  + +L+NAP     FF VPK VE
Sbjct: 82  IQADGETSLAVAPM----RDDVVTEGDLSDKVLANAPDRAGPFFAVPKVVE 128


>gi|254283838|ref|ZP_04958806.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [gamma
          proteobacterium NOR51-B]
 gi|219680041|gb|EED36390.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [gamma
          proteobacterium NOR51-B]
          Length = 95

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 51/89 (57%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV +IAH +R+ I E ++   + R    L +++++  V+V    PM +        RPDV
Sbjct: 7  DVVQIAHLARLEIAENELDTVVERFGRILELVDELQAVDVSDTAPMSNPHDDIQRLRPDV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V  GD  E++ S AP VE+ +F+VPK ++
Sbjct: 67 VSRGDNREALQSAAPAVEEGYFLVPKVID 95


>gi|163784155|ref|ZP_02179094.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Hydrogenivirga
          sp. 128-5-R1-1]
 gi|159880574|gb|EDP74139.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Hydrogenivirga
          sp. 128-5-R1-1]
          Length = 96

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 48/93 (51%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   V +IA  S++ + E++I LF  +L   +  +EK+ E+  E + P   ++     
Sbjct: 1  MIDKDTVLKIAQLSKLQLSEKEIQLFSKQLPQIIQFIEKLEELETENILPFYELIDTPAP 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
           R D V  G   E  L NAP  E  FFVVP+ V
Sbjct: 61 LRKDEVKSGLSQEEALKNAPQAEDGFFVVPRVV 93


>gi|258514075|ref|YP_003190297.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfotomaculum
          acetoxidans DSM 771]
 gi|257777780|gb|ACV61674.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfotomaculum
          acetoxidans DSM 771]
          Length = 93

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 48/91 (52%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +I   DV+ +A   R+ + EE+   +  +LN  L   + + +++ E V P    +PM+ V
Sbjct: 1  MITKADVEHVALLGRLYLSEEEKERYTDQLNAILEYAQMLQKLDTENVPPTAHALPMQNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D   D    E +LSNAP  E+ +F VPK
Sbjct: 61 FREDCAGDCLTNEEVLSNAPEREEEYFKVPK 91


>gi|119896465|ref|YP_931678.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Azoarcus sp.
          BH72]
 gi|166198837|sp|A1K1T6|GATC_AZOSB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|119668878|emb|CAL92791.1| glutamyl-tRNA(GLN) amidotransferase subunit C [Azoarcus sp. BH72]
          Length = 95

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 47/88 (53%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V RIA  +R++I E +I     +L+    ++E++  V+  GVEPM     +    R DVV
Sbjct: 8  VGRIARLARLAISEGEIDAVRAKLDGIFGLIEQMQAVDTAGVEPMSHPQELATRLRDDVV 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + D+  +  S AP  E   ++VPK +E
Sbjct: 68 TETDRRSAFQSVAPQTEAGLYLVPKVIE 95


>gi|218246966|ref|YP_002372337.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Cyanothece sp. PCC
          8801]
 gi|226709615|sp|B7K034|GATC_CYAP8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|218167444|gb|ACK66181.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Cyanothece sp.
          PCC 8801]
          Length = 98

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 50/91 (54%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +I+   V++IAH +R+ I   +   F  +LN+ L   +++SE++ E V PM   + +  +
Sbjct: 1  MINRQQVEKIAHLARLEITPAEEEAFAPQLNSILQYFDQLSELDTENVPPMTRAIELSNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D        ES+L +AP  E +FF VP+
Sbjct: 61 TRSDRTETYGDRESLLKSAPEQEGDFFRVPQ 91


>gi|238926772|ref|ZP_04658532.1| glutamyl-tRNA amidotransferase subunit C [Selenomonas flueggei
          ATCC 43531]
 gi|238885304|gb|EEQ48942.1| glutamyl-tRNA amidotransferase subunit C [Selenomonas flueggei
          ATCC 43531]
          Length = 100

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   D++  AH SR+SI  E+    L  L + LS ++ +S V+ + V+P    +P++ 
Sbjct: 5  MKVTEQDLRVTAHLSRLSIPTEEKEEALASLGDFLSYVDNLSRVDTQDVQPTTYALPIEN 64

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V      E+ LSNAP  E  +F VPK +E
Sbjct: 65 VFRTDEVRPSLSNEAALSNAPLQEDGYFKVPKVLE 99


>gi|116753499|ref|YP_842617.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methanosaeta
          thermophila PT]
 gi|121693165|sp|A0B5K3|GATC_METTP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|116664950|gb|ABK13977.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Methanosaeta thermophila PT]
          Length = 93

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 49/93 (52%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +I + DV+ I+  + I + EE+    + + N  L   +++ EV+ EGVEP   VV +  V
Sbjct: 1  MITIKDVEHISWLASIRVSEEEREELVAQFNTILDYFQQLDEVDTEGVEPTYRVVDLANV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
           R DV  D    +  L NAP  E+ +F  P+ V
Sbjct: 61 FREDVPRDSLTQDEALRNAPRREEGYFRSPRIV 93


>gi|289577827|ref|YP_003476454.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Thermoanaerobacter
          italicus Ab9]
 gi|297544112|ref|YP_003676414.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Thermoanaerobacter
          mathranii subsp. mathranii str. A3]
 gi|289527540|gb|ADD01892.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermoanaerobacter italicus Ab9]
 gi|296841887|gb|ADH60403.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 95

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 53/95 (55%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  +R+   +E+I  F ++L+  +  + K++E++ E VEP   +VP+  
Sbjct: 1  MAISRSEVEHVAKLARLKFSQEEIEEFTVQLSKIIDYVNKLNELDTENVEPTAHIVPIHN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V      + IL NAP+ E   F VPK +E
Sbjct: 61 VFREDEVKPSMGRDKILMNAPYKENGCFKVPKIIE 95


>gi|15677220|ref|NP_274373.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          meningitidis MC58]
 gi|18203148|sp|Q9JZ00|GATC_NEIMB RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|7226600|gb|AAF41729.1| putative glutamyl-tRNA (Gln) amidotransferase subunit C
          [Neisseria meningitidis MC58]
 gi|254670552|emb|CBA06401.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria
          meningitidis alpha153]
 gi|254672152|emb|CBA04951.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria
          meningitidis alpha275]
 gi|308389472|gb|ADO31792.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          meningitidis alpha710]
 gi|316984161|gb|EFV63139.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Neisseria meningitidis H44/76]
 gi|325130408|gb|EGC53172.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis OX99.30304]
 gi|325134410|gb|EGC57055.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis M13399]
 gi|325136143|gb|EGC58751.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis M0579]
 gi|325136452|gb|EGC59059.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis M0579]
 gi|325140426|gb|EGC62947.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis CU385]
 gi|325142537|gb|EGC64937.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis 961-5945]
 gi|325144511|gb|EGC66810.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis M01-240013]
 gi|325198499|gb|ADY93955.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis G2136]
 gi|325200025|gb|ADY95480.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis H44/76]
 gi|325201936|gb|ADY97390.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis M01-240149]
 gi|325204348|gb|ADY99801.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis M01-240355]
 gi|325205878|gb|ADZ01331.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis M04-240196]
 gi|325208313|gb|ADZ03765.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis NZ-05/33]
          Length = 96

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV +IA  SR+ +  E+    L  LN+  +++E++  +N +G+EPM       +
Sbjct: 1  MALTLADVDKIARLSRLHLTAEEKEKSLQELNDIFTMVEQMQTINTDGIEPMAHPHEAAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D+     + AP V    ++VP+ +E
Sbjct: 61 RLREDEVTETDRAAEYQAGAPEVRNRLYIVPQVIE 95


>gi|325103368|ref|YP_004273022.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Pedobacter saltans DSM 12145]
 gi|324972216|gb|ADY51200.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Pedobacter saltans DSM 12145]
          Length = 96

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 53/94 (56%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   V++IAH SR+S+ EE+    +  L+  LS +EK++EV+VEGV P++ +     
Sbjct: 1  MKIDKETVEKIAHLSRLSLTEEEKKKSIQELSEILSFMEKLNEVDVEGVSPLIHLNDEVN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R D+       E  L NAP   + +F V K +
Sbjct: 61 VLREDIEKQELTREEALQNAPLKNEEYFKVSKVI 94


>gi|118594296|ref|ZP_01551643.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Methylophilales
          bacterium HTCC2181]
 gi|118440074|gb|EAV46701.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Methylophilales
          bacterium HTCC2181]
          Length = 95

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   D+K+IAH +RI+I  ++  L   +L   + +++++ +V+ +GVEPM   + +  
Sbjct: 1  MTISQEDIKKIAHLARINISSDESILLEKKLTGIMELIDQMQKVDTDGVEPMSHALNISQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D  +  +  AP  +++ F+VP+ +E
Sbjct: 61 PLRDDQVTESDIRKKTMPLAPETQESLFIVPQVIE 95


>gi|188585102|ref|YP_001916647.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Natranaerobius
          thermophilus JW/NM-WN-LF]
 gi|226709619|sp|B2A5W6|GATC_NATTJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|179349789|gb|ACB84059.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Natranaerobius
          thermophilus JW/NM-WN-LF]
          Length = 95

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   +V  +A   ++ + +E++ +F  +L+  L   EK+ E+++EG+EP    +  + 
Sbjct: 1  MKVSKEEVLHVAKLGQLDLDQEEVEMFQDKLSQILEWQEKLDELDLEGLEPTAHALERRN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V +    +  L NAP  E N+F VP+ +E
Sbjct: 61 VTREDQVHNSLTNDKALENAPETEGNYFKVPRIIE 95


>gi|167038088|ref|YP_001665666.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167039198|ref|YP_001662183.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Thermoanaerobacter sp. X514]
 gi|256752856|ref|ZP_05493695.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermoanaerobacter ethanolicus CCSD1]
 gi|300913207|ref|ZP_07130524.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermoanaerobacter sp. X561]
 gi|307266288|ref|ZP_07547828.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermoanaerobacter wiegelii Rt8.B1]
 gi|307723779|ref|YP_003903530.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Thermoanaerobacter
          sp. X513]
 gi|320116495|ref|YP_004186654.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Thermoanaerobacter
          brockii subsp. finnii Ako-1]
 gi|326390896|ref|ZP_08212447.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermoanaerobacter ethanolicus JW 200]
 gi|229487559|sp|B0KBN5|GATC_THEP3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|229487560|sp|B0K3S2|GATC_THEPX RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|166853438|gb|ABY91847.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermoanaerobacter sp. X514]
 gi|166856922|gb|ABY95330.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256748258|gb|EEU61323.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889892|gb|EFK85037.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermoanaerobacter sp. X561]
 gi|306918666|gb|EFN48900.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermoanaerobacter wiegelii Rt8.B1]
 gi|307580840|gb|ADN54239.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermoanaerobacter sp. X513]
 gi|319929586|gb|ADV80271.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|325993044|gb|EGD51485.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermoanaerobacter ethanolicus JW 200]
          Length = 95

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 53/95 (55%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  +R+   +E+I  F ++L+  +  + K++E++ E VEP   +VP+  
Sbjct: 1  MAISRSEVEHVAKLARLKFSQEEIEEFTVQLSKIIDYVNKLNELDTENVEPTAHIVPIHN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V      + IL NAP+ E   F VPK +E
Sbjct: 61 VFREDEVKPSMDRDKILMNAPYKENGCFKVPKIIE 95


>gi|220933700|ref|YP_002512599.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thioalkalivibrio
          sp. HL-EbGR7]
 gi|254791022|sp|B8GL94|GATC_THISH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|219995010|gb|ACL71612.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thioalkalivibrio
          sp. HL-EbGR7]
          Length = 95

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 48/89 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV++IAH +R+++ + D+  +   L++ L  +E++  V  + V PM          R D 
Sbjct: 7  DVRKIAHLARLAVSDADVEAYARSLSSILDFVEQMEAVKTDHVAPMAHPQDTAQRLRDDA 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V + D+ E   S AP VE   ++VPK +E
Sbjct: 67 VSEADQRERFQSIAPAVEAGLYLVPKVIE 95


>gi|225025271|ref|ZP_03714463.1| hypothetical protein EIKCOROL_02168 [Eikenella corrodens ATCC
          23834]
 gi|224942029|gb|EEG23238.1| hypothetical protein EIKCOROL_02168 [Eikenella corrodens ATCC
          23834]
          Length = 96

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV++IA  SR+S+ E +    L  LN   +++E++  VN +G+EPM     + +
Sbjct: 1  MSLTLSDVEKIARLSRLSLTEAEKASTLDELNGIFAMVEQMQSVNTDGIEPMTHPHELAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D      + AP V    ++VP+ +E
Sbjct: 61 RLRADQVTETDHAAEYQAVAPEVHNRLYIVPQVIE 95


>gi|240128377|ref|ZP_04741038.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          gonorrhoeae SK-93-1035]
 gi|268686775|ref|ZP_06153637.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          gonorrhoeae SK-93-1035]
 gi|268627059|gb|EEZ59459.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          gonorrhoeae SK-93-1035]
          Length = 96

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV +IA  SR+ +  E+    L  LN+  +++E++  +N +G+EPM     + +
Sbjct: 1  MALTLADVDKIARLSRLQLTAEEKEKSLQELNDIFTMVEQMQNINTDGIEPMAHPHEVAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D+     + AP V    F+VP+ +E
Sbjct: 61 RLREDEVTETDRAAEYQAVAPEVRNRLFIVPQVIE 95


>gi|20807101|ref|NP_622272.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Thermoanaerobacter tengcongensis MB4]
 gi|39931601|sp|Q8RC41|GATC_THETN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|20515593|gb|AAM23876.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit
          [Thermoanaerobacter tengcongensis MB4]
          Length = 95

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 50/95 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ IA  +R+   EE+I      L+  L  + K++E++ E VEP   +VP+  
Sbjct: 1  MAISKSEVEYIAKLARLKFTEEEIEAMAQELSKILDYVNKLNELDTENVEPTAHIVPIHN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V      E +L NAP  E+  F VPK +E
Sbjct: 61 VFREDEVKPSMPREKVLMNAPFTEQGCFKVPKIIE 95


>gi|300113193|ref|YP_003759768.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Nitrosococcus
          watsonii C-113]
 gi|299539130|gb|ADJ27447.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Nitrosococcus
          watsonii C-113]
          Length = 95

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DV+ IAH +R++I  E IP +   L+  L  + ++++V+   +EPM   +    
Sbjct: 1  MTLKTADVEYIAHLARLAIDSEAIPHYRHDLSRILEFVGQMNKVDTTNIEPMAHPLDAIQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD V + D+  +  + AP VE   +++PK ++
Sbjct: 61 RLRPDEVTENDQWRTFQAIAPQVEAGVYLIPKVID 95


>gi|205372468|ref|ZP_03225281.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          coahuilensis m4-4]
          Length = 96

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 49/89 (55%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +VK +AH +R++I EE+   F  +L   +S  E+++E++   VEP   V+ MK + R D 
Sbjct: 8  EVKHVAHLARLAITEEEAEKFTEQLAKIISFAEQLNELDTTNVEPTSHVLDMKNIMREDK 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             G   E +L NAP       VVPK +E
Sbjct: 68 PGQGLPREEVLKNAPTHRDGLVVVPKVME 96


>gi|300022169|ref|YP_003754780.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Hyphomicrobium
          denitrificans ATCC 51888]
 gi|299523990|gb|ADJ22459.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Hyphomicrobium
          denitrificans ATCC 51888]
          Length = 95

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 41/66 (62%)

Query: 30 RLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFV 89
           L+  L   +++ EV+   VEPM  VV  ++  R DVV DG+  +++ +NAP  E ++FV
Sbjct: 30 ELSGILDWAQQLDEVDTSAVEPMTRVVAQELAMRDDVVNDGEIADAVTANAPLTEDHYFV 89

Query: 90 VPKAVE 95
          VPK VE
Sbjct: 90 VPKIVE 95


>gi|283852170|ref|ZP_06369443.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfovibrio sp.
          FW1012B]
 gi|283572396|gb|EFC20383.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfovibrio sp.
          FW1012B]
          Length = 94

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 50/88 (56%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V ++A  +R+ + ++ +  F  +++  L+ +E +  V+ +GVEP+ S V  +   R DV
Sbjct: 7  EVAKVAKLARLRLDDDSLEAFAGQMDGILAYMETLGAVDTDGVEPLYSPVLHETPLRADV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
                 + IL+NAP  +  FF+VPK V
Sbjct: 67 ATKACARDRILANAPATDGQFFIVPKIV 94


>gi|225375173|ref|ZP_03752394.1| hypothetical protein ROSEINA2194_00797 [Roseburia inulinivorans
          DSM 16841]
 gi|225212983|gb|EEG95337.1| hypothetical protein ROSEINA2194_00797 [Roseburia inulinivorans
          DSM 16841]
          Length = 97

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 40/60 (66%)

Query: 35 LSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          L  ++K++E++  GVEPM  V P+  V R DVV +GD  E+ LSNAP ++ + F VPK +
Sbjct: 37 LDYIDKLNELDTTGVEPMSHVFPVTNVFREDVVTNGDGSEATLSNAPSMKDSGFKVPKTI 96


>gi|313896620|ref|ZP_07830169.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
           [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320529044|ref|ZP_08030136.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Selenomonas
           artemidis F0399]
 gi|312974805|gb|EFR40271.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
           [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320138674|gb|EFW30564.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Selenomonas
           artemidis F0399]
          Length = 102

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 50/89 (56%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           D++  A  SR++I  ++    L RL + L+ ++ +S V+ EGV P    +P++ V R D 
Sbjct: 13  DLETTARLSRLAIPADERADALARLGDFLTYVDNLSGVDTEGVRPTTYALPIENVFRADE 72

Query: 67  VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           V      E+ LSNAP  E  +F VPK +E
Sbjct: 73  VRPSLPNEAALSNAPLREDGYFKVPKVLE 101


>gi|296270788|ref|YP_003653420.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Thermobispora
          bispora DSM 43833]
 gi|296093575|gb|ADG89527.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thermobispora
          bispora DSM 43833]
          Length = 99

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V  +A  SR+++ +E++  F  +L+  ++ + ++SEV  + + P    +P+  V RPD V
Sbjct: 9  VAHLARLSRLALTDEELDHFAAQLDQIVAAVARVSEVAADDIPPSSHALPLTNVFRPDEV 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPK 92
            G   E  LS AP VE N F VP+
Sbjct: 69 RPGLTPEQALSGAPAVEDNRFRVPR 93


>gi|260438088|ref|ZP_05791904.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Butyrivibrio
          crossotus DSM 2876]
 gi|292809568|gb|EFF68773.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Butyrivibrio
          crossotus DSM 2876]
          Length = 97

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 49/88 (55%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          ++ +   +++ + +ED       + + L  ++K+ E++  GVEPM  + P+  V R D +
Sbjct: 10 IEYVGILAKLELSDEDKENAKKDMASMLDYIDKLGELDTTGVEPMSHIFPVSNVMREDEI 69

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +GD  E+ L NAP    + F+VPK VE
Sbjct: 70 TNGDGSEATLRNAPERNDDAFIVPKTVE 97


>gi|319761103|ref|YP_004125040.1| glutamyl-tRNA(gln) amidotransferase, c subunit [Alicycliphilus
          denitrificans BC]
 gi|330822961|ref|YP_004386264.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Alicycliphilus
          denitrificans K601]
 gi|317115664|gb|ADU98152.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Alicycliphilus
          denitrificans BC]
 gi|329308333|gb|AEB82748.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Alicycliphilus
          denitrificans K601]
          Length = 99

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 54/99 (54%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMV-SVVPMK 59
          M +   D+ RIAH +R+ +   +    L +LN    ++EK+  V+  G+ P+   V  ++
Sbjct: 1  MALTPQDIGRIAHLARLELSPAESERMLTQLNGFFGIVEKMRAVDTGGIAPLPHPVAAIQ 60

Query: 60 MVH---RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           VH   R DV  + D+ E+   +AP VE+  F+VPK +E
Sbjct: 61 DVHLRLRDDVASEPDQREANQQSAPAVERGLFLVPKVIE 99


>gi|85860810|ref|YP_463012.1| aspartyl/glutamyl-tRNA(asn/Gln) amidotransferase subunit C
          [Syntrophus aciditrophicus SB]
 gi|123517739|sp|Q2LXN4|GATC_SYNAS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|85723901|gb|ABC78844.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit C
          [Syntrophus aciditrophicus SB]
          Length = 95

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 50/95 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +AH +R+   E ++  F  ++N  L  ++K++EV+  GVEP+   + +  
Sbjct: 1  MKISKEEVAYVAHLARLEFSESEMETFTFQMNEILLYMDKLNEVDTSGVEPLSHAIALHN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V +    +  L+NAP     FF VPK ++
Sbjct: 61 AFREDKVQESLSQDLSLANAPDPRGEFFRVPKVID 95


>gi|269798059|ref|YP_003311959.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Veillonella
          parvula DSM 2008]
 gi|282850286|ref|ZP_06259665.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Veillonella
          parvula ATCC 17745]
 gi|269094688|gb|ACZ24679.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Veillonella
          parvula DSM 2008]
 gi|282579779|gb|EFB85183.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Veillonella
          parvula ATCC 17745]
          Length = 96

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   ++K+IA  SR+ +KEE +      L++ L+ + ++  + ++GVEPM   VP+  
Sbjct: 1  MKISQEEIKKIALLSRLEVKEEHMAHVEKELSDILTYVAELDALELDGVEPMAHAVPLHN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D        E  LSNAP  E  +F VP+ V+
Sbjct: 61 VFREDEKKPSLDHELALSNAPEAEDGYFKVPRVVQ 95


>gi|296134658|ref|YP_003641900.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thiomonas
          intermedia K12]
 gi|295794780|gb|ADG29570.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thiomonas
          intermedia K12]
          Length = 99

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMV----SVV 56
          M + + D+ R+A  +R+ +   +    L  LN    V+E++  VN +GVEP+     +V 
Sbjct: 1  MSLTLPDIDRLAQLARLDLTASERDHMLTDLNAFFDVVEQMRAVNTDGVEPLAHPLSAVQ 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           M +  R D V +G+  ++ L NAP  +   F+VP+ VE
Sbjct: 61 DMPLRLREDAVTEGNIRDAALRNAPDAQDGLFLVPRVVE 99


>gi|254432793|ref|ZP_05046496.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Cyanobium sp. PCC
          7001]
 gi|197627246|gb|EDY39805.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Cyanobium sp. PCC
          7001]
          Length = 97

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 47/90 (52%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I   DV+++AH +R+++ EE I  +  +L   L  +  +  V+ EGV P    V +  V 
Sbjct: 4  ITAEDVRKVAHLARLALPEEKIATYTGQLERILEYVAHLEAVDTEGVPPTTRAVEVTNVT 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R D V   +  E +L  AP  E +FF VP+
Sbjct: 64 REDAVVATEVREELLDLAPQREGDFFRVPQ 93


>gi|39998472|ref|NP_954423.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Geobacter
          sulfurreducens PCA]
 gi|81700886|sp|Q746Y5|GATC_GEOSL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|39985419|gb|AAR36773.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Geobacter
          sulfurreducens PCA]
 gi|298507416|gb|ADI86139.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Geobacter sulfurreducens KN400]
          Length = 95

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   DV+ +A  +R+ + E++   F  +L+  L+ +EK++E++ +G+ P    VP++ 
Sbjct: 1  MKITRTDVEHVATLARLELTEDEKDRFTGQLDAILAYVEKLNELDTDGIIPTSHAVPVEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V     VE+ L+NAP   + FF VP+ +E
Sbjct: 61 AFREDEVRPSIGVENALANAPDRVEGFFRVPRVIE 95


>gi|238021992|ref|ZP_04602418.1| hypothetical protein GCWU000324_01897 [Kingella oralis ATCC
          51147]
 gi|237866606|gb|EEP67648.1| hypothetical protein GCWU000324_01897 [Kingella oralis ATCC
          51147]
          Length = 96

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV++IA  SR+++ +++    L +LN    ++EK+  VN +GVEPM     + +
Sbjct: 1  MSLTLNDVEKIAKLSRLTLSDDEKNSTLEKLNAVFELVEKMQTVNTDGVEPMAHPHEVAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D     L+ AP V    ++VP  +E
Sbjct: 61 RLREDTVTESDHATEYLAVAPEVRNRMYIVPHVIE 95


>gi|297539765|ref|YP_003675534.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Methylotenera sp.
           301]
 gi|297259112|gb|ADI30957.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylotenera sp.
           301]
          Length = 104

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 50/104 (48%), Gaps = 9/104 (8%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M + + D+K++AH +RI + E D    L +L   L ++E++  V+  G+EPM     +  
Sbjct: 1   MALSIEDIKKVAHLARIEVSESDAAATLTKLTGILGLIEQMQAVDTTGIEPMSHSQDLSQ 60

Query: 61  VHRPDVVCDGDKVESILSNAPH---------VEKNFFVVPKAVE 95
             R DVV   +  +    NAP          V    ++VPK +E
Sbjct: 61  RLRDDVVTKTNLRDEFQKNAPELGNGSTEPAVAGGLYLVPKVIE 104


>gi|121603089|ref|YP_980418.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Polaromonas
          naphthalenivorans CJ2]
 gi|166199384|sp|A1VIL9|GATC_POLNA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|120592058|gb|ABM35497.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Polaromonas naphthalenivorans CJ2]
          Length = 99

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 58/99 (58%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPM-- 58
          M +   D++R+A+ +R+ ++ ++    L +LN   +++E++  VN +GVEP+     +  
Sbjct: 1  MALTFKDIERVANLARLELRPDETEHTLSQLNGFFALVEQMQAVNTDGVEPLAHPAALLG 60

Query: 59 --KMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             +  R D+  + ++ E+  ++AP VE+  F+VPK +E
Sbjct: 61 EVALRLREDIASEPNQREASQASAPAVERGLFLVPKVIE 99


>gi|288554991|ref|YP_003426926.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          pseudofirmus OF4]
 gi|288546151|gb|ADC50034.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          pseudofirmus OF4]
          Length = 96

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 52/89 (58%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I   +VK +A+ +R++I EE+  +F  +L+  ++  E+++E++  GVEP   V+ MK V 
Sbjct: 4  ISTDEVKHVANLARLAITEEEAEMFQGQLDAIITFAEQLNELDTTGVEPTSHVLDMKNVL 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          R D   +G  ++ +L NAP  E     VP
Sbjct: 64 REDKPAEGLPIKDVLKNAPDHEDGHIRVP 92


>gi|302392791|ref|YP_003828611.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Acetohalobium arabaticum DSM 5501]
 gi|302204868|gb|ADL13546.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Acetohalobium arabaticum DSM 5501]
          Length = 98

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   V+++A  +R+ + E+       +LN+ L   +K++E++ E VEP    +P+K 
Sbjct: 1  MKIDETTVEKVAMLARLELDEDKKEEMTEQLNDILEYADKLNELDTEDVEPTAHALPIKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V +    E+ L NAP  E   F VP+ ++
Sbjct: 61 VFREDKVEESLDREAALKNAPEREDGSFKVPQIID 95


>gi|59801090|ref|YP_207802.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          gonorrhoeae FA 1090]
 gi|194098806|ref|YP_002001869.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          gonorrhoeae NCCP11945]
 gi|239999097|ref|ZP_04719021.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          gonorrhoeae 35/02]
 gi|240013996|ref|ZP_04720909.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          gonorrhoeae DGI18]
 gi|240016437|ref|ZP_04722977.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          gonorrhoeae FA6140]
 gi|240080556|ref|ZP_04725099.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          gonorrhoeae FA19]
 gi|240113074|ref|ZP_04727564.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          gonorrhoeae MS11]
 gi|240115830|ref|ZP_04729892.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          gonorrhoeae PID18]
 gi|240118128|ref|ZP_04732190.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          gonorrhoeae PID1]
 gi|240121562|ref|ZP_04734524.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          gonorrhoeae PID24-1]
 gi|240123677|ref|ZP_04736633.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          gonorrhoeae PID332]
 gi|240125867|ref|ZP_04738753.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          gonorrhoeae SK-92-679]
 gi|254493875|ref|ZP_05107046.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          gonorrhoeae 1291]
 gi|260440354|ref|ZP_05794170.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          gonorrhoeae DGI2]
 gi|268594935|ref|ZP_06129102.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Neisseria gonorrhoeae 35/02]
 gi|268596686|ref|ZP_06130853.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Neisseria gonorrhoeae FA19]
 gi|268599160|ref|ZP_06133327.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          gonorrhoeae MS11]
 gi|268601506|ref|ZP_06135673.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          gonorrhoeae PID18]
 gi|268603844|ref|ZP_06138011.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          gonorrhoeae PID1]
 gi|268682308|ref|ZP_06149170.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          gonorrhoeae PID332]
 gi|268684465|ref|ZP_06151327.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          gonorrhoeae SK-92-679]
 gi|291043649|ref|ZP_06569365.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Neisseria gonorrhoeae DGI2]
 gi|293398952|ref|ZP_06643117.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Neisseria gonorrhoeae F62]
 gi|75432517|sp|Q5F8U7|GATC_NEIG1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|229487522|sp|B4RM84|GATC_NEIG2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|59717985|gb|AAW89390.1| putative Glu-tRNA(Gln) amidotransferase subunit [Neisseria
          gonorrhoeae FA 1090]
 gi|193934096|gb|ACF29920.1| putative Glu-tRNA(Gln) amidotransferase subunit [Neisseria
          gonorrhoeae NCCP11945]
 gi|226512915|gb|EEH62260.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          gonorrhoeae 1291]
 gi|268548324|gb|EEZ43742.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Neisseria gonorrhoeae 35/02]
 gi|268550474|gb|EEZ45493.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Neisseria gonorrhoeae FA19]
 gi|268583291|gb|EEZ47967.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          gonorrhoeae MS11]
 gi|268585637|gb|EEZ50313.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          gonorrhoeae PID18]
 gi|268587975|gb|EEZ52651.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          gonorrhoeae PID1]
 gi|268622592|gb|EEZ54992.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          gonorrhoeae PID332]
 gi|268624749|gb|EEZ57149.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          gonorrhoeae SK-92-679]
 gi|291012112|gb|EFE04101.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Neisseria gonorrhoeae DGI2]
 gi|291610366|gb|EFF39476.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Neisseria gonorrhoeae F62]
 gi|317164388|gb|ADV07929.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          gonorrhoeae TCDC-NG08107]
          Length = 96

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV +IA  SR+ +  E+    L  LN+  +++E++  +N +G+EPM     + +
Sbjct: 1  MALTLADVDKIARLSRLQLTAEEKEKSLQELNDIFTMVEQMQNINTDGIEPMAHPHEVAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D+     + AP V    ++VP+ +E
Sbjct: 61 RLREDEVTETDRAAEYQAVAPEVRNRLYIVPQVIE 95


>gi|91786132|ref|YP_547084.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Polaromonas
          sp. JS666]
 gi|123356262|sp|Q12H06|GATC_POLSJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|91695357|gb|ABE42186.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Polaromonas sp. JS666]
          Length = 99

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 60/101 (59%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM------VS 54
          M +   D+ R+A+ +R+ ++ E+    L +LN   +++E+++ VN +GVEP+      + 
Sbjct: 1  MALTSQDIARVANLARLELRPEETEHTLSQLNGFFALVEQMAAVNTDGVEPLAHPAAVIG 60

Query: 55 VVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           V +++  R D+  + ++ E+   +AP VE+  F+VPK +E
Sbjct: 61 EVALRL--RDDIASEPNQREASQVSAPAVERGLFLVPKVIE 99


>gi|291004704|ref|ZP_06562677.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Saccharopolyspora erythraea NRRL 2338]
          Length = 99

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+++ E+++  F  +L+  L  + K+ +V  E + P    VP+  V R DV
Sbjct: 8  EVAHLAGLARLAVTEQELDTFAGQLDQILDAVAKVGQVAAEDIPPTSHAVPVTNVFREDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V  G   E  LS AP  E+N F VP+
Sbjct: 68 VRPGLSREQALSGAPAAEENRFRVPR 93


>gi|82701455|ref|YP_411021.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Nitrosospira
          multiformis ATCC 25196]
 gi|123545136|sp|Q2YC92|GATC_NITMU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|82409520|gb|ABB73629.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Nitrosospira multiformis ATCC 25196]
          Length = 95

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DVKR+A+ +RI I E++    L++L+    ++E++  V+V  + PM     +  
Sbjct: 1  MSLSLDDVKRVANLARIEISEDEARKALIQLSGIFGLIEQMQAVDVSAITPMSHAQDVMQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D   + D+ E   S AP VE   ++VPK +E
Sbjct: 61 RLRADGATEIDQRELFQSVAPQVEAGLYLVPKVIE 95


>gi|294791933|ref|ZP_06757081.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Veillonella sp.
          6_1_27]
 gi|294793796|ref|ZP_06758933.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Veillonella sp.
          3_1_44]
 gi|294455366|gb|EFG23738.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Veillonella sp.
          3_1_44]
 gi|294457163|gb|EFG25525.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Veillonella sp.
          6_1_27]
          Length = 96

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   ++K+IA  SR+ +KEE +      L++ L+ + ++  + ++GVEPM   VP+  
Sbjct: 1  MKISQEEIKKIALLSRLEVKEEHMAHVEKELSDILTYVAELDALELDGVEPMAHAVPLHN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D        +  LSNAP  E  +F VP+ V+
Sbjct: 61 VFREDETKPSLDHDLALSNAPEAEDGYFKVPRVVQ 95


>gi|298368772|ref|ZP_06980090.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria sp.
          oral taxon 014 str. F0314]
 gi|298282775|gb|EFI24262.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria sp.
          oral taxon 014 str. F0314]
          Length = 96

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV++IA  SR+ + + +    L  LN+  +++EK+  VN +G+EPM       +
Sbjct: 1  MALTLNDVEKIARLSRLYLDDGEKAQTLQELNDIFAMVEKMQSVNTDGIEPMAHPHEAAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D + + D+     S AP V    ++VP+ +E
Sbjct: 61 RLREDKITETDRAAEYQSVAPEVHNRLYIVPQVIE 95


>gi|238019227|ref|ZP_04599653.1| hypothetical protein VEIDISOL_01091 [Veillonella dispar ATCC 17748]
 gi|237863926|gb|EEP65216.1| hypothetical protein VEIDISOL_01091 [Veillonella dispar ATCC 17748]
          Length = 102

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 52/95 (54%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M I   ++K+IA  SR+ +KEE +      L++ L+ + ++  + ++GVEPM   VP+  
Sbjct: 7   MKISQEEIKKIALLSRLEVKEEHMAHVEKELSDILTYVAELDALELDGVEPMAHAVPLHN 66

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           V R D        +  LSNAP  E  +F VP+ V+
Sbjct: 67  VFREDETKPSLDHDLALSNAPEAEDGYFKVPRVVQ 101


>gi|134102611|ref|YP_001108272.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
           [Saccharopolyspora erythraea NRRL 2338]
 gi|133915234|emb|CAM05347.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Saccharopolyspora
           erythraea NRRL 2338]
          Length = 115

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           +V  +A  +R+++ E+++  F  +L+  L  + K+ +V  E + P    VP+  V R DV
Sbjct: 24  EVAHLAGLARLAVTEQELDTFAGQLDQILDAVAKVGQVAAEDIPPTSHAVPVTNVFREDV 83

Query: 67  VCDGDKVESILSNAPHVEKNFFVVPK 92
           V  G   E  LS AP  E+N F VP+
Sbjct: 84  VRPGLSREQALSGAPAAEENRFRVPR 109


>gi|189426241|ref|YP_001953418.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Geobacter lovleyi
          SZ]
 gi|229487472|sp|B3EA23|GATC_GEOLS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|189422500|gb|ACD96898.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Geobacter lovleyi
          SZ]
          Length = 95

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 54/95 (56%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I+  +++ +A  +R+++++++  LF  ++   L+ +E ++E+N + + P    VPM+ 
Sbjct: 1  MSINQHEIEHVAKLARLTLRDDEKQLFTGQMEAILAYVETLNELNTDDIAPTSHAVPMEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD V      +  L+NAP   + +F VP  +E
Sbjct: 61 AFRPDCVAPSIGHDRALANAPDKNETYFRVPPVIE 95


>gi|254409360|ref|ZP_05023141.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Microcoleus
          chthonoplastes PCC 7420]
 gi|196183357|gb|EDX78340.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Microcoleus
          chthonoplastes PCC 7420]
          Length = 97

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 54/91 (59%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID+  V+++A+ +R+ +  E+   FL +LN+ L   +++SE++ E V P    + +  V
Sbjct: 1  MIDLEQVRKVANLARLELTPEEEEQFLPQLNSILEYFQQLSELDTENVPPTTRAIDVSNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           RPD +      +++L+ +P  + +FF VP+
Sbjct: 61 TRPDQLQRYPARDALLAESPDQDGDFFKVPQ 91


>gi|269214397|ref|ZP_05986480.2| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria
          lactamica ATCC 23970]
 gi|269209990|gb|EEZ76445.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria
          lactamica ATCC 23970]
          Length = 99

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV +IA  SR+ +  E+    L  LN+  +++E++  +N +G+EPM       +
Sbjct: 4  MALTLADVDKIARLSRLHLTAEEKEKSLQELNDIFAIVEQMQTINTDGIEPMAHPHEAAL 63

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D+     + AP V    ++VP+ +E
Sbjct: 64 RLREDEVTETDRAAEYQAVAPEVRNRLYIVPQVIE 98


>gi|262038777|ref|ZP_06012131.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Leptotrichia
          goodfellowii F0264]
 gi|261747188|gb|EEY34673.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Leptotrichia
          goodfellowii F0264]
          Length = 100

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 52/88 (59%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV +IA  S++  +E++I  F   LN  L  +E ++ V+  GVEP+ +V+ +K   R D 
Sbjct: 6  DVLKIAKLSKLEFQEDEIEKFQTDLNKILEHMEILNNVDTTGVEPLFNVLDLKDRLRKDE 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V   D  + +L NAP+ + +F +VPK V
Sbjct: 66 VQSVDIKKELLKNAPNKDDDFIIVPKIV 93


>gi|152974138|ref|YP_001373655.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          cereus subsp. cytotoxis NVH 391-98]
 gi|189045156|sp|A7GKK2|GATC_BACCN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|152022890|gb|ABS20660.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          cytotoxicus NVH 391-98]
          Length = 96

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 55/93 (59%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I V +VK +AH +R++I +++   F  +L+  ++  E+++E++   V+P   V+ M+ V 
Sbjct: 4  ISVENVKHVAHLARLAITDQEAEKFQKQLDAIVTFAEQLNELDTTNVKPTTHVLTMRNVM 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          R DV   G  VE +L NAP  ++N   VP  +E
Sbjct: 64 REDVPEQGLPVEEVLKNAPDHKENQIRVPAVLE 96


>gi|113477967|ref|YP_724028.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Trichodesmium
          erythraeum IMS101]
 gi|110169015|gb|ABG53555.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Trichodesmium erythraeum IMS101]
          Length = 97

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 51/92 (55%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M+ID   V+++AH +R+ +  E+  +F  +L++ L   E++SE++ E V P    + +  
Sbjct: 1  MIIDNEQVRKVAHLARLELDSEEEEMFTTQLSSILEYFEQLSELDTEIVPPTTRAIDVNN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          V R D +      E ILS AP    +FF VPK
Sbjct: 61 VTRKDSLEPFPYREDILSCAPEQNGDFFKVPK 92


>gi|294788510|ref|ZP_06753752.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Simonsiella
          muelleri ATCC 29453]
 gi|294483387|gb|EFG31072.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Simonsiella
          muelleri ATCC 29453]
          Length = 96

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV++IA  SR+S+   +    L +LN   +++EK+  VN +G+EPM     + +
Sbjct: 1  MSLTINDVEKIAKLSRLSLNNTEKNATLEKLNAVFALVEKMQTVNTDGIEPMSHPHEVAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D      + AP V    ++VP+ +E
Sbjct: 61 RLRDDAVTESDHAAQYQAVAPEVRNRLYIVPQVIE 95


>gi|262277134|ref|ZP_06054927.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [alpha
          proteobacterium HIMB114]
 gi|262224237|gb|EEY74696.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [alpha
          proteobacterium HIMB114]
          Length = 95

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 53/88 (60%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK+I+  SRI+  E+     +  LN  L  +++++EV +E +EP+ S V  +++ R D V
Sbjct: 8  VKKISKLSRIASNEKFEENMIKDLNAILKFVDQLNEVKIENIEPLASTVEQELIKRDDEV 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
             ++ + IL N+P    +F+VVPK +E
Sbjct: 68 KKMNEKKDILINSPEENDDFYVVPKVIE 95


>gi|126669080|ref|ZP_01740012.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Marinobacter
          sp. ELB17]
 gi|126626458|gb|EAZ97123.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Marinobacter
          sp. ELB17]
          Length = 95

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 55/97 (56%), Gaps = 4/97 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   D++++A  +RI + +E IP     L+N LS+++++S  N + VEP+    P+  
Sbjct: 1  MTISRADIEKVAVLARIRLDDEQIPALENDLSNILSLVDQLSAANTDNVEPLAH--PLDA 58

Query: 61 VH--RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V   R D V + ++ E+  + AP  E   ++VP+ +E
Sbjct: 59 VQRLRADEVTESNQREAFQAIAPATESGLYLVPRVIE 95


>gi|206974259|ref|ZP_03235176.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          H3081.97]
 gi|229194693|ref|ZP_04321486.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus m1293]
 gi|206747499|gb|EDZ58889.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          H3081.97]
 gi|228588796|gb|EEK46821.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus m1293]
          Length = 96

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 54/93 (58%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I V +VK +AH +R++I +++   F  +L+  ++  E+++E++   V+P   V+ MK V 
Sbjct: 4  ISVENVKHVAHLARLAITDQEAEKFQKQLDAIVTFAEQLNELDTTNVKPTTHVLTMKNVM 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          R DV   G  VE +L NAP  + N   VP  +E
Sbjct: 64 REDVPEKGLPVEEVLKNAPDHKDNQIRVPAVLE 96


>gi|218440910|ref|YP_002379239.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Cyanothece sp. PCC
          7424]
 gi|226709614|sp|B7KKZ9|GATC_CYAP7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|218173638|gb|ACK72371.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Cyanothece sp.
          PCC 7424]
          Length = 98

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 48/91 (52%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   VK+IAH +R+ I  E    F  +L++ L   +++SE++   V P    + +K +
Sbjct: 1  MIDTEQVKKIAHLARLEITPEQEEQFTGQLSSILEYFDQLSELDTTDVPPTTRAIEIKNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D +      E +L  AP  E +FF VP+
Sbjct: 61 TRSDSMQPYPSREELLKEAPEQEGDFFKVPQ 91


>gi|315649452|ref|ZP_07902538.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Paenibacillus
          vortex V453]
 gi|315275140|gb|EFU38512.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Paenibacillus
          vortex V453]
          Length = 95

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 53/95 (55%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   DV+ +A  +R+++  E+  +F  +LN  L   EK++E++ EGVEP   V+ +  
Sbjct: 1  MSITDKDVQHVAKLARLNLTPEEEQMFTGQLNAILQYAEKLNELDTEGVEPTTHVLHLSN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V +   +E +L NAP  E +   VP  +E
Sbjct: 61 VMRDDEVRESLPIEKVLLNAPDEEDDQIKVPAVLE 95


>gi|313497301|gb|ADR58667.1| GatC [Pseudomonas putida BIRD-1]
          Length = 88

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 51/88 (57%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          +++IAH +R+ + + ++P     LN+ L +++++  V+  G+EP+   +      RPD V
Sbjct: 1  MEKIAHLARLGLNDGELPRITDALNSILGLVDQMQAVDTTGIEPLAHPLEASQRLRPDQV 60

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + ++ ++  + AP  E   ++VPK +E
Sbjct: 61 TESNQRDAYQAIAPSTESGLYLVPKVIE 88


>gi|119357874|ref|YP_912518.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Chlorobium
          phaeobacteroides DSM 266]
 gi|166198857|sp|A1BI67|GATC_CHLPD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|119355223|gb|ABL66094.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Chlorobium phaeobacteroides DSM 266]
          Length = 95

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 48/88 (54%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV  IA  +R+   + ++    + LNN L  ++K++EV+ EGV+P+ S+     V R D+
Sbjct: 7  DVAYIAELARLKFGDTEMETMTVELNNILHYIDKLNEVDTEGVQPLSSIHDESNVLRADI 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
                 + +L NAP  +  FF VPK +
Sbjct: 67 EKTSISTDQVLLNAPDRQDRFFKVPKVI 94


>gi|223938911|ref|ZP_03630798.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [bacterium
          Ellin514]
 gi|223892464|gb|EEF58938.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [bacterium
          Ellin514]
          Length = 95

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 46/90 (51%)

Query: 6  VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD 65
          +DV  +A  +RI++  E+      +L N L  +EK+ E++V  VEP    VP+  V RPD
Sbjct: 6  LDVNYVAKLARIALSPEEEQKLGAQLGNILGYIEKLKELDVTNVEPTAHAVPLINVTRPD 65

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
                  E  L NAP      F+VPK VE
Sbjct: 66 EPKPSLSNEDALRNAPAKANGLFLVPKIVE 95


>gi|227498769|ref|ZP_03928911.1| glutamyl-tRNA(Gln) amidotransferase [Acidaminococcus sp. D21]
 gi|226904223|gb|EEH90141.1| glutamyl-tRNA(Gln) amidotransferase [Acidaminococcus sp. D21]
          Length = 95

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   DVK IA  SR+++  +++  F  + N  L+  E + +V+  G+EP   V+P   
Sbjct: 1  MSITAKDVKHIATLSRLNVPADELEKFEDQFNQILNYAEILKQVDTTGIEPSPYVLPTSN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R DV  +G   E  + NAP      F VP+ +E
Sbjct: 61 VFREDVPQEGLSHEDAMKNAPEEHDGGFKVPRVIE 95


>gi|318042704|ref|ZP_07974660.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Synechococcus
          sp. CB0101]
          Length = 97

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+++A  +R+ + EE +  +  +L   L  ++ +  V+ EGV P    V +  V R DV
Sbjct: 8  DVRKVAKLARLDLPEEKVATYTTQLERILDYVDHLQAVDTEGVPPTTRAVEVVNVTRDDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V   +  E +L  AP  E +FF VPK
Sbjct: 68 VVPTEVREQLLEEAPQREGDFFRVPK 93


>gi|126654713|ref|ZP_01726247.1| hypothetical protein CY0110_09767 [Cyanothece sp. CCY0110]
 gi|126623448|gb|EAZ94152.1| hypothetical protein CY0110_09767 [Cyanothece sp. CCY0110]
          Length = 98

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 49/91 (53%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          ++D   V++IAH +R+ I  E+   F  +L++ L   E++ E++ E V P    V +  +
Sbjct: 1  MLDRQQVQKIAHLARLDITPEEEEQFAGQLSDILDYFEQLGELDTENVSPTTRAVELSNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D        E++L  AP+ E +FF VP+
Sbjct: 61 TRQDSSQVYSDREALLQEAPNPEDDFFRVPQ 91


>gi|90415735|ref|ZP_01223669.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [marine gamma
          proteobacterium HTCC2207]
 gi|90333058|gb|EAS48228.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [marine gamma
          proteobacterium HTCC2207]
          Length = 95

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 57/97 (58%), Gaps = 4/97 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I+  +++++A  SRI+I E+ I     RL++ L +++++  VN +GVE M    PMK 
Sbjct: 1  MSIERQEIEKLATLSRIAIGEDTITEVSQRLSSVLELVDQLQAVNTDGVEAMSH--PMKA 58

Query: 61 VHR--PDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R   D V + ++ E+  + AP  E+  F+VPK +E
Sbjct: 59 TQRLREDEVSEINQREAFQAIAPDTEEGLFLVPKVIE 95


>gi|282897069|ref|ZP_06305071.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Raphidiopsis
          brookii D9]
 gi|281197721|gb|EFA72615.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Raphidiopsis
          brookii D9]
          Length = 96

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 51/91 (56%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   V+++A+ +R+ +  ++   F L+L + L  +E++ E++V  V P    + +  V
Sbjct: 1  MIDREQVRKVANLARLELTAQEEEQFTLQLGSILEYVEQLGELDVSNVPPTTRAIDLSNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D +      ESIL +AP  E +FF VPK
Sbjct: 61 TREDKLQPYPDRESILRSAPQQEGDFFKVPK 91


>gi|296132391|ref|YP_003639638.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thermincola sp.
          JR]
 gi|296030969|gb|ADG81737.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thermincola
          potens JR]
          Length = 93

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 54/93 (58%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          ++    V+ +A  +R+ + EE+  ++  +LN+ L+ +E +++++   + P   V+P++ V
Sbjct: 1  MLTKAQVEHVALLARLELTEEEKEMYASQLNDILNHVEALNKLDTTDIPPTAHVLPLRNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
           R D VC+    E  L+NAP  E  +F VPK V
Sbjct: 61 MREDKVCEHLPNEEALANAPAREDGYFKVPKIV 93


>gi|261392370|emb|CAX49910.1| aspartyl-tRNA(Asn) amidotransferase subunit C (Asp-ADT subunit C)
          [Neisseria meningitidis 8013]
          Length = 96

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV +IA  SR+ +  E+    L  LN+  +++E++  +N +G+EPM       +
Sbjct: 1  MALTLADVDKIARLSRLHLTAEEKEKSLQELNDIFTMVEQMQTINTDGIEPMAHPHEAAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D+     + AP V    ++VP+ +E
Sbjct: 61 RLREDEVTETDRAAEYQAVAPEVRNRLYIVPQVIE 95


>gi|187922334|ref|YP_001893976.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          phytofirmans PsJN]
 gi|229487458|sp|B2T1M3|GATC_BURPP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|187713528|gb|ACD14752.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
          phytofirmans PsJN]
          Length = 99

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 56/101 (55%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DVKRIAH +R+ + + D    L++LN+   ++E++  V+  G+ P+    P++ 
Sbjct: 1  MALTLTDVKRIAHLARLELADADAEHTLVQLNDFFGLVEQMQAVDTSGIAPLAH--PIEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +       R DVV +  + E+    AP V+   ++VPK +E
Sbjct: 59 IEDVALRLRNDVVTETVEREAFQRPAPAVQDGLYLVPKVIE 99


>gi|30018558|ref|NP_830189.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          cereus ATCC 14579]
 gi|30260490|ref|NP_842867.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          anthracis str. Ames]
 gi|42779430|ref|NP_976677.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          cereus ATCC 10987]
 gi|47525585|ref|YP_016934.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          anthracis str. 'Ames Ancestor']
 gi|47569570|ref|ZP_00240248.1| glutamyl-tRNA(gln) amidotransferase, C subunit [Bacillus cereus
          G9241]
 gi|49183333|ref|YP_026585.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          anthracis str. Sterne]
 gi|49479064|ref|YP_034638.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          thuringiensis serovar konkukian str. 97-27]
 gi|52144929|ref|YP_081900.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          cereus E33L]
 gi|65317742|ref|ZP_00390701.1| COG0721: Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit
          [Bacillus anthracis str. A2012]
 gi|118476069|ref|YP_893220.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          thuringiensis str. Al Hakam]
 gi|163938310|ref|YP_001643194.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          weihenstephanensis KBAB4]
 gi|165871370|ref|ZP_02216018.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. A0488]
 gi|167634115|ref|ZP_02392437.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. A0442]
 gi|167640086|ref|ZP_02398353.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. A0193]
 gi|170688326|ref|ZP_02879535.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. A0465]
 gi|170708768|ref|ZP_02899205.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. A0389]
 gi|177653671|ref|ZP_02935810.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. A0174]
 gi|190567402|ref|ZP_03020316.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis Tsiankovskii-I]
 gi|190567507|ref|ZP_03020420.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis Tsiankovskii-I]
 gi|196034731|ref|ZP_03102139.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          W]
 gi|196040167|ref|ZP_03107469.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          NVH0597-99]
 gi|196045310|ref|ZP_03112542.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          03BB108]
 gi|206968017|ref|ZP_03228973.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          AH1134]
 gi|217957878|ref|YP_002336422.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          cereus AH187]
 gi|218234915|ref|YP_002365148.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          cereus B4264]
 gi|218895426|ref|YP_002443837.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          G9842]
 gi|218901510|ref|YP_002449344.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          AH820]
 gi|222094077|ref|YP_002528134.1| aspartyl/glutamyl-tRNA amidotransferase subunit c [Bacillus
          cereus Q1]
 gi|225862357|ref|YP_002747735.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          03BB102]
 gi|227812985|ref|YP_002812994.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. CDC 684]
 gi|228899035|ref|ZP_04063308.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis IBL 4222]
 gi|228906080|ref|ZP_04069969.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis IBL 200]
 gi|228913047|ref|ZP_04076686.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228919240|ref|ZP_04082610.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar huazhongensis BGSC
          4BD1]
 gi|228925563|ref|ZP_04088652.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar pondicheriensis BGSC
          4BA1]
 gi|228931810|ref|ZP_04094706.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar andalousiensis BGSC
          4AW1]
 gi|228937599|ref|ZP_04100237.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar berliner ATCC 10792]
 gi|228944115|ref|ZP_04106494.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228950861|ref|ZP_04112984.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar kurstaki str. T03a001]
 gi|228956737|ref|ZP_04118523.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar pakistani str. T13001]
 gi|228963400|ref|ZP_04124561.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar sotto str. T04001]
 gi|228970486|ref|ZP_04131137.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar thuringiensis str.
          T01001]
 gi|228977055|ref|ZP_04137458.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis Bt407]
 gi|228983560|ref|ZP_04143765.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|229009803|ref|ZP_04167023.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus mycoides DSM 2048]
 gi|229015700|ref|ZP_04172682.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus AH1273]
 gi|229021893|ref|ZP_04178461.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus AH1272]
 gi|229028161|ref|ZP_04184302.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus AH1271]
 gi|229042202|ref|ZP_04189956.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus AH676]
 gi|229055145|ref|ZP_04195573.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus AH603]
 gi|229068060|ref|ZP_04201368.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus F65185]
 gi|229077664|ref|ZP_04210294.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus Rock4-2]
 gi|229083600|ref|ZP_04215929.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus Rock3-44]
 gi|229089434|ref|ZP_04220705.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus Rock3-42]
 gi|229095022|ref|ZP_04226018.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus Rock3-29]
 gi|229101123|ref|ZP_04231889.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus Rock3-28]
 gi|229107976|ref|ZP_04237603.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus Rock1-15]
 gi|229113975|ref|ZP_04243401.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus Rock1-3]
 gi|229119966|ref|ZP_04249221.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus 95/8201]
 gi|229125801|ref|ZP_04254827.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus BDRD-Cer4]
 gi|229131307|ref|ZP_04260208.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus BDRD-ST196]
 gi|229137145|ref|ZP_04265764.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus BDRD-ST26]
 gi|229143102|ref|ZP_04271535.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus BDRD-ST24]
 gi|229148707|ref|ZP_04276957.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus m1550]
 gi|229154072|ref|ZP_04282197.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus ATCC 4342]
 gi|229159456|ref|ZP_04287474.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus R309803]
 gi|229165285|ref|ZP_04293072.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus AH621]
 gi|229171153|ref|ZP_04298747.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus MM3]
 gi|229176897|ref|ZP_04304293.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus 172560W]
 gi|229182701|ref|ZP_04309942.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus BGSC 6E1]
 gi|229188575|ref|ZP_04315614.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus ATCC 10876]
 gi|229601001|ref|YP_002864935.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. A0248]
 gi|254686703|ref|ZP_05150561.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          anthracis str. CNEVA-9066]
 gi|254724778|ref|ZP_05186561.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          anthracis str. A1055]
 gi|254739072|ref|ZP_05196774.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          anthracis str. Western North America USA6153]
 gi|254742306|ref|ZP_05199992.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          anthracis str. Kruger B]
 gi|254756082|ref|ZP_05208111.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          anthracis str. Vollum]
 gi|254761899|ref|ZP_05213748.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          anthracis str. Australia 94]
 gi|296501133|ref|YP_003662833.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          thuringiensis BMB171]
 gi|300118938|ref|ZP_07056649.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          cereus SJ1]
 gi|301052033|ref|YP_003790244.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          anthracis CI]
 gi|39931466|sp|Q81IN4|GATC_BACCR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|39931473|sp|Q81ZE9|GATC_BACAN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|81569973|sp|Q73EK9|GATC_BACC1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|81614010|sp|Q6HP82|GATC_BACHK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|81689698|sp|Q63GR1|GATC_BACCZ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|166198839|sp|A0R920|GATC_BACAH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|226709610|sp|B7JMB1|GATC_BACC0 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|226709611|sp|B7IUX8|GATC_BACC2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|226709612|sp|B7H4W1|GATC_BACC4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|226709613|sp|B7HSX9|GATC_BACC7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|226779779|sp|A9VRH6|GATC_BACWK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|254790982|sp|C3PBQ3|GATC_BACAA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|254790983|sp|C3L558|GATC_BACAC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|254790984|sp|C1EV87|GATC_BACC3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|254790985|sp|B9J1M9|GATC_BACCQ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|29894099|gb|AAP07390.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Bacillus cereus
          ATCC 14579]
 gi|30253858|gb|AAP24353.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. Ames]
 gi|42735346|gb|AAS39285.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          ATCC 10987]
 gi|47500733|gb|AAT29409.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. 'Ames Ancestor']
 gi|47553753|gb|EAL12126.1| glutamyl-tRNA(gln) amidotransferase, C subunit [Bacillus cereus
          G9241]
 gi|49177260|gb|AAT52636.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. Sterne]
 gi|49330620|gb|AAT61266.1| glutaminyl-tRNA synthase, glutamine-hydrolyzing, subunit C
          (glutamyl-tRNA(Gln) amidotransferase, subunit C)
          [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|51978398|gb|AAU19948.1| glutaminyl-tRNA synthase, glutamine-hydrolyzing, subunit C
          (glutamyl-tRNA(Gln) amidotransferase, subunit C)
          [Bacillus cereus E33L]
 gi|118415294|gb|ABK83713.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis str. Al Hakam]
 gi|163860507|gb|ABY41566.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          weihenstephanensis KBAB4]
 gi|164712854|gb|EDR18383.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. A0488]
 gi|167511897|gb|EDR87276.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. A0193]
 gi|167530429|gb|EDR93144.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. A0442]
 gi|170126347|gb|EDS95237.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. A0389]
 gi|170667658|gb|EDT18412.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. A0465]
 gi|172081251|gb|EDT66326.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. A0174]
 gi|190561294|gb|EDV15266.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis Tsiankovskii-I]
 gi|190561529|gb|EDV15500.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis Tsiankovskii-I]
 gi|195992774|gb|EDX56734.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          W]
 gi|196023894|gb|EDX62569.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          03BB108]
 gi|196029022|gb|EDX67627.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          NVH0597-99]
 gi|206736937|gb|EDZ54084.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          AH1134]
 gi|217066499|gb|ACJ80749.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          AH187]
 gi|218162872|gb|ACK62864.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          B4264]
 gi|218538437|gb|ACK90835.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          AH820]
 gi|218541727|gb|ACK94121.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          G9842]
 gi|221238132|gb|ACM10842.1| glutaminyl-tRNA synthase, glutamine-hydrolyzing, subunit C
          (glutamyl-tRNA(Gln) amidotransferase, subunit C)
          [Bacillus cereus Q1]
 gi|225789529|gb|ACO29746.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus cereus
          03BB102]
 gi|227005201|gb|ACP14944.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. CDC 684]
 gi|228594764|gb|EEK52544.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus ATCC 10876]
 gi|228600786|gb|EEK58365.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus BGSC 6E1]
 gi|228606570|gb|EEK63995.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus 172560W]
 gi|228612331|gb|EEK69559.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus MM3]
 gi|228618110|gb|EEK75148.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus AH621]
 gi|228624027|gb|EEK80835.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus R309803]
 gi|228629352|gb|EEK86054.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus ATCC 4342]
 gi|228634715|gb|EEK91294.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus m1550]
 gi|228640375|gb|EEK96772.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus BDRD-ST24]
 gi|228646317|gb|EEL02532.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus BDRD-ST26]
 gi|228652128|gb|EEL08064.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus BDRD-ST196]
 gi|228657658|gb|EEL13470.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus BDRD-Cer4]
 gi|228663432|gb|EEL19017.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus 95/8201]
 gi|228669434|gb|EEL24850.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus Rock1-3]
 gi|228675479|gb|EEL30696.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus Rock1-15]
 gi|228682251|gb|EEL36362.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus Rock3-28]
 gi|228688352|gb|EEL42234.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus Rock3-29]
 gi|228693911|gb|EEL47603.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus Rock3-42]
 gi|228699732|gb|EEL52388.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus Rock3-44]
 gi|228705605|gb|EEL57961.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus Rock4-2]
 gi|228715068|gb|EEL66935.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus F65185]
 gi|228721221|gb|EEL72750.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus AH603]
 gi|228727137|gb|EEL78340.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus AH676]
 gi|228733109|gb|EEL83950.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus AH1271]
 gi|228739412|gb|EEL89840.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus AH1272]
 gi|228745557|gb|EEL95577.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus cereus AH1273]
 gi|228751421|gb|EEM01227.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus mycoides DSM 2048]
 gi|228776156|gb|EEM24517.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|228782672|gb|EEM30847.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis Bt407]
 gi|228789218|gb|EEM37146.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar thuringiensis str.
          T01001]
 gi|228796294|gb|EEM43741.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar sotto str. T04001]
 gi|228802925|gb|EEM49757.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar pakistani str. T13001]
 gi|228808790|gb|EEM55286.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar kurstaki str. T03a001]
 gi|228815504|gb|EEM61746.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228822080|gb|EEM68070.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar berliner ATCC 10792]
 gi|228827790|gb|EEM73528.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar andalousiensis BGSC
          4AW1]
 gi|228834041|gb|EEM79589.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar pondicheriensis BGSC
          4BA1]
 gi|228840347|gb|EEM85618.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar huazhongensis BGSC
          4BD1]
 gi|228846452|gb|EEM91465.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228853489|gb|EEM98257.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis IBL 200]
 gi|228860610|gb|EEN04997.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bacillus thuringiensis IBL 4222]
 gi|229265409|gb|ACQ47046.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          anthracis str. A0248]
 gi|296322185|gb|ADH05113.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          thuringiensis BMB171]
 gi|298723554|gb|EFI64285.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          cereus SJ1]
 gi|300374202|gb|ADK03106.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          cereus biovar anthracis str. CI]
 gi|324324320|gb|ADY19580.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          thuringiensis serovar finitimus YBT-020]
 gi|326938092|gb|AEA13988.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          thuringiensis serovar chinensis CT-43]
          Length = 96

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 54/93 (58%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I V +VK +AH +R++I +++   F  +L+  ++  E+++E++   V+P   V+ MK V 
Sbjct: 4  ISVENVKHVAHLARLAITDQEAEKFQKQLDAIVTFAEQLNELDTTDVKPTTHVLTMKNVM 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          R DV   G  VE +L NAP  + N   VP  +E
Sbjct: 64 REDVPEKGLPVEEVLKNAPDHKDNQIRVPAVLE 96


>gi|56962868|ref|YP_174595.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus
          clausii KSM-K16]
 gi|81600997|sp|Q5WJ21|GATC_BACSK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|56909107|dbj|BAD63634.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Bacillus clausii
          KSM-K16]
          Length = 95

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 48/84 (57%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK +AH +R++I EE+   F  +L + ++  E+++EV+ EGV P   V+ M  V R D  
Sbjct: 9  VKHVAHLARLAITEEEAETFRNQLEDIITAAEQLNEVDTEGVVPTTHVLQMHNVLREDKP 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVP 91
            G +V+ +L NAP  E     VP
Sbjct: 69 EKGLEVKEVLKNAPDHEDGQIRVP 92


>gi|254805148|ref|YP_003083369.1| glutamyl-tRNA(GLN) amidotransferase subunit C [Neisseria
          meningitidis alpha14]
 gi|254668690|emb|CBA06427.1| glutamyl-tRNA(GLN) amidotransferase subunit C [Neisseria
          meningitidis alpha14]
 gi|309378843|emb|CBX22548.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 96

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV +IA  SR+ +  E+    L  LN+  +++E++  +N +G+EPM       +
Sbjct: 1  MALTLADVDKIARLSRLHLTAEEKEKSLQELNDIFAMVEQMQTINTDGIEPMAHPHEAAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D+     + AP V    ++VP+ +E
Sbjct: 61 RLREDEVTETDRAAEYQAVAPEVRNRLYIVPQVIE 95


>gi|261855847|ref|YP_003263130.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Halothiobacillus
          neapolitanus c2]
 gi|261836316|gb|ACX96083.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Halothiobacillus
          neapolitanus c2]
          Length = 95

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++   +K +AH SRI+++E  IP  +  LN  L+  E++ +  ++ + PM   +  + 
Sbjct: 1  MSLNSSQLKHVAHLSRIALEESKIPALVHDLNAILAFAEQLKDSRLDDLAPMAHPLDQQQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + ++ + +   AP  ++  F+VPK +E
Sbjct: 61 PLRADAVTETNQRDQLQKGAPAKDRGLFLVPKVIE 95


>gi|319790985|ref|YP_004152625.1| glutamyL-tRNA(gln) amidotransferase, c subunit [Variovorax
          paradoxus EPS]
 gi|315593448|gb|ADU34514.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Variovorax
          paradoxus EPS]
          Length = 99

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 54/99 (54%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM----VSVV 56
          M +D  D+ RIA  +R+ +  ++    L ++N    ++E++  V+  G+EP+     ++ 
Sbjct: 1  MSLDASDIARIASLARLQLASDESERMLSQINGFFDLVERMRSVDTAGIEPLAHPVAAIE 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + +  R DVV + D  E+   +AP VE   F+VPK +E
Sbjct: 61 DITLRLRDDVVSEPDNREANQKSAPAVEAGLFLVPKVIE 99


>gi|304387330|ref|ZP_07369522.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis ATCC 13091]
 gi|304338581|gb|EFM04699.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis ATCC 13091]
          Length = 99

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV +IA  SR+ +  E+    L  LN+  +++E++  +N +G+EPM       +
Sbjct: 4  MALTLADVDKIARLSRLHLTAEEKEKSLQELNDIFTMVEQMQNINTDGIEPMAHPHEAAL 63

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D+     + AP V    ++VP+ +E
Sbjct: 64 RLREDEVTETDRAAEYQAVAPEVRDRLYIVPQVIE 98


>gi|295110404|emb|CBL24357.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Ruminococcus obeum A2-162]
          Length = 97

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 53/93 (56%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   ++ +   +++S+ EE        +   L  +EK+ E++ +GVEP+  +   + V
Sbjct: 4  IIDDETIENVCILAKLSLNEEAKEKAKEDMQKMLDYVEKLDELDTKGVEPLSHIFGDQNV 63

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
           R DVV +GD  E++L+NAP  ++  + VPK +
Sbjct: 64 FREDVVTNGDNKEAMLANAPKAKEGQYQVPKTI 96


>gi|313893243|ref|ZP_07826818.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Veillonella sp. oral taxon 158 str. F0412]
 gi|313442139|gb|EFR60556.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Veillonella sp. oral taxon 158 str. F0412]
          Length = 96

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   ++K+IA  SR+ +KEE +      L++ LS + ++  + ++GVEPM   VP+  
Sbjct: 1  MKISQEEIKKIALLSRLEVKEEHMAHVEKELSDILSYVAELDALELDGVEPMAHAVPLHN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D +         LSNAP  E  +F VP+ V+
Sbjct: 61 VLREDEMKPSLDHYLALSNAPEAEDGYFKVPRVVQ 95


>gi|301057107|ref|ZP_07198247.1| aspartate--tRNA ligase [delta proteobacterium NaphS2]
 gi|300448788|gb|EFK12413.1| aspartate--tRNA ligase [delta proteobacterium NaphS2]
          Length = 727

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 52/94 (55%)

Query: 2   LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
           +I   +V  +A  +R+ + E++   F   LN+ L+ +E + +++ E V PM  V+ +  V
Sbjct: 633 MISGEEVNHVAKLARLELSEKETAFFQKDLNSILNYVESLKDLDTENVSPMSHVLEVNNV 692

Query: 62  HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D      + E +L NAP  EKN++ VPK +E
Sbjct: 693 WRDDRPERRKETEPLLLNAPMREKNYYKVPKILE 726


>gi|294338604|emb|CAZ86933.1| Glutamyl-tRNA(Gln) amidotransferase subunit C (Glu-ADT subunit C)
          [Thiomonas sp. 3As]
          Length = 99

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMV----SVV 56
          M + + D+ R+A  +R+ +   +    L  LN   +V+E++  VN + VEP+     +V 
Sbjct: 1  MSLTLPDIDRLAQLARLDLTASERDQLLTDLNAFFAVVEQMRAVNTDSVEPLAHPLSAVQ 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           M +  R D V +G+  ++ L NAP  +   F+VP+ VE
Sbjct: 61 DMPLRLREDAVTEGNIRDAALRNAPDAQDGLFLVPRVVE 99


>gi|257054928|ref|YP_003132760.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Saccharomonospora viridis DSM 43017]
 gi|256584800|gb|ACU95933.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Saccharomonospora viridis DSM 43017]
          Length = 99

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 48/86 (55%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          ++  +A  +R+++ EE++ LF+ RL+  L+ + K+SEV  + + PM   V +    R D 
Sbjct: 8  EIAHLAKLARMNVTEEELDLFVGRLDQVLNEVAKVSEVASDDIPPMTHAVALTNAFRDDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V  G   E  LS AP VE   F VP+
Sbjct: 68 VRPGLSQEEALSGAPAVEDGRFRVPR 93


>gi|78356068|ref|YP_387517.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Desulfovibrio desulfuricans subsp. desulfuricans str.
          G20]
 gi|123552951|sp|Q313S4|GATC_DESDG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|78218473|gb|ABB37822.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Desulfovibrio desulfuricans subsp. desulfuricans str.
          G20]
          Length = 94

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 49/94 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I    V  IA  +R+ + E+   LF  +    L  ++ ++EV+ +GV P+ S V    
Sbjct: 1  MSISKEQVAAIAGLARLQLDEDKKELFAGQFAQILEYMDTLNEVDTDGVAPLYSPVQHAT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V+R D V      E +L+NAP  +  FF+VP+ V
Sbjct: 61 VYREDEVQRHCSREQVLANAPEEDGTFFIVPRIV 94


>gi|319654353|ref|ZP_08008441.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Bacillus sp.
          2_A_57_CT2]
 gi|317394053|gb|EFV74803.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Bacillus sp.
          2_A_57_CT2]
          Length = 96

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 51/93 (54%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I +  VK +AH +R+++ EE+   +  +L+  +S  E ++E++ + VEP   V+ MK V 
Sbjct: 4  ISIDQVKHVAHLARLAMTEEEAVAYTEQLDKMISFAELLNELDTDHVEPTSHVLDMKNVL 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          R D    G   E +L NAP  +  +  VP  +E
Sbjct: 64 REDKANKGLPQEEVLKNAPEHQDGYIKVPSIIE 96


>gi|225075634|ref|ZP_03718833.1| hypothetical protein NEIFLAOT_00650 [Neisseria flavescens
          NRL30031/H210]
 gi|241759811|ref|ZP_04757911.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria
          flavescens SK114]
 gi|261380502|ref|ZP_05985075.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria
          subflava NJ9703]
 gi|319638539|ref|ZP_07993301.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria mucosa
          C102]
 gi|224953056|gb|EEG34265.1| hypothetical protein NEIFLAOT_00650 [Neisseria flavescens
          NRL30031/H210]
 gi|241319819|gb|EER56215.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria
          flavescens SK114]
 gi|284796755|gb|EFC52102.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria
          subflava NJ9703]
 gi|317400288|gb|EFV80947.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria mucosa
          C102]
          Length = 96

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV++IA  SR+++ +E+    L  LN+  +++E +  VN +G+EPM       +
Sbjct: 1  MALSLNDVEKIAKLSRLTLTDEEKNKTLAELNDIFAMVENMQSVNTDGIEPMAHPHEAAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D      + AP V    ++VP+ +E
Sbjct: 61 RLREDKVTETDHAAEYQAVAPEVRNRLYIVPQVIE 95


>gi|111023434|ref|YP_706406.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhodococcus
          jostii RHA1]
 gi|122955127|sp|Q0S2I8|GATC_RHOSR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|110822964|gb|ABG98248.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Rhodococcus jostii
          RHA1]
          Length = 99

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 51/86 (59%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ + ++  F  +L++ LS ++ ++EV  E V PM +   +  V RPDV
Sbjct: 8  EVAHLARLSRLALTDAELDEFAGQLDSILSHVKVVTEVPAEDVPPMANPNAVTNVTRPDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          +  G   E  LS AP VE+  FVVP+
Sbjct: 68 IVPGLTPEQALSGAPAVEQGRFVVPQ 93


>gi|302387683|ref|YP_003823505.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          saccharolyticum WM1]
 gi|302198311|gb|ADL05882.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          saccharolyticum WM1]
          Length = 97

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (61%)

Query: 31 LNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVV 90
          +   L  +++++E++  GVEPM  V P+  V R DVV +GD  E+IL NAP  +   F V
Sbjct: 33 MGRMLDYIDQLNELDTAGVEPMSHVFPVHNVFREDVVENGDDRENILKNAPDSKDGAFKV 92

Query: 91 PKAVE 95
          PK VE
Sbjct: 93 PKTVE 97


>gi|88807984|ref|ZP_01123495.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Synechococcus sp.
          WH 7805]
 gi|88788023|gb|EAR19179.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Synechococcus sp.
          WH 7805]
          Length = 97

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+++AH +R+ + EE I  +  +L   L  ++++  V+ EGV      V +  V R D 
Sbjct: 8  DVRKVAHLARLDLPEETIATYTGQLERILDYVDQLQAVDTEGVPATTRAVEVVNVTREDT 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V   +  E++L  AP  E +FF VPK
Sbjct: 68 VEATEVREALLDQAPLREGDFFRVPK 93


>gi|258591573|emb|CBE67874.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [NC10 bacterium
          'Dutch sediment']
          Length = 96

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 54/95 (56%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I V +V+ +A  +R+ +  ++      +L++ LS ++K++E++   VEP   V+PM  
Sbjct: 1  MKITVEEVEHVARLARLELTADEKERMRAQLDSILSYIDKLNELDTSAVEPTSHVLPMTN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V      E++L+NAP     FF VP+ +E
Sbjct: 61 VFREDEVTPSLAQEAVLANAPDRHDLFFRVPRILE 95


>gi|310778394|ref|YP_003966727.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Ilyobacter polytropus DSM 2926]
 gi|309747717|gb|ADO82379.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Ilyobacter polytropus DSM 2926]
          Length = 96

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 50/88 (56%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V ++A  +R+  K+E+I  F ++LN+ L  ++ + EV+ +GVEP++ V       R D 
Sbjct: 7  EVLKVAKLARLEFKDEEIQKFQIQLNDILGYIDILDEVDTDGVEPLIHVNEGLGKLREDE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
          +     VE  L NAP  E +  +VPK V
Sbjct: 67 IRKSFTVEEALKNAPQSEADTIIVPKVV 94


>gi|189347520|ref|YP_001944049.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Chlorobium
          limicola DSM 245]
 gi|229487459|sp|B3EG61|GATC_CHLL2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|189341667|gb|ACD91070.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Chlorobium
          limicola DSM 245]
          Length = 95

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 46/88 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV  IA  SR+   +E++      LN+ L  +EK++E++ +GVEP+  +     V R DV
Sbjct: 7  DVAYIAALSRLQFSDEEMATMTTELNSILHYVEKLNEIDTDGVEPLSGIHDQMNVLRDDV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
            +       L NAP  +  FF VPK +
Sbjct: 67 EKESIATALALQNAPDRQDRFFKVPKVI 94


>gi|88810575|ref|ZP_01125832.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Nitrococcus
          mobilis Nb-231]
 gi|88792205|gb|EAR23315.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Nitrococcus
          mobilis Nb-231]
          Length = 95

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 45/88 (51%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+ IAH +R++I   DIP +   L+  L  ++++     EG  P+   + M    R D V
Sbjct: 8  VREIAHLARLTIDGNDIPAYAENLSRILDFVDQLGSAATEGTAPLAHPLEMPQRLRADAV 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + D+ E   S AP  +   ++VPK +E
Sbjct: 68 DEEDQRELFQSIAPATQDGLYLVPKVIE 95


>gi|307544499|ref|YP_003896978.1| aspartyl-tRNA amidotransferase subunit C [Halomonas elongata DSM
          2581]
 gi|307216523|emb|CBV41793.1| aspartyl-tRNA amidotransferase subunit C [Halomonas elongata DSM
          2581]
          Length = 95

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I+  DV R AH +R+ + E +   +L  L   L +++++  ++ +GV PM   +    
Sbjct: 1  MAIEHADVLRAAHLARLGLDEGEAAHYLDDLGRILEMVDQLQALDTDGVAPMAHPLDATQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D+ +     AP VE   ++VP+ VE
Sbjct: 61 RLRADEVTETDQRDDFQRCAPAVENGLYLVPRVVE 95


>gi|295394418|ref|ZP_06804642.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Brevibacterium
          mcbrellneri ATCC 49030]
 gi|294972770|gb|EFG48621.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Brevibacterium
          mcbrellneri ATCC 49030]
          Length = 101

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 48/90 (53%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I +  V+ +A+ +RIS+ +E++      L   LS + K+SEV  + +      +P+  V 
Sbjct: 7  ITLEQVEHLANLARISMSQEELEQVSSDLGQILSSVAKVSEVATDDIPATSHPIPLTNVM 66

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          RPD V D    E  LS AP  E N F+VP+
Sbjct: 67 RPDTVADQLTAEQALSGAPAEEDNKFLVPQ 96


>gi|160895802|ref|YP_001561384.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Delftia
          acidovorans SPH-1]
 gi|229487469|sp|A9BPN0|GATC_DELAS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|160361386|gb|ABX32999.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Delftia
          acidovorans SPH-1]
          Length = 99

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 55/99 (55%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM----VSVV 56
          M ++  D+ RIA+ +R+ +   +    L +LN+   ++EK+  V+  GV P+     ++ 
Sbjct: 1  MALNAQDIARIANLARLELSSTESERMLGQLNDFFGIVEKMQAVDTSGVSPLSHPVAAIQ 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + +  R D+  + D+ ++   +AP VE+  F+VPK +E
Sbjct: 61 DIALRLREDIASEPDQRDANQRSAPAVERGLFLVPKVIE 99


>gi|255037801|ref|YP_003088422.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Dyadobacter
          fermentans DSM 18053]
 gi|254950557|gb|ACT95257.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Dyadobacter
          fermentans DSM 18053]
          Length = 95

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   + +IAH +R+ I+  +    L  +++ L+ +++++E+N +GVEP+  V+  + 
Sbjct: 1  MKIDQESLNKIAHLARLEIRPGEEAALLSSMDSVLTWMDQLNEINTQGVEPLTHVLDEEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D   +    E  L NAP     + +VPK +E
Sbjct: 61 NWREDKGANTLTREEALFNAPSKNSTYIMVPKVIE 95


>gi|171057196|ref|YP_001789545.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Leptothrix
          cholodnii SP-6]
 gi|229487514|sp|B1XY11|GATC_LEPCP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|170774641|gb|ACB32780.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Leptothrix
          cholodnii SP-6]
          Length = 99

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 53/101 (52%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DV RIA+ +R+ +   +    L++LN    ++E++  V+  GV P+ +  P+  
Sbjct: 1  MALTPADVSRIANLARLELSTAEQSDLLVQLNGFFGIVERMRAVDTTGVAPLYT--PLSA 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V       R D V + D+ E+   +AP VE   F+VP+ +E
Sbjct: 59 VQDVSLRLRDDAVTETDQREANQKSAPAVEGGLFLVPRVIE 99


>gi|160936242|ref|ZP_02083615.1| hypothetical protein CLOBOL_01138 [Clostridium bolteae ATCC
          BAA-613]
 gi|158441052|gb|EDP18776.1| hypothetical protein CLOBOL_01138 [Clostridium bolteae ATCC
          BAA-613]
          Length = 97

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (60%)

Query: 31 LNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVV 90
          +   L  ++K++E++ +GVEPM  V P+  V R DVV   D+ + ILSNAP  +   F V
Sbjct: 33 MGRMLDYIDKLNELDTQGVEPMSHVFPVHNVFREDVVTGTDQRDQILSNAPQQKDGAFKV 92

Query: 91 PKAV 94
          PK V
Sbjct: 93 PKTV 96


>gi|282165109|ref|YP_003357494.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Methanocella paludicola SANAE]
 gi|282157423|dbj|BAI62511.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Methanocella paludicola SANAE]
          Length = 94

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 47/94 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I V DV+ IA  + + + E +   F  + N+ L   +++  +N EGVEP   V+ +  
Sbjct: 1  MAISVKDVQHIASLACVDLNETEQERFAKQFNSILEYFKELDGLNTEGVEPTYHVIGLNN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R D   +    E  L NAP  EK +F  P+ V
Sbjct: 61 VFREDDAYEPLPQEEALKNAPRHEKGYFKGPRIV 94


>gi|57239518|ref|YP_180654.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58579501|ref|YP_197713.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Ehrlichia
           ruminantium str. Welgevonden]
 gi|57161597|emb|CAH58525.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58418127|emb|CAI27331.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 114

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 53/90 (58%), Gaps = 1/90 (1%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMV-SVVPMKMVHRPD 65
           D+ ++A   ++ + + +I  ++  L + LS +  IS+VN + V PM    +  K+  R D
Sbjct: 25  DLLQVAKLVKVKLSDNEIGYYIKELESVLSWINTISQVNTDNVIPMSHGGISHKLPLRQD 84

Query: 66  VVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           ++ DG+  + ILS +P  E +FFVVPK +E
Sbjct: 85  IINDGNIKDIILSESPKQEHDFFVVPKVIE 114


>gi|257092325|ref|YP_003165966.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Candidatus
          Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257044849|gb|ACV34037.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Candidatus
          Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 98

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + +  V+R+AH +RI I E +    L  LN   +++E +  V+  GVEPM     +  
Sbjct: 1  MSLTLEQVRRVAHLARIEISEVEADSTLGHLNEIFALIETMQAVDTSGVEPMAHAQDVAQ 60

Query: 61 VHRPDVVCDGDKVE---SILSNAPHVEKNFFVVPKAVE 95
            R D V + D+V    +  + AP  E   ++VPK +E
Sbjct: 61 RLRADRVTESDEVAQRTAFQAIAPETEAGLYLVPKVIE 98


>gi|198283878|ref|YP_002220199.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Acidithiobacillus
          ferrooxidans ATCC 53993]
 gi|218666897|ref|YP_002426513.1| glutamyl-tRNA(Gln)/aspartyl-tRNA(Asn) amidotransferase, C subunit
          [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226709609|sp|B7J4X0|GATC_ACIF2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|226779778|sp|B5EKF7|GATC_ACIF5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|198248399|gb|ACH83992.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acidithiobacillus
          ferrooxidans ATCC 53993]
 gi|218519110|gb|ACK79696.1| glutamyl-tRNA(Gln)/aspartyl-tRNA(Asn) amidotransferase, C subunit
          [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 95

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M  D   V+R AH +RI++ + +IP    +L   + ++E++  +    V  M   + +  
Sbjct: 1  MAFDQDTVRRTAHLARIALPQAEIPAVADQLERIMGLVEELRAIETTDVPIMAHPLDLDQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD+V   D+ E ++++AP  E   F+VPK +E
Sbjct: 61 PLRPDMVVHQDQREVLMASAPAAEHGLFLVPKVIE 95


>gi|58617553|ref|YP_196752.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C [Ehrlichia
           ruminantium str. Gardel]
 gi|58417165|emb|CAI28278.1| Putative Glutamyl-tRNA(Gln) amidotransferase subunit C [Ehrlichia
           ruminantium str. Gardel]
          Length = 114

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 53/90 (58%), Gaps = 1/90 (1%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMV-SVVPMKMVHRPD 65
           D+ ++A   ++ + + +I  ++  L + LS +  IS+VN + V PM    +  K+  R D
Sbjct: 25  DLLQVAKLVKVKLSDNEIGYYIKELESVLSWINTISQVNTDNVIPMSHGGIGHKLPLRQD 84

Query: 66  VVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           ++ DG+  + ILS +P  E +FFVVPK +E
Sbjct: 85  IINDGNIKDIILSESPKQEHDFFVVPKVIE 114


>gi|119477381|ref|ZP_01617572.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [marine gamma
          proteobacterium HTCC2143]
 gi|119449307|gb|EAW30546.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [marine gamma
          proteobacterium HTCC2143]
          Length = 95

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 57/97 (58%), Gaps = 4/97 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I+  D+++IA  +RI + +  +P    R+N+ L +++ +  V+   +EPM +  P+  
Sbjct: 1  MSIEKSDIEKIASLARIRVDQSAVPEIANRINDILKMVDSMQAVDTADIEPMAN--PLDA 58

Query: 61 VHR--PDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R   D+V + ++ E+  + AP VE+  ++VPK +E
Sbjct: 59 VQRLRVDLVTERNQREAFQAIAPQVEQGLYLVPKVIE 95


>gi|119505168|ref|ZP_01627244.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [marine gamma
          proteobacterium HTCC2080]
 gi|119459150|gb|EAW40249.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [marine gamma
          proteobacterium HTCC2080]
          Length = 95

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 48/90 (53%)

Query: 6  VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD 65
           DV  +A  +R+ I E  +     R N TL ++ ++ EV+ EGV PM +   M    R D
Sbjct: 6  ADVLSVAQLARLRIDETALDDVTDRFNRTLKLVAQLEEVDTEGVVPMSNPHDMYQRLRAD 65

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           V + ++ E++   AP V   FF+VPK ++
Sbjct: 66 KVTESNQREALQKTAPAVADGFFLVPKVID 95


>gi|332703262|ref|ZP_08423350.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Desulfovibrio africanus str. Walvis Bay]
 gi|332553411|gb|EGJ50455.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Desulfovibrio africanus str. Walvis Bay]
          Length = 94

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 47/87 (54%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V ++A  +R+ + E+ + LF  +L + L+ ++K+ E+    VEP+ S V      R D+ 
Sbjct: 8  VAKMASLARLELSEDKVGLFAEQLGDVLAYMDKLGELETSAVEPLYSPVDKPTPMREDIT 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAV 94
                E +L+ AP  +  FF+VP+ V
Sbjct: 68 VKEFSREDLLAGAPQTDGAFFIVPRIV 94


>gi|261409299|ref|YP_003245540.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Paenibacillus sp.
          Y412MC10]
 gi|329928587|ref|ZP_08282454.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Paenibacillus sp. HGF5]
 gi|261285762|gb|ACX67733.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Paenibacillus sp.
          Y412MC10]
 gi|328937703|gb|EGG34112.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Paenibacillus sp. HGF5]
          Length = 95

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 53/95 (55%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   DV+ +A  +R+++  E+  +F  +LN  L   EK++E++ +GVEP   V+ +  
Sbjct: 1  MSITDKDVQHVAKLARLNLTPEEEQMFTGQLNAILQYAEKLNELDTDGVEPTTHVLHLSN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V +   +E +L NAP  E +   VP  +E
Sbjct: 61 VMREDEVRESLPIEKVLLNAPDEEDDQIKVPAVLE 95


>gi|51244496|ref|YP_064380.1| Glu-tRNA(Gln) amidotransferase, subunit C [Desulfotalea
          psychrophila LSv54]
 gi|81642922|sp|Q6AQK0|GATC_DESPS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|50875533|emb|CAG35373.1| related to Glu-tRNA(Gln) amidotransferase, subunit C
          [Desulfotalea psychrophila LSv54]
          Length = 94

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 48/94 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +AH SR+ + ++++     +L+  LS +EK++EV+ EGV P         
Sbjct: 1  MKISEKEVQHVAHLSRLHLDQDELASMTEQLDGILSYMEKLAEVDTEGVLPTTHAFSKTN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
            R D+V D    E  L+N P      F VP+ +
Sbjct: 61 AFREDIVKDSLSQEESLANGPVQNGTAFQVPRVI 94


>gi|89902683|ref|YP_525154.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Rhodoferax
          ferrireducens T118]
 gi|122478183|sp|Q21RI0|GATC_RHOFD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|89347420|gb|ABD71623.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rhodoferax ferrireducens T118]
          Length = 99

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 55/99 (55%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM----VSVV 56
          M +   D+ RIA+ +R+ +K  +    L ++N   +++EK+  V+  G+EP+     +V 
Sbjct: 1  MSLTSTDIARIANLARLELKAAESERMLTQINGFFALVEKMRAVDTTGIEPLAHPVATVQ 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + +  R D V + ++ E+   NAP +E   F+VPK +E
Sbjct: 61 DITLRLREDRVSEPNQREANQRNAPALEHGLFLVPKVIE 99


>gi|322383060|ref|ZP_08056888.1| aspartyl/glutamyl-tRNA amidotransferase subunit C-like protein
          [Paenibacillus larvae subsp. larvae B-3650]
 gi|321152829|gb|EFX45454.1| aspartyl/glutamyl-tRNA amidotransferase subunit C-like protein
          [Paenibacillus larvae subsp. larvae B-3650]
          Length = 95

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I + DV+ +A  +R+ + E++   F  +L+  L+  E+++E++ E VEP    +P+  
Sbjct: 1  MNISIQDVEHVAKLARLELNEQEKETFTEQLSKILTFAEQLNELDTEQVEPTSHPMPLAN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D       +E ++ NAP  E   F VP  +E
Sbjct: 61 VMREDEGRSSWSIEEVMKNAPDEEAGQFKVPAVLE 95


>gi|254515290|ref|ZP_05127351.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [gamma
          proteobacterium NOR5-3]
 gi|219677533|gb|EED33898.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [gamma
          proteobacterium NOR5-3]
          Length = 95

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 50/88 (56%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          ++ IA  +R++++++++P      N  L + E++     +GVEPM + +      R DVV
Sbjct: 8  IREIAQLARLAVEDDELPALTSSFNAILDLFEQLQAAPTDGVEPMANPLDASQSLREDVV 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + ++ E++ + AP  E   ++VP+ V+
Sbjct: 68 TETNQREALQAVAPLTEDGLYLVPRVVD 95


>gi|300313943|ref|YP_003778035.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase subunit C [Herbaspirillum
           seropedicae SmR1]
 gi|300076728|gb|ADJ66127.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit protein
           [Herbaspirillum seropedicae SmR1]
          Length = 100

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 55/100 (55%), Gaps = 5/100 (5%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM----VSVV 56
           M + + DVKRIA+ SR+ + E      L +LN   +++E++  V+  GVEP+     ++ 
Sbjct: 1   MSLSLSDVKRIANLSRLELTEAQADQTLEKLNGIFALVEQMKAVDTRGVEPLSHPIAAIE 60

Query: 57  P-MKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           P + +  R DVV + ++ +     AP  +   ++VPK +E
Sbjct: 61  PALALRLREDVVTETNRRDDYQQPAPATQDGLYLVPKVIE 100


>gi|92114363|ref|YP_574291.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Chromohalobacter salexigens DSM 3043]
 gi|122419660|sp|Q1QVB6|GATC_CHRSD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|91797453|gb|ABE59592.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Chromohalobacter salexigens DSM 3043]
          Length = 95

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I+  DV R AH +R+ + E++   ++  L+  L +++++  V+ +G+ P+   +    
Sbjct: 1  MAIEHADVLRAAHLARVGLGEDEATGYVDDLSRILEMVDQLQAVDTQGIAPLAHPLDATQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD V + ++ E   + AP  E   ++VP+ VE
Sbjct: 61 RLRPDEVTEHNQRERFQACAPVTEGGLYLVPRVVE 95


>gi|326804256|ref|YP_004322074.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Aerococcus urinae ACS-120-V-Col10a]
 gi|326650046|gb|AEA00229.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Aerococcus urinae ACS-120-V-Col10a]
          Length = 99

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   D K +A  +++S  +E++     R    L ++EK+SEV+ EGVE M   + +K 
Sbjct: 1  MSISEQDFKHVAQLAKLSFSDEEVGPMNDRFTEILDMVEKLSEVDTEGVEVMTHGINLKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          + R D    G   + +L NAP     F VVP + E
Sbjct: 61 IMRDDQPEAGTDRDLMLKNAPTKRDGFIVVPASFE 95


>gi|284053881|ref|ZP_06384091.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Arthrospira
          platensis str. Paraca]
 gi|291570325|dbj|BAI92597.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Arthrospira
          platensis NIES-39]
          Length = 97

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 51/91 (56%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID  +V+++AH +R+ ++  +   F   LN  L   E++ E++ E V P +  + +  +
Sbjct: 1  MIDREEVRKVAHLARLQLQPSEEEKFTKELNGILDYFEQLKELDTEKVAPTMRAIDVSNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           RPD +      +++L+ AP  + +FF VP+
Sbjct: 61 TRPDQLEPYQNRDALLAAAPEPDGDFFRVPQ 91


>gi|290967939|ref|ZP_06559489.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Megasphaera
          genomosp. type_1 str. 28L]
 gi|290782078|gb|EFD94656.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Megasphaera
          genomosp. type_1 str. 28L]
          Length = 96

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 54/95 (56%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   ++++IA  SR+ I+E  +     +L++ LS ++ + EV++  VEP    V M+ 
Sbjct: 1  MKITGEEIQKIALLSRLHIEENQVDAVEKQLSDILSYMDLLKEVDITDVEPTAHAVTMRN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R DV  +    E+ L+NAP  E  +F VPK ++
Sbjct: 61 VMREDVPHESLPHEAALANAPEPENGYFKVPKVLQ 95


>gi|312140508|ref|YP_004007844.1| glutamyl-tRNA(gln) amidotransferase subunit c gatc [Rhodococcus
          equi 103S]
 gi|325675873|ref|ZP_08155557.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rhodococcus equi ATCC 33707]
 gi|311889847|emb|CBH49164.1| glutamyl-tRNA(Gln) amidotransferase subunit C GatC [Rhodococcus
          equi 103S]
 gi|325553844|gb|EGD23522.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rhodococcus equi ATCC 33707]
          Length = 99

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 51/86 (59%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ + ++  F  +L++ LS ++ ++EV  + V P  +  P+  V RPDV
Sbjct: 8  EVAHLARLSRLALTDAELDEFAGQLDSILSHVKAVAEVAADDVPPTANPNPVVNVTRPDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V  G   E  LS AP VE++ F VP+
Sbjct: 68 VVPGLTPEQALSGAPAVEEDRFAVPQ 93


>gi|222153629|ref|YP_002562806.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          uberis 0140J]
 gi|254791017|sp|B9DVG7|GATC_STRU0 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|222114442|emb|CAR43254.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus uberis
          0140J]
          Length = 100

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  S+++  EE+   F   L   + ++E ++EV+ EGV    ++   K 
Sbjct: 1  MKISEEEVRHVATLSKLAFSEEETSQFATTLTKIVDMVELLNEVDTEGVAITTTMADRKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V RPD+   G   E +  N P  E NF  VP  +E
Sbjct: 61 VMRPDLAQAGTNREDLFKNVPEKENNFIKVPAILE 95


>gi|226365935|ref|YP_002783718.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhodococcus
          opacus B4]
 gi|254791011|sp|C1B1S8|GATC_RHOOB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|226244425|dbj|BAH54773.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rhodococcus opacus B4]
          Length = 99

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 51/86 (59%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ + ++  F  +L++ LS ++ ++EV  E V PM +   +  V RPDV
Sbjct: 8  EVAHLARLSRLALTDAELDEFAGQLDSILSHVKVVTEVPAEDVPPMANPNAVTNVTRPDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          +  G   E  LS AP VE++ F VP+
Sbjct: 68 IVPGLTPEQALSGAPAVEQDRFAVPQ 93


>gi|110639210|ref|YP_679419.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Cytophaga hutchinsonii ATCC 33406]
 gi|123163318|sp|Q11R87|GATC_CYTH3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|110281891|gb|ABG60077.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Cytophaga hutchinsonii ATCC 33406]
          Length = 95

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 8/96 (8%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   + +IAH +R+   ++ +  F    N  LS ++K++EVN + VEP++ +     
Sbjct: 1  MSLDTKTIGKIAHLARLEFDDKSLEAFSTDFNKILSWIDKLNEVNTDNVEPLIHMSHELN 60

Query: 61 VHRPDVVCDGDKV----ESILSNAPHVEKNFFVVPK 92
          V R D+    DKV    E  L NAP  + ++F VPK
Sbjct: 61 VLREDI----DKVTISHEEALKNAPKKDSDYFRVPK 92


>gi|331005044|ref|ZP_08328448.1| Aspartyl-tRNA(Asn) amidotransferase subunit C [gamma
           proteobacterium IMCC1989]
 gi|330421099|gb|EGG95361.1| Aspartyl-tRNA(Asn) amidotransferase subunit C [gamma
           proteobacterium IMCC1989]
          Length = 107

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 51/89 (57%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           D+  +AH +RI+I ++ +      +N+ LS+++++ + + + VEPM   +      R D 
Sbjct: 19  DINALAHLARININDDLLDNVTDNINSILSLVDQLQQASTDDVEPMYHPLDATQQLRADE 78

Query: 67  VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           V + D  +++ +NAP  E   F+VP+ +E
Sbjct: 79  VTETDNRQALQANAPATEAGLFLVPQVIE 107


>gi|89097071|ref|ZP_01169962.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus sp.
          NRRL B-14911]
 gi|89088451|gb|EAR67561.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus sp.
          NRRL B-14911]
          Length = 96

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+ +AH +R+ I +E+       L   LS  E++SE++ E VEP   V+ +K V R D+ 
Sbjct: 9  VRHVAHLARLEISDEEAARMQKELEKMLSFAEQLSELDTEKVEPTSHVLDIKNVFREDIA 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +G   E +L NAP  +     VP  +E
Sbjct: 69 KEGLPQEEVLKNAPDHQDGQIKVPSILE 96


>gi|163846999|ref|YP_001635043.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Chloroflexus
          aurantiacus J-10-fl]
 gi|222524821|ref|YP_002569292.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Chloroflexus sp.
          Y-400-fl]
 gi|189045160|sp|A9WA95|GATC_CHLAA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|254790991|sp|B9LCU6|GATC_CHLSY RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|163668288|gb|ABY34654.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Chloroflexus
          aurantiacus J-10-fl]
 gi|222448700|gb|ACM52966.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Chloroflexus sp.
          Y-400-fl]
          Length = 96

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 47/90 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   +V+ +A  +RI++ +E+I L   +L+  L  +  + EV+V  V P   V  +  
Sbjct: 1  MALSEAEVRHVARLARIALSDEEIALMQAQLSAILDYIAMLQEVDVSNVPPTAQVTGLTT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVV 90
          V RPDVV +    E  L+NAP  +   F V
Sbjct: 61 VWRPDVVGEMLTQEQALANAPDQQDGMFRV 90


>gi|303325576|ref|ZP_07356019.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfovibrio sp.
          3_1_syn3]
 gi|302863492|gb|EFL86423.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfovibrio sp.
          3_1_syn3]
          Length = 98

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 48/88 (54%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+ + +E+  LF  +  + L  ++ +++VN E V+P+ S V      R D 
Sbjct: 11 EVAHMAALSRLRVSDEEQKLFARQFGDILGYMDVLAQVNTENVDPLYSPVQHAAEGREDR 70

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
            +    E +L+NAP  +  +F+VP+ V
Sbjct: 71 AVNRRSREEVLANAPEADGEYFIVPRIV 98


>gi|317154027|ref|YP_004122075.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Desulfovibrio
          aespoeensis Aspo-2]
 gi|316944278|gb|ADU63329.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfovibrio
          aespoeensis Aspo-2]
          Length = 94

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 50/94 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I    V ++A  +R+ + ++ + LF  +L + L  ++K+ E++   VEPM S V    
Sbjct: 1  MKISPEQVAKVARLARLDLPQDKLELFAGQLGDILGHMDKLGELDTASVEPMYSPVEHTT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R D        + +L+NAP  +  FF+VP+ V
Sbjct: 61 VLRADEARKEHGRDEVLANAPGHDGQFFIVPRIV 94


>gi|170693997|ref|ZP_02885153.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
          graminis C4D1M]
 gi|307728161|ref|YP_003905385.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Burkholderia sp.
          CCGE1003]
 gi|170141069|gb|EDT09241.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
          graminis C4D1M]
 gi|307582696|gb|ADN56094.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia sp.
          CCGE1003]
          Length = 99

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 54/101 (53%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DVKRIAH +R+ + + D    L++LN    ++E++  V+  G+ P+    P++ 
Sbjct: 1  MALTLTDVKRIAHLARLELADADAEHTLVQLNEFFGLVEQMQAVDTTGIAPLAH--PIEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +       R D V +  + E+    AP V+   ++VPK +E
Sbjct: 59 IEDVALRLRDDAVTETIEREAFQRPAPAVQDGLYLVPKVIE 99


>gi|254467820|ref|ZP_05081226.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [beta
          proteobacterium KB13]
 gi|207086630|gb|EDZ63913.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [beta
          proteobacterium KB13]
          Length = 95

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 52/89 (58%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          D+K+++H ++I+I  +D  + L +L+  + +++ + +VN + ++PM   + +    R DV
Sbjct: 7  DIKKLSHLAKINIDSKDEEIILSKLDGIIKLIDSMQKVNTDNIDPMSHALDITQPLREDV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V + ++    L   P    ++F+VP+ VE
Sbjct: 67 VTEKNQKNDFLELGPESNDDYFIVPRVVE 95


>gi|113953907|ref|YP_729570.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Synechococcus
          sp. CC9311]
 gi|123031892|sp|Q0IDA2|GATC_SYNS3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|113881258|gb|ABI46216.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Synechococcus sp.
          CC9311]
          Length = 97

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+++A  +R+ + E+ I  +  +L   L  ++++  V+ EGV P    V +    R D 
Sbjct: 8  DVRKVAKLARLDLPEDTIATYTGQLERILDYVDQLQAVDTEGVPPTTRAVEVVNATREDS 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V   D  + +L  AP  E +FF VPK
Sbjct: 68 VVATDVRQELLDQAPQREGDFFRVPK 93


>gi|172035200|ref|YP_001801701.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Cyanothece sp.
          ATCC 51142]
 gi|226779781|sp|B1X0Z4|GATC_CYAA5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|171696654|gb|ACB49635.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Cyanothece sp.
          ATCC 51142]
          Length = 98

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 51/91 (56%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          ++D   V++IAH +R+ I  E+   F  +L++ L   E++SE++ E V P    + +  +
Sbjct: 1  MLDRQQVQKIAHLARLDITSEEEEKFADQLSDILDYFEQLSELDTENVPPTTRAIELSNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D        +++L+ AP+ E +FF VP+
Sbjct: 61 TRQDSFELYHDRDALLNEAPNPEGDFFRVPQ 91


>gi|149277793|ref|ZP_01883933.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Pedobacter sp.
          BAL39]
 gi|149231481|gb|EDM36860.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Pedobacter sp.
          BAL39]
          Length = 96

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 55/95 (57%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   + ++A+ +RI+I++ +    +  +N  L+ +EK++E++  GV P+V +   + 
Sbjct: 1  MKIDRQTIDKVANLARIAIEDTEAENLMADMNKILTFMEKLNELDTTGVAPLVYMNAEEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R DVV     V   L NA    ++FF+VPK +E
Sbjct: 61 VWREDVVRQEITVGEGLKNAALHNESFFMVPKIIE 95


>gi|288818101|ref|YP_003432449.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Hydrogenobacter
          thermophilus TK-6]
 gi|288787501|dbj|BAI69248.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Hydrogenobacter
          thermophilus TK-6]
 gi|308751702|gb|ADO45185.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Hydrogenobacter
          thermophilus TK-6]
          Length = 93

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 6/96 (6%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          ++D+  V++ A+ +RI +KE +  +   +  + L+ +E++ EVN EG E M   V   + 
Sbjct: 1  MVDIKTVEKTAYLARIELKEHEKEVLGRQFLDILTFVEQLKEVNTEGAEDMEYQVGTPL- 59

Query: 62 HRPDV--VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           R D+  VC     E    NAP  EK FFVVP+ VE
Sbjct: 60 -REDIPGVCLSQ--EEATFNAPQREKGFFVVPRVVE 92


>gi|120608996|ref|YP_968674.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Acidovorax
          citrulli AAC00-1]
 gi|166198832|sp|A1TIW2|GATC_ACIAC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|120587460|gb|ABM30900.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Acidovorax citrulli AAC00-1]
          Length = 99

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM----VSVV 56
          M +   D+ RIA+ +R+ +   +    L +LN    ++EK+  V+  G+EP+     ++ 
Sbjct: 1  MALTPQDIGRIANLARLELSPAESERMLTQLNGFFGIVEKMRAVDTAGLEPLSHPVAAIQ 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + +  R D   + D+ E+   +AP VE+  F+VPK +E
Sbjct: 61 DIALRLREDTASEPDQREANQRSAPAVERGLFLVPKVIE 99


>gi|326315171|ref|YP_004232843.1| glutamyl-tRNA(gln) amidotransferase subunit C [Acidovorax avenae
          subsp. avenae ATCC 19860]
 gi|323372007|gb|ADX44276.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acidovorax avenae
          subsp. avenae ATCC 19860]
          Length = 99

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM----VSVV 56
          M +   D+ RIA+ +R+ +   +    L +LN    ++EK+  V+  G+EP+     ++ 
Sbjct: 1  MALTPQDIGRIANLARLDLSPAESERMLTQLNGFFGIVEKMRAVDTAGLEPLSHPVAAIQ 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + +  R D   + D+ E+   +AP VE+  F+VPK +E
Sbjct: 61 DIALRLREDTASEPDQREANQRSAPAVERGLFLVPKVIE 99


>gi|124025027|ref|YP_001014143.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Prochlorococcus marinus str. NATL1A]
 gi|166199386|sp|A2C068|GATC_PROM1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|123960095|gb|ABM74878.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Prochlorococcus
          marinus str. NATL1A]
          Length = 95

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 49/90 (54%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I   DV+++A  +R+ + E+ I  +  +L   LS ++++ E++ E + P    V +    
Sbjct: 4  ISSSDVRKVAQLARLELPEDQIETYTEQLEEILSYVDQLQEIDTENIPPTTRAVEVVNSM 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R D+V      E +L+ APH E +FF VPK
Sbjct: 64 RDDLVEVNCSREDLLNQAPHREGDFFRVPK 93


>gi|308272773|emb|CBX29377.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [uncultured Desulfobacterium sp.]
          Length = 95

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 49/88 (55%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          D+  +A  +R+ + EE I  F +++++ L  +E ++ ++ EGV P    + +    R DV
Sbjct: 7  DIIHVADLARLDMDEESIQKFTVQIDDILKYIETLNNLDTEGVLPTSHAIVLTNAFRDDV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
          +    K +++L NAP  E   F+VPK V
Sbjct: 67 IVQNIKRDALLENAPEDENGSFMVPKVV 94


>gi|226322859|ref|ZP_03798377.1| hypothetical protein COPCOM_00631 [Coprococcus comes ATCC 27758]
 gi|225208645|gb|EEG90999.1| hypothetical protein COPCOM_00631 [Coprococcus comes ATCC 27758]
          Length = 97

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 50/86 (58%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          ++ +   +++ + +E+       +   L  ++ ++E++ EG+EPM  V P+  V R DVV
Sbjct: 10 IEYVGILAKLELSDEEKEQAKKDMETMLDYIDTLNELDTEGIEPMSHVFPVNNVFREDVV 69

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKA 93
           +GD  E++L+NAP  ++  + VP+ 
Sbjct: 70 TNGDNHEAMLANAPQQKEQSYKVPRT 95


>gi|220905992|ref|YP_002481303.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Cyanothece sp. PCC
          7425]
 gi|254790994|sp|B8HU22|GATC_CYAP4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|219862603|gb|ACL42942.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Cyanothece sp.
          PCC 7425]
          Length = 97

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 47/85 (55%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK++AH +R+ +  E++  F  +L + L   +++ E+NV  V P    +    + R D +
Sbjct: 7  VKKVAHLARLELSGEEVAQFTTQLGSILDYFQQLEELNVTDVPPTTRAIESSNITRADQL 66

Query: 68 CDGDKVESILSNAPHVEKNFFVVPK 92
              + E+IL+ AP  + +FF VPK
Sbjct: 67 HPWAERENILAIAPEQDGDFFRVPK 91


>gi|330839064|ref|YP_004413644.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Selenomonas sputigena ATCC 35185]
 gi|329746828|gb|AEC00185.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Selenomonas sputigena ATCC 35185]
          Length = 96

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 48/89 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          D+  +A  SR+SI E +   +L +L+  L  +E +  V+   V+P    +PM+ V R D 
Sbjct: 7  DLADVAILSRLSIAEGERDKYLGQLDAFLQYVENLDGVDTAEVQPTTYALPMQNVFRADE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V      E+ LSNAP  +  +F VPK +E
Sbjct: 67 VKPSLAREAALSNAPLADDGYFKVPKILE 95


>gi|110833390|ref|YP_692249.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Alcanivorax
          borkumensis SK2]
 gi|123345782|sp|Q0VS71|GATC_ALCBS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|110646501|emb|CAL15977.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Alcanivorax
          borkumensis SK2]
          Length = 95

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 52/88 (59%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V ++AH +R+ +  +D      RLN+ L++++++ + +V+GV PM   + +    R DVV
Sbjct: 8  VAQVAHLARLKVDPQDSNALSDRLNDILAMVDQLQQADVDGVAPMAHPLDVTQPLRDDVV 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + +  +  L+ AP VE   F+VP+ +E
Sbjct: 68 TEPNIRDKALAIAPAVENGCFLVPRVIE 95


>gi|78221303|ref|YP_383050.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Geobacter metallireducens GS-15]
 gi|123573000|sp|Q39ZJ9|GATC_GEOMG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|78192558|gb|ABB30325.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Geobacter metallireducens GS-15]
          Length = 95

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A  +R+ +  E+   F  +++  L+ +EK++E++  G+ P    VP++ 
Sbjct: 1  MKITKAEVDAVALLARLELTPEETETFTGQMDAILAYVEKLNELDTSGIIPTSHAVPVEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V     VE+ L+NAP   + FF VPK +E
Sbjct: 61 AFRDDAVRPSIGVENALANAPDRVEGFFRVPKVIE 95


>gi|313668489|ref|YP_004048773.1| Glu-tRNA(Gln) amidotransferase subunit C [Neisseria lactamica
          ST-640]
 gi|313005951|emb|CBN87408.1| putative Glu-tRNA(Gln) amidotransferase subunit C [Neisseria
          lactamica 020-06]
          Length = 96

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 50/95 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV +IA  SR+ +  E+    L  LN+  +++E++  ++ +G+EPM       +
Sbjct: 1  MALTLADVDKIARLSRLHLTAEEKEKSLQELNDIFAMVEQMQNIDTDGIEPMAHPHEAAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D+     + AP V    ++VP+ +E
Sbjct: 61 RLREDEVTETDRAAEYQAVAPEVRNRLYIVPQVIE 95


>gi|260887167|ref|ZP_05898430.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Selenomonas
           sputigena ATCC 35185]
 gi|260863229|gb|EEX77729.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Selenomonas
           sputigena ATCC 35185]
          Length = 101

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 48/89 (53%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           D+  +A  SR+SI E +   +L +L+  L  +E +  V+   V+P    +PM+ V R D 
Sbjct: 12  DLADVAILSRLSIAEGERDKYLGQLDAFLQYVENLDGVDTAEVQPTTYALPMQNVFRADE 71

Query: 67  VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           V      E+ LSNAP  +  +F VPK +E
Sbjct: 72  VKPSLAREAALSNAPLADDGYFKVPKILE 100


>gi|257414146|ref|ZP_04745378.2| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseburia
           intestinalis L1-82]
 gi|257201062|gb|EEU99346.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Roseburia
           intestinalis L1-82]
          Length = 278

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%)

Query: 35  LSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
           L+ ++K++E++  GVEPM  V P+  V R DVV +GD  +  LSNAP  +   F VPK +
Sbjct: 217 LNYIDKLNELDTTGVEPMSHVFPVNNVFREDVVTNGDGSKETLSNAPAQKDGGFKVPKTI 276


>gi|209525064|ref|ZP_03273608.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Arthrospira
          maxima CS-328]
 gi|209494473|gb|EDZ94784.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Arthrospira
          maxima CS-328]
          Length = 97

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 51/91 (56%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID  +V+++AH +R+ ++  +   F   LN  L   E++ E++ E V P +  + +  +
Sbjct: 1  MIDREEVRKVAHLARLQLQPSEEEKFTKELNGILDYFEQLKELDTEKVAPTMRAIDVSNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           RPD +      +++L+ AP  + +FF VP+
Sbjct: 61 TRPDQLEPYPNRDALLAAAPEPDGDFFRVPQ 91


>gi|282899874|ref|ZP_06307835.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Cylindrospermopsis
          raciborskii CS-505]
 gi|281195144|gb|EFA70080.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Cylindrospermopsis
          raciborskii CS-505]
          Length = 96

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 50/91 (54%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   V+++A+ +R+ +  E+   F  +L + L  +E++ E++V  V P    + +  V
Sbjct: 1  MIDREQVRKVANLARLELTAEEEEQFTFQLGSILEYVEQLGELDVSNVPPTTRAIDLSNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D +      E+IL +AP  E +FF VPK
Sbjct: 61 TREDKLQPYLDREAILRSAPQQEGDFFKVPK 91


>gi|297250475|ref|ZP_06864394.2| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria
          polysaccharea ATCC 43768]
 gi|296838742|gb|EFH22680.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Neisseria
          polysaccharea ATCC 43768]
          Length = 99

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 50/95 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV +IA  SR+ +  E+    L  LN+  +++E++  ++ +G+EPM       +
Sbjct: 4  MALTLADVDKIARLSRLHLTAEEKEKSLQELNDIFAMVEQMQNIDTDGIEPMAHPHEAAL 63

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D+     + AP V    ++VP+ +E
Sbjct: 64 RLREDEVTETDRAAEYQAVAPEVRNRLYIVPQVIE 98


>gi|86742326|ref|YP_482726.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Frankia sp. CcI3]
 gi|86569188|gb|ABD12997.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Frankia sp. CcI3]
          Length = 98

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 46/92 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A  +R+S+ ++++     +L   LS + ++SE+    + P    VP+  
Sbjct: 1  MAITRDEVAHLARLARMSVTDDELDALAPQLEAILSAVARVSEIAAGDIPPTSHAVPLTN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          V RPD +C    V   L+ AP  E   F VP+
Sbjct: 61 VFRPDTICPSLPVTEALAGAPATEDGRFRVPR 92


>gi|260219774|emb|CBA26642.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Curvibacter putative symbiont of Hydra magnipapillata]
          Length = 99

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 54/99 (54%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM----VSVV 56
          M +   D+ RIA+ +R+ ++ ++    L +LN    ++E +  V+  GV+P+     ++ 
Sbjct: 1  MSLTSSDIARIANLARLELQPDESERMLTQLNGFFGIVETMRAVDTTGVQPLAHPVAAIQ 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + +  R D V + D  E+   +AP VE+  F+VPK +E
Sbjct: 61 DITLRLRDDAVSEPDNREANQRSAPAVERGLFLVPKVIE 99


>gi|284049094|ref|YP_003399433.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acidaminococcus
          fermentans DSM 20731]
 gi|283953315|gb|ADB48118.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acidaminococcus
          fermentans DSM 20731]
          Length = 95

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 54/95 (56%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + V DVK IA+  R+++ ++++  F+ + N  L+  E + +V+ +G+EP   V+P+  
Sbjct: 1  MSVTVNDVKHIANLCRLNVPDDEMEKFVEQFNQILNYAEILKKVDTKGIEPSPYVLPISN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R DV  +    E  + NAP   +  F VP+ +E
Sbjct: 61 VLREDVPVESLSHEDAMKNAPEEYEGGFKVPRVIE 95


>gi|169831194|ref|YP_001717176.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Candidatus
          Desulforudis audaxviator MP104C]
 gi|169638038|gb|ACA59544.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Candidatus
          Desulforudis audaxviator MP104C]
          Length = 93

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 49/86 (56%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ +A  +R+ + EE+I L+  +L   L     + +++   V P   V+P++ V R D+
Sbjct: 6  EVEHVALLARLDLSEEEIELYTTQLAKILEYAAVLDQLDTSEVPPTAHVLPLQNVFREDL 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V +    E +L+NAP  E+ FF VP+
Sbjct: 66 VGEHLAPEDVLANAPEKEEGFFKVPR 91


>gi|291525651|emb|CBK91238.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
           subunit [Eubacterium rectale DSM 17629]
          Length = 305

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 25/64 (39%), Positives = 39/64 (60%)

Query: 31  LNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVV 90
           + + L  ++K+ E++  G+EPM  V P+  V R DVV +GD  E+ L+NAP  +   F V
Sbjct: 240 MADMLDYIDKLEELDTSGIEPMSHVFPVNNVFRDDVVTNGDGSEATLANAPVKKDGGFKV 299

Query: 91  PKAV 94
           PK +
Sbjct: 300 PKTI 303


>gi|114565928|ref|YP_753082.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Syntrophomonas
          wolfei subsp. wolfei str. Goettingen]
 gi|122318949|sp|Q0AZZ3|GATC_SYNWW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|114336863|gb|ABI67711.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
          Length = 94

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 51/88 (57%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+++ E++   F  +L   L  +E+++E++   VEP++ ++P+  V R D 
Sbjct: 7  EVNHVAMLARLALSEDEKTAFAEQLTLILDYVERLNELDTGEVEPLIHILPVFNVLRQDE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
             G   E ILSNAP VE   + VP+ +
Sbjct: 67 ALPGSSQEEILSNAPLVEDGQYKVPRII 94


>gi|323524441|ref|YP_004226594.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Burkholderia sp.
          CCGE1001]
 gi|323381443|gb|ADX53534.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia sp.
          CCGE1001]
          Length = 99

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 53/101 (52%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DVKRIAH +R+ + + D    L++LN    ++E++  V+  G+ P+    P++ 
Sbjct: 1  MALTLTDVKRIAHLARLELADADAEHTLVQLNEFFGLVEQMQAVDTTGIAPLAH--PIEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +       R D V +    E+    AP V+   ++VPK +E
Sbjct: 59 IEDVALRLRDDAVTETIDREAFQRPAPAVQDGLYLVPKVIE 99


>gi|268316139|ref|YP_003289858.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhodothermus
          marinus DSM 4252]
 gi|262333673|gb|ACY47470.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhodothermus
          marinus DSM 4252]
          Length = 95

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 50/95 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I V +V+ IA  +R+   EE+  +   ++   L  + K++E++   V PM  V+ +  
Sbjct: 1  MAISVEEVRYIARLARLEFSEEEERMLAEQMGEVLDYVAKLNELDTRDVPPMSHVLDLYN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R DVV      E  L NAP  + ++F VPK +E
Sbjct: 61 VFREDVVEQRISHEDALRNAPDADSDYFRVPKVIE 95


>gi|291528243|emb|CBK93829.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
           subunit [Eubacterium rectale M104/1]
          Length = 305

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 25/64 (39%), Positives = 39/64 (60%)

Query: 31  LNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVV 90
           + + L  ++K+ E++  G+EPM  V P+  V R DVV +GD  E+ L+NAP  +   F V
Sbjct: 240 MADMLDYIDKLEELDTSGIEPMSHVFPVNNVFRDDVVTNGDGSEATLANAPVKKDGGFKV 299

Query: 91  PKAV 94
           PK +
Sbjct: 300 PKTI 303


>gi|217968692|ref|YP_002353926.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Thauera sp.
          MZ1T]
 gi|217506019|gb|ACK53030.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thauera sp. MZ1T]
          Length = 95

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 46/88 (52%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          +  IA  +RI++ + ++     +L+    ++E++  V+  GVEPM          RPDVV
Sbjct: 8  IGHIARLARIALSDTELEATRAKLDGIFGLIEQMQAVDTTGVEPMSHPQEFPTRLRPDVV 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + D+ ++    AP  E   ++VPK +E
Sbjct: 68 TETDRRDAFQKVAPQTEAGLYLVPKVIE 95


>gi|186474824|ref|YP_001856294.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          phymatum STM815]
 gi|229487457|sp|B2JJW1|GATC_BURP8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|184191283|gb|ACC69248.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
          phymatum STM815]
          Length = 99

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 54/101 (53%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DVKRIAH +R+ + + D    L++LN+   ++E++  V+  G+ P+    P++ 
Sbjct: 1  MALTLTDVKRIAHLARLELPDADAEHTLIQLNDFFGLVEQMQAVDTTGISPLAH--PIEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +       R D V +    +    +AP V+   ++VPK +E
Sbjct: 59 IEDVALRLRNDAVTENVNRDDYQRSAPAVQDGLYLVPKVIE 99


>gi|218768372|ref|YP_002342884.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          meningitidis Z2491]
 gi|18203135|sp|Q9JTZ6|GATC_NEIMA RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|121052380|emb|CAM08712.1| putative Glu-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis Z2491]
 gi|319410618|emb|CBY90987.1| aspartyl-tRNA(Asn) amidotransferase subunit C (Asp-ADT subunit C)
          [Neisseria meningitidis WUE 2594]
 gi|325128455|gb|EGC51336.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis N1568]
          Length = 96

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV +IA  SR+ +   +    L  LN+  +++E++  +N +G+EPM       +
Sbjct: 1  MALTLADVDKIARLSRLHLTAAEKEKSLQELNDIFAMVEQMQNINTDGIEPMAHPHEAAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D+     + AP V    ++VP+ +E
Sbjct: 61 RLREDEVTETDRAAEYQAVAPEVRNRLYIVPQVIE 95


>gi|222109452|ref|YP_002551716.1| glutamyl-tRNA(gln) amidotransferase subunit C [Acidovorax ebreus
          TPSY]
 gi|254790997|sp|B9MB32|GATC_DIAST RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|221728896|gb|ACM31716.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acidovorax ebreus
          TPSY]
          Length = 99

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 56/99 (56%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM---VSVV- 56
          M +   D+ RIA+ +R+ +   +    L +LN    ++EK+  V+  G+ P+   V+VV 
Sbjct: 1  MALTPQDIGRIANLARLELSPGESERMLTQLNGFFGIVEKMQAVDTHGIAPLSHPVAVVR 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +++  R DV  + D+ E+   +AP VE+  F+VPK +E
Sbjct: 61 DVQLRLREDVASEPDQREANQRSAPAVERGLFLVPKVIE 99


>gi|153813415|ref|ZP_01966083.1| hypothetical protein RUMOBE_03835 [Ruminococcus obeum ATCC 29174]
 gi|149830507|gb|EDM85598.1| hypothetical protein RUMOBE_03835 [Ruminococcus obeum ATCC 29174]
          Length = 97

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 51/93 (54%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   ++ +   +++S+  E        +   L  +EK+ E++ +GVEP+  +   K V
Sbjct: 4  IIDDETIENVCILAKLSLSNEAKEKAKEDMQKMLDYVEKLDELDTDGVEPLSHIFGDKNV 63

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
           R DVV +GD  E++L NAP  ++  + VPK +
Sbjct: 64 FRDDVVTNGDNKEAMLMNAPKAKEGQYQVPKTI 96


>gi|209522245|ref|ZP_03270879.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia sp.
          H160]
 gi|209497323|gb|EDZ97544.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia sp.
          H160]
          Length = 99

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 54/101 (53%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + ++DVKRIAH +R+ + + D      +LN+   ++E++  V+  G+ P+    P++ 
Sbjct: 1  MALTLIDVKRIAHLARLELADADAEHTRAQLNDFFGLVEQMQAVDTTGIAPLAH--PIEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +       R D V +  + E+    AP V+   ++VPK +E
Sbjct: 59 IEDVALRLRDDAVTEAVEREAFQRPAPAVQDGLYLVPKVIE 99


>gi|292670866|ref|ZP_06604292.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Selenomonas noxia
          ATCC 43541]
 gi|292647487|gb|EFF65459.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Selenomonas noxia
          ATCC 43541]
          Length = 96

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 49/89 (55%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          D+   AH SR++I   +    L  L + L+ ++ +S+V+ + V+P    +P++ V R D 
Sbjct: 7  DLTTTAHLSRLAIPAAEKDAALKTLGDFLTYVDNLSDVDTKDVQPTTYALPIENVFRADE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V      E+ LSNAP  E  +F VPK +E
Sbjct: 67 VRPSLSNEAALSNAPLHENGYFKVPKVLE 95


>gi|27262186|gb|AAN87374.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Heliobacillus
          mobilis]
          Length = 94

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 48/88 (54%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ +A  +R+ + ++++  +  +LN+ L   +++  ++   V P   V P++ V R D 
Sbjct: 7  EVQHVAMLARLELSDKEVEKYTTQLNDILGYAQRLQALDTANVPPTAHVFPLQNVMRDDC 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V      E IL+NAP  E  FF VPK V
Sbjct: 67 VDPSMAREKILANAPDEEDGFFRVPKIV 94


>gi|331695643|ref|YP_004331882.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Pseudonocardia dioxanivorans CB1190]
 gi|326950332|gb|AEA24029.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Pseudonocardia dioxanivorans CB1190]
          Length = 107

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           +V  +A  SR+++ + ++ +F  +L+  L  + ++ EV  E + P    VP++ V RPD 
Sbjct: 16  EVAHLARLSRLAVTDAELDVFAGQLDVILGAVARVGEVAAEDIPPTSHAVPLENVFRPDE 75

Query: 67  VCDGDKVESILSNAPHVEKNFFVVPK 92
           +  G   E  LS AP  E   F VP+
Sbjct: 76  LRPGLTQEQALSGAPAAEDGRFRVPQ 101


>gi|325261861|ref|ZP_08128599.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium sp.
          D5]
 gi|324033315|gb|EGB94592.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium sp.
          D5]
          Length = 97

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 38/60 (63%)

Query: 35 LSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          L  ++ ++E++  G+EPM  V P+  V R DVV +GD  E IL+NAP  + + F VPK +
Sbjct: 37 LDYIDTLNELDTSGIEPMSHVFPVNNVFREDVVTNGDSKEEILANAPKRKNDSFEVPKTI 96


>gi|238923548|ref|YP_002937064.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Eubacterium rectale
           ATCC 33656]
 gi|238875223|gb|ACR74930.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Eubacterium rectale
           ATCC 33656]
          Length = 305

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 25/64 (39%), Positives = 39/64 (60%)

Query: 31  LNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVV 90
           + + L  ++K+ E++  G+EPM  V P+  V R DVV +GD  E+ L+NAP  +   F V
Sbjct: 240 MADMLDYIDKLEELDTSGIEPMSHVFPVNNVFRDDVVTNGDGSEATLANAPVKKDGGFKV 299

Query: 91  PKAV 94
           PK +
Sbjct: 300 PKTI 303


>gi|291288327|ref|YP_003505143.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Denitrovibrio
          acetiphilus DSM 12809]
 gi|290885487|gb|ADD69187.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Denitrovibrio
          acetiphilus DSM 12809]
          Length = 97

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 47/93 (50%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I + DVK IA+ +R+S  E         LN+ L  ++K++E++   VEP    + +  V 
Sbjct: 5  ISIKDVKHIANLARLSFDEAGAEKLKDDLNSILGYVDKLNELDTSDVEPTSHTLDIYTVT 64

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          RPD        E  L+NAP  E   F VPK +E
Sbjct: 65 RPDKAEPSLTNEEALANAPQSENAHFKVPKVME 97


>gi|325132452|gb|EGC55145.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis M6190]
 gi|325138226|gb|EGC60795.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis ES14902]
          Length = 96

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV +IA  SR+ +   +    L  LN+  +++E++  +N +G+EPM       +
Sbjct: 1  MALTLADVDKIARLSRLHLTAAEKEKSLQELNDIFAMVEQMQTINTDGIEPMAHPHEAAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D+     + AP V    ++VP+ +E
Sbjct: 61 RLREDEVTETDRAAEYQAVAPEVRNRLYIVPQVIE 95


>gi|253577657|ref|ZP_04854965.1| glutamyl-tRNA(Gln) amidotransferase [Paenibacillus sp. oral taxon
          786 str. D14]
 gi|251842949|gb|EES70989.1| glutamyl-tRNA(Gln) amidotransferase [Paenibacillus sp. oral taxon
          786 str. D14]
          Length = 95

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   DV+ +A  +R+ + +E+  +F  +LN  L   EK++E+N + + P   V+ +  
Sbjct: 1  MSIQTKDVEHVARLARLHLTDEERDMFTEQLNAILQYAEKLNELNTDDIAPTTHVLHLSN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V +    E +  NAP  E   F VP  +E
Sbjct: 61 VMREDEVKESLPPEKVFRNAPEEEDGQFKVPAVLE 95


>gi|220931080|ref|YP_002507988.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Halothermothrix
          orenii H 168]
 gi|254790999|sp|B8D124|GATC_HALOH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|219992390|gb|ACL68993.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Halothermothrix
          orenii H 168]
          Length = 95

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V++IA  + + + +E+   F  +L + L  +EK++E++ +GV P    VPMK V R D 
Sbjct: 6  EVEKIAGLAYLKLSDEERETFTRQLGDILDYVEKLNELDTDGVVPTAYTVPMKNVLRDDK 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
          V      E  L NAP  +   F VP
Sbjct: 66 VGSSIPREEALDNAPDKKDGLFRVP 90


>gi|300863654|ref|ZP_07108593.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Oscillatoria
          sp. PCC 6506]
 gi|300338362|emb|CBN53737.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Oscillatoria
          sp. PCC 6506]
          Length = 97

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 50/92 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   V+++AH +R+ + + +   F  +L++ L   E++SE++   V P    + +  
Sbjct: 1  MKIDNEQVRKVAHLARLELTQAEEEQFTTQLSSMLEYFEQLSELDTSDVPPTTRAIDVSN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          V R D +      E+IL+ AP  + +FF VPK
Sbjct: 61 VTRADDLEPFANREAILAAAPEQDGDFFRVPK 92


>gi|121635061|ref|YP_975306.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Neisseria
          meningitidis FAM18]
 gi|120866767|emb|CAM10520.1| putative Glu-tRNA(Gln) amidotransferase subunit C [Neisseria
          meningitidis FAM18]
          Length = 99

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV +IA  SR+ +   +    L  LN+  +++E++  +N +G+EPM       +
Sbjct: 4  MALTLADVDKIARLSRLHLTAAEKEKSLQELNDIFAMVEQMQTINTDGIEPMAHPHEAAL 63

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D+     + AP V    ++VP+ +E
Sbjct: 64 RLREDEVTETDRAAEYQAVAPEVRNRLYIVPQVIE 98


>gi|121592672|ref|YP_984568.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acidovorax sp. JS42]
 gi|120604752|gb|ABM40492.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acidovorax sp. JS42]
          Length = 122

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 56/99 (56%), Gaps = 4/99 (4%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM---VSVV- 56
           M +   D+ RIA+ +R+ +   +    L +LN    ++EK+  V+  G+ P+   V+VV 
Sbjct: 24  MALTPQDIGRIANLARLELSPGESERMLTQLNGFFGIVEKMQAVDTHGIAPLSHPVAVVR 83

Query: 57  PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            +++  R DV  + D+ E+   +AP VE+  F+VPK +E
Sbjct: 84  DVQLRLREDVASEPDQREANQRSAPAVERGLFLVPKVIE 122


>gi|254447828|ref|ZP_05061293.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [gamma
          proteobacterium HTCC5015]
 gi|198262608|gb|EDY86888.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [gamma
          proteobacterium HTCC5015]
          Length = 88

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 52/90 (57%), Gaps = 4/90 (4%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH--RPD 65
          +K+IA  + + I+ E +  +   L++ L+++E++  V+  GVEPM    P+ MV   R D
Sbjct: 1  MKKIARLAALDIRPEQVADYEKNLSSILNLVEQMDAVDTTGVEPMAH--PLHMVQPLRDD 58

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           V + D+ +    +AP  E  +++VPK +E
Sbjct: 59 AVTEEDQRDHFQEHAPATEDGYYLVPKVIE 88


>gi|300783594|ref|YP_003763885.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Amycolatopsis mediterranei U32]
 gi|299793108|gb|ADJ43483.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Amycolatopsis mediterranei U32]
          Length = 99

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 46/86 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+++ +++I +F  +L+  L  + K+SEV    V P    VP+  V R DV
Sbjct: 8  EVAHLAKLARLAVTDDEIDVFAGQLDQILDSVAKVSEVAAADVPPTSHAVPLTNVFRQDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V  G   +  L+ AP  E   F VP+
Sbjct: 68 VVPGLSQQQALAGAPAAEDGRFRVPR 93


>gi|227530247|ref|ZP_03960296.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
          vaginalis ATCC 49540]
 gi|227349836|gb|EEJ40127.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
          vaginalis ATCC 49540]
          Length = 105

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 49/86 (56%), Gaps = 2/86 (2%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD-- 65
          V+ +A  +++  K+E++  F  +L + + + E ++ V+ EGVEPM S    + V R D  
Sbjct: 10 VEHVAELAKLEFKDEELTKFTTQLGSIIDMFEDLTNVDTEGVEPMTSASDRENVMREDKA 69

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVP 91
          V    ++ +++L+NAP  +  +  VP
Sbjct: 70 VKSSKEETDALLNNAPDTDDGYIKVP 95


>gi|226941982|ref|YP_002797056.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Laribacter
          hongkongensis HLHK9]
 gi|254791000|sp|C1D5N0|GATC_LARHH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|226716909|gb|ACO76047.1| GatC [Laribacter hongkongensis HLHK9]
          Length = 95

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DV +IA  +R+ + E +      +LN    ++E +  V+  GVEPM       +
Sbjct: 1  MALSSDDVVKIARLARLRVSEAERGAVQGQLNGIFDLIEAMRAVDTAGVEPMAHPQDAAL 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D+  +  + AP VE   ++VPK +E
Sbjct: 61 RLRADAVTETDRRSAYQAVAPQVENGLYLVPKVIE 95


>gi|291549447|emb|CBL25709.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Ruminococcus torques L2-14]
          Length = 100

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 40/60 (66%)

Query: 35 LSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          L  ++ ++E++  G+EPM  V P++ V R DVV +GD  E+ L+NAP  +++ F VPK +
Sbjct: 40 LDYIDTLNELDTTGIEPMSHVFPVQNVFREDVVTNGDNKEATLANAPLRKEDSFEVPKTI 99


>gi|251795124|ref|YP_003009855.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Paenibacillus sp.
          JDR-2]
 gi|247542750|gb|ACS99768.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Paenibacillus sp.
          JDR-2]
          Length = 95

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 50/95 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I + DV+ +A+ +R+ +  E+   F  +LN  L   EK+  ++ + VEP   V+P+  
Sbjct: 1  MSITIKDVEHVANLARLELSNEEKEQFTGQLNAILKYAEKLDSLDTDNVEPTSHVLPITN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D+  +   +E +L NAP  E     VP  +E
Sbjct: 61 VMREDITRESLPIEKVLLNAPDEEDGQIKVPAVLE 95


>gi|91781449|ref|YP_556655.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          xenovorans LB400]
 gi|296161380|ref|ZP_06844187.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia sp.
          Ch1-1]
 gi|122970796|sp|Q146Y6|GATC_BURXL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|91685403|gb|ABE28603.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Burkholderia xenovorans LB400]
 gi|295888366|gb|EFG68177.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia sp.
          Ch1-1]
          Length = 99

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 55/101 (54%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DVKRIAH +R+ + + +    L++LN+   ++E++  V+  G+ P+    P++ 
Sbjct: 1  MALTLTDVKRIAHLARLELADAEAEHTLVQLNDFFGLVEQMQAVDTTGIAPLAH--PIEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +       R D V +  + E+    AP V+   ++VPK +E
Sbjct: 59 IEDVALRLRDDTVTETVEREAFQRPAPAVQDGLYLVPKVIE 99


>gi|72383438|ref|YP_292793.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Prochlorococcus marinus str. NATL2A]
 gi|123620446|sp|Q46HD8|GATC_PROMT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|72003288|gb|AAZ59090.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Prochlorococcus marinus str. NATL2A]
          Length = 95

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 49/90 (54%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I   DV+++A  +R+ + E+ I  +  +L   LS ++++ E++ + + P    V +    
Sbjct: 4  ISSSDVRKVAQLARLELPEDQIETYTEQLEEILSYVDQLQEIDTKNIPPTTRAVEVVNAM 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R D+V      E +L+ APH E +FF VPK
Sbjct: 64 RDDLVEVNCSREDLLNQAPHREGDFFRVPK 93


>gi|293602408|ref|ZP_06684854.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Achromobacter
          piechaudii ATCC 43553]
 gi|292819170|gb|EFF78205.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Achromobacter
          piechaudii ATCC 43553]
          Length = 102

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 52/99 (52%), Gaps = 7/99 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMK- 59
          M ++  DV RIA  +RI +  +   +    LN  L ++E++  V+ +GVEP+   +    
Sbjct: 1  MALNDTDVARIARLARIELTSDQRAVAQAELNGILHLIERLQSVDTQGVEPLAHPLSAHE 60

Query: 60 ---MVHRPDVVCDGD---KVESILSNAPHVEKNFFVVPK 92
             +  R D V +     + E++L+NAP  ++  F+VPK
Sbjct: 61 DIVLRLREDAVTEASSETRREALLANAPDAQEGLFLVPK 99


>gi|239813301|ref|YP_002942211.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Variovorax
          paradoxus S110]
 gi|259647266|sp|C5CY41|GATC_VARPS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|239799878|gb|ACS16945.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Variovorax
          paradoxus S110]
          Length = 99

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 52/99 (52%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM----VSVV 56
          M +   D+ RIA  +R+ +  ++    L ++N    ++E++  V+  GVEP+     +V 
Sbjct: 1  MSLSASDIARIASLARLQLASDESERMLSQINGFFDLVERMRSVDTAGVEPLAHPVAAVE 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + +  R DV  + D  E+   +AP VE   F+VPK +E
Sbjct: 61 DITLRLRDDVASEPDNREANQKSAPAVEAGLFLVPKVIE 99


>gi|167761366|ref|ZP_02433493.1| hypothetical protein CLOSCI_03774 [Clostridium scindens ATCC
          35704]
 gi|167661032|gb|EDS05162.1| hypothetical protein CLOSCI_03774 [Clostridium scindens ATCC
          35704]
          Length = 97

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 38/60 (63%)

Query: 35 LSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          L  ++ ++E++ EG+EPM  V P+K V R DVV + D  +  L+NAP  + N F VPK +
Sbjct: 37 LDYIDTLNELDTEGIEPMSHVFPIKNVFREDVVTNEDGSKDTLANAPLQKNNSFKVPKTI 96


>gi|330720567|gb|EGG98841.1| Aspartyl-tRNA(Asn) amidotransferase subunit C @
          Glutamyl-tRNA(Gln) amidotransferase subunit C [gamma
          proteobacterium IMCC2047]
          Length = 95

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 48/95 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I+  DV   AH +R+ I + DI  F   L N +S+ +++  V+  G+EPM   +    
Sbjct: 1  MSIERNDVLNAAHLARLGIDDNDIEDFTQDLANIISLADQMQAVDTTGIEPMAHPMDATQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + ++ +     AP  E   ++VPK ++
Sbjct: 61 RLRADQVTETNQRDHFQKIAPATENGLYLVPKVID 95


>gi|154499974|ref|ZP_02038012.1| hypothetical protein BACCAP_03631 [Bacteroides capillosus ATCC
          29799]
 gi|150271572|gb|EDM98829.1| hypothetical protein BACCAP_03631 [Bacteroides capillosus ATCC
          29799]
          Length = 95

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 49/88 (55%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V  ++  SR+ + +E+       L   ++ ++ ++ ++ +GVEPM  + P+K V R DVV
Sbjct: 8  VDYVSTLSRLRLPQEEKAKMAGELEQIVTYMDTLNTLDTDGVEPMSHIFPLKNVLRADVV 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
                E +LS AP  ++  F VPKAVE
Sbjct: 68 VPSADREVLLSGAPARDEETFRVPKAVE 95


>gi|329119740|ref|ZP_08248419.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327464135|gb|EGF10441.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 105

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 49/95 (51%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M +   DV++IA  SR+ +  ++    L  LN+  +++EK+ + + +G+ PM     + +
Sbjct: 10  MSLTPADVEKIARLSRLELNADEQAAMLGELNSVFAMVEKMRQTDTDGIAPMTHPHDLPL 69

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             R D V + D      + AP V    ++VP+ +E
Sbjct: 70  RLREDTVTEADHAAEYQACAPDVRNRLYIVPQVIE 104


>gi|120555640|ref|YP_959991.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Marinobacter
          aquaeolei VT8]
 gi|166199154|sp|A1U485|GATC_MARAV RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|120325489|gb|ABM19804.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Marinobacter aquaeolei VT8]
          Length = 95

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 53/97 (54%), Gaps = 4/97 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   D++++A  +RI +  E +      L N L +++++S  + + VEPM    P+  
Sbjct: 1  MSISREDIEKVAVLARIKVDGEQVSALEKDLGNILDLVDQLSAADTDAVEPMAH--PLDA 58

Query: 61 VH--RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V   RPDVV + ++ E+  + AP  E   ++VP+ +E
Sbjct: 59 VQKLRPDVVTETNQREAFQAIAPATEDGLYLVPRVIE 95


>gi|253997617|ref|YP_003049681.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Methylotenera
           mobilis JLW8]
 gi|253984296|gb|ACT49154.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylotenera
           mobilis JLW8]
          Length = 104

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 52/104 (50%), Gaps = 9/104 (8%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M +   D+K+IAH +R+ + + D    L +L   L ++E++  V+  G+EPM     +  
Sbjct: 1   MALSTDDIKKIAHLARLEVSDSDAAATLSKLTGILGLIEQMQAVDTAGIEPMSHSQDVVQ 60

Query: 61  VHRPDVVCDGDKVES------ILSNAP---HVEKNFFVVPKAVE 95
             R DVV   ++ ES      +L N      V+   ++VPK +E
Sbjct: 61  RLRDDVVTKTNQRESFQKISPVLGNGSAELAVDSGLYLVPKVIE 104


>gi|332667972|ref|YP_004450760.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Haliscomenobacter hydrossis DSM 1100]
 gi|332336786|gb|AEE53887.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Haliscomenobacter hydrossis DSM 1100]
          Length = 96

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          + R+ H +R+ + EE+       LNN L ++EK+  ++   VEP+V +     V R D V
Sbjct: 8  ISRLEHLARLELSEEERKSLQEDLNNILVMVEKLQALDTNDVEPLVYLNEDVNVWREDQV 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
              K E  L NAP  +  FF+VPK ++
Sbjct: 68 QHQVKREDALLNAPQQDGTFFMVPKVID 95


>gi|147919420|ref|YP_686841.1| glutamyl-tRNA(Gln) amidotransferase, subunit C [uncultured
          methanogenic archaeon RC-I]
 gi|121685318|sp|Q0W278|GATC_UNCMA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|110622237|emb|CAJ37515.1| glutamyl-tRNA(Gln) amidotransferase, subunit C [uncultured
          methanogenic archaeon RC-I]
          Length = 93

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 44/88 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ I   + I +  E+  LF  + N+ L    ++ EVN +GVEP   V+ +  V R DV
Sbjct: 6  DVEHIGSLACIDLSPEETGLFAKQFNSILDYFRELDEVNTDGVEPTHHVIGLTNVFREDV 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
            +    E  ++NA   EK F   P+ V
Sbjct: 66 AGESLTQEECIANAARKEKGFIKGPRIV 93


>gi|145590198|ref|YP_001156795.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Polynucleobacter
          necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145048604|gb|ABP35231.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Polynucleobacter necessarius subsp. asymbioticus
          QLW-P1DMWA-1]
          Length = 97

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 50/93 (53%), Gaps = 4/93 (4%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVS----VVPMKMVH 62
          DV+RIAH SR+ + + +    L +L    S++E++  V+  G+EP+      +  +    
Sbjct: 5  DVQRIAHLSRLELNQAEAEAVLPQLQAIFSLVEEMQAVDTTGLEPLAHPILFIRDLAQPM 64

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          R D V + D     + +AP  ++ +F+VPK +E
Sbjct: 65 RADQVTETDHRSENMQSAPAQQEGYFLVPKVIE 97


>gi|327398249|ref|YP_004339118.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Hippea maritima DSM 10411]
 gi|327180878|gb|AEA33059.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Hippea maritima DSM 10411]
          Length = 95

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 46/89 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +VKRIA  S + +KEED+  F  + N  L  +++I  +N+E  E +  V  +K V R D 
Sbjct: 6  EVKRIAKLSMLELKEEDVDKFCNQFNEILGYMKEIDGLNLESQEAVFHVGELKNVFREDE 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V      E  L NAP      F VPK +E
Sbjct: 66 VKPSTDNELALKNAPDPADRAFRVPKVIE 94


>gi|313677552|ref|YP_004055548.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit c
          [Marivirga tractuosa DSM 4126]
 gi|312944250|gb|ADR23440.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Marivirga tractuosa DSM 4126]
          Length = 95

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I+   +++IAH +R+   E+     L  +NN LS +EK+ E++ + VEP+ ++     
Sbjct: 1  MSINKETLEKIAHLARLEFDEKSEEKMLKDMNNMLSFVEKLQELDTDNVEPLQAMSFEIN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D + +    E  L NAP  ++ +F VPK +E
Sbjct: 61 QMREDKIKEHLSREKGLKNAPKKDQEYFRVPKVIE 95


>gi|319945175|ref|ZP_08019437.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Lautropia
          mirabilis ATCC 51599]
 gi|319741745|gb|EFV94170.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Lautropia
          mirabilis ATCC 51599]
          Length = 95

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 45/89 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          D+ R+   +RI + + +    L +L++   ++EK+  V+  GVEPM     +    R DV
Sbjct: 7  DISRLGELARIRLDDAERAHMLAQLDDIFGIIEKLRAVDTTGVEPMTHAGHVGQRLRDDV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V + D       +AP V    ++VP+ VE
Sbjct: 67 VTESDHRAENQRSAPSVADGLYLVPRVVE 95


>gi|118443290|ref|YP_878903.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Clostridium
          novyi NT]
 gi|118133746|gb|ABK60790.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium novyi
          NT]
          Length = 94

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 52/94 (55%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +I   D+K IA  S++S  E +    +  LN  L  +EKI+E+  + VE  V+   ++  
Sbjct: 1  MISREDIKYIARLSKLSFDENEEEKIIEHLNKVLKDIEKINELKTDDVEITVNPYYIENE 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +R D + +  K++ +L NAP   K + VVPK +E
Sbjct: 61 YREDEIEESLKLKKVLENAPESNKEYIVVPKVIE 94


>gi|187479647|ref|YP_787672.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bordetella avium
           197N]
 gi|123513677|sp|Q2KU73|GATC_BORA1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit C; Short=Asp/Glu-ADT subunit C
 gi|115424234|emb|CAJ50787.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Bordetella avium
           197N]
          Length = 102

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 52/104 (50%), Gaps = 11/104 (10%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMV------S 54
           M ++  DV RIA  +RI +  E        LN  L ++E++  V+ +GVEP+        
Sbjct: 1   MALNQQDVARIARLARIELTPEQQSRAQDELNGILHLIERLQAVDTQGVEPLAHPLSAHE 60

Query: 55  VVPMKMVHRPDVVCDGDKVE---SILSNAPHVEKNFFVVPKAVE 95
            +P+++  R D V +    E    +L+NAP      F+VPK +E
Sbjct: 61  DIPLRL--RQDAVTETASAERRAELLANAPEQSAGLFLVPKVIE 102


>gi|163854731|ref|YP_001629029.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bordetella
           petrii DSM 12804]
 gi|229487452|sp|A9I0H9|GATC_BORPD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit C; Short=Asp/Glu-ADT subunit C
 gi|163258459|emb|CAP40758.1| glutamyl-tRNA(GLN) amidotransferase subunit C [Bordetella petrii]
          Length = 102

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 7/102 (6%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVP--- 57
           M ++  DV RIA  +RI +  +        LN  L ++E++   + EGVEP+   +    
Sbjct: 1   MALNEQDVARIARLARIELTPDQRSRAQDELNGILHLIERLQAADTEGVEPLAHPLSAHQ 60

Query: 58  -MKMVHRPDVVCDG---DKVESILSNAPHVEKNFFVVPKAVE 95
            + +  RPD V +    D+   +L+NAP      F+VPK +E
Sbjct: 61  DIALRLRPDAVTETPSEDRRAELLANAPDARDGLFLVPKVIE 102


>gi|73667440|ref|YP_303456.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Ehrlichia canis str. Jake]
 gi|72394581|gb|AAZ68858.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Ehrlichia canis str. Jake]
          Length = 114

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 52/94 (55%), Gaps = 9/94 (9%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMV-----SVVPMKMV 61
           D+ ++A   RI + + +I  +L  L   LS ++ IS+VN + + PM        +P+   
Sbjct: 25  DLLQVAKLVRIKLDDSEIDYYLKELKVVLSWIQTISQVNTQNIAPMSHGGINDTLPL--- 81

Query: 62  HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D++ DG+  + +L N+   E +FFVVPK +E
Sbjct: 82  -REDIINDGNIKDIVLFNSTEQEHDFFVVPKVIE 114


>gi|300781375|ref|ZP_07091229.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Corynebacterium
          genitalium ATCC 33030]
 gi|300533082|gb|EFK54143.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Corynebacterium
          genitalium ATCC 33030]
          Length = 101

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  IA  +RI++ EE++     +L+  +  +  +  V+ EGVEPM     +    RPDV
Sbjct: 11 EVAGIARLARIAVSEEELDQLAGQLDTIVEAVSAVQAVDTEGVEPMSHPHSIDAGMRPDV 70

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  L  AP VE++ F+VP+
Sbjct: 71 VRPTLTQEQALDQAPEVEEDRFMVPQ 96


>gi|220905415|ref|YP_002480727.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Desulfovibrio
          desulfuricans subsp. desulfuricans str. ATCC 27774]
 gi|219869714|gb|ACL50049.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfovibrio
          desulfuricans subsp. desulfuricans str. ATCC 27774]
          Length = 98

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 51/92 (55%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I + +V  +A  SR+++ EE+  LF  +L++ L  ++ +++V+    EP+ S    +   
Sbjct: 7  IGLKEVAHMAELSRLTVSEEEQTLFARQLDDILGYMDVLAKVDTSRAEPLYSPAQHQPAP 66

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          R DV       + +L+NAP  +  +F+VP+ V
Sbjct: 67 REDVAAHVCTRQDVLANAPEADGEYFMVPRIV 98


>gi|254428553|ref|ZP_05042260.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Alcanivorax sp.
          DG881]
 gi|196194722|gb|EDX89681.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Alcanivorax sp.
          DG881]
          Length = 95

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 53/95 (55%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   V ++AH +R+ +  +D      RLN+ L++++++ + +V+GV P+   + +  
Sbjct: 1  MAIDSKVVAQVAHLARLKVDPQDSDALSNRLNDILAMVDQLQQADVDGVAPLAHPLDVTQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DVV + +  +  L  AP  E   F+VP+ +E
Sbjct: 61 PLREDVVTEPNIRDKALEIAPAAEDGCFLVPRVIE 95


>gi|312144160|ref|YP_003995606.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Halanaerobium sp.
          'sapolanicus']
 gi|311904811|gb|ADQ15252.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Halanaerobium sp.
          'sapolanicus']
          Length = 95

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 48/91 (52%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID  DV+  A  + + + EE+  L+  ++      +EK++E++ E V P    VPMK V
Sbjct: 1  MIDKKDVEYSADLAHLKLSEEEKDLYTEQIAKIFDYVEKLNELDTEDVVPTAYTVPMKNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D V +    E  L+NAP  +   F VPK
Sbjct: 61 MREDEVEESLDREKSLANAPDKKDGQFRVPK 91


>gi|197302920|ref|ZP_03167971.1| hypothetical protein RUMLAC_01648 [Ruminococcus lactaris ATCC
          29176]
 gi|197298001|gb|EDY32550.1| hypothetical protein RUMLAC_01648 [Ruminococcus lactaris ATCC
          29176]
          Length = 100

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 39/60 (65%)

Query: 35 LSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          L  ++ ++E++  G+EPM  V P++ V R DVV +GD  E  L+NAP  +++ F VPK +
Sbjct: 40 LDYIDTLNELDTTGIEPMSHVFPVQNVFREDVVTNGDNKEKTLANAPLRKEDSFEVPKTI 99


>gi|15607091|ref|NP_214473.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Aquifex aeolicus
          VF5]
 gi|6225420|sp|O67904|GATC_AQUAE RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|254574885|pdb|3H0L|C Chain C, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574888|pdb|3H0L|F Chain F, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574891|pdb|3H0L|I Chain I, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574894|pdb|3H0L|L Chain L, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574897|pdb|3H0L|O Chain O, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574900|pdb|3H0L|R Chain R, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574903|pdb|3H0L|U Chain U, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574906|pdb|3H0L|X Chain X, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574909|pdb|3H0M|C Chain C, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574912|pdb|3H0M|F Chain F, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574915|pdb|3H0M|I Chain I, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574918|pdb|3H0M|L Chain L, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574921|pdb|3H0M|O Chain O, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574924|pdb|3H0M|R Chain R, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574927|pdb|3H0M|U Chain U, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574930|pdb|3H0M|X Chain X, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574933|pdb|3H0R|C Chain C, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574936|pdb|3H0R|F Chain F, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574939|pdb|3H0R|I Chain I, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574942|pdb|3H0R|L Chain L, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574945|pdb|3H0R|O Chain O, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574948|pdb|3H0R|R Chain R, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574951|pdb|3H0R|U Chain U, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|254574954|pdb|3H0R|X Chain X, Structure Of Trna-Dependent Amidotransferase Gatcab From
          Aquifex Aeolicus
 gi|2984354|gb|AAC07874.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Aquifex aeolicus
          VF5]
          Length = 94

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 55/97 (56%), Gaps = 7/97 (7%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVS---VVPM 58
          ++D   V +IA  +R+ +KEE+I +F  +L++ L  ++++ E++ E VEP +      PM
Sbjct: 1  MVDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPM 60

Query: 59 KMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +    P    D +K    L NAP  +  FFVVP+ VE
Sbjct: 61 RE-DEPHPSLDREKA---LMNAPERKDGFFVVPRVVE 93


>gi|124265277|ref|YP_001019281.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Methylibium
          petroleiphilum PM1]
 gi|166199155|sp|A2SBV7|GATC_METPP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|124258052|gb|ABM93046.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Methylibium petroleiphilum PM1]
          Length = 99

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 52/101 (51%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DV RIA  +R+ + E +    L +LN    ++E++  V+  GV P+ +  P+  
Sbjct: 1  MALTPTDVSRIALLARLELSEAEQSAMLSQLNGFFDIVERMRAVDTTGVAPLYT--PLSA 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V       R D V + D+ ++   +AP VE   ++VPK +E
Sbjct: 59 VQEVALRLREDAVTEVDQRQANQLSAPAVEAGLYLVPKVIE 99


>gi|291546776|emb|CBL19884.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Ruminococcus sp. SR1/5]
          Length = 97

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 53/93 (56%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   ++ +   +++S+ E++       +   L  ++K+ E++   VEPM  +   + V
Sbjct: 4  IIDDETMENVCILAKLSLTEDEKEKAKEDMQKMLDYVDKLDELDTSSVEPMSHIFEDENV 63

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
           R DVV +GD  E++L+NAP  ++N + VPK +
Sbjct: 64 FREDVVTNGDNHEAMLANAPKQKENQYQVPKTI 96


>gi|188996307|ref|YP_001930558.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Sulfurihydrogenibium sp. YO3AOP1]
 gi|229487557|sp|B2V7T1|GATC_SULSY RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|188931374|gb|ACD66004.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 99

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          ++++A  S + +KEE+I LF  +  + LS ++K++EV+V+   P   +   +   R D+ 
Sbjct: 10 IEKVAKLSNLKLKEEEIELFSNQFKDILSFIDKLNEVDVKDTLPFYELQIEEKSEREDIP 69

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAV 94
                E  + NAP  +  FFVVP+ V
Sbjct: 70 TGSITNEEAIKNAPQAKGGFFVVPRVV 96


>gi|148927885|ref|ZP_01811297.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [candidate division
           TM7 genomosp. GTL1]
 gi|147886762|gb|EDK72320.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [candidate division
           TM7 genomosp. GTL1]
          Length = 116

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 46/87 (52%), Gaps = 1/87 (1%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           +V R+AH + IS+ E +I      L   L  +E++SE++ EGV P   V  ++ V R D 
Sbjct: 28  EVARLAHLAGISLSESEIARLETELGEILRYVEQLSELDTEGVTPTYQVTDLEHVTRSDE 87

Query: 67  VCD-GDKVESILSNAPHVEKNFFVVPK 92
           + D G   + +L+NAP        VPK
Sbjct: 88  IIDYGLGRDELLANAPDRTDTQIKVPK 114


>gi|116334211|ref|YP_795738.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
          brevis ATCC 367]
 gi|116099558|gb|ABJ64707.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Lactobacillus brevis ATCC 367]
          Length = 103

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 47/88 (53%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+ +A  +++   +  +  F  +L++ + + E +SEV+ +GVE   SV     V R DV 
Sbjct: 10 VQHVASLAKLEFTDAQLDAFTPQLDDIIGLFETLSEVDTDGVEATSSVTDQLNVMREDVA 69

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +  + +S+L NAP   + F  VP  ++
Sbjct: 70 DNWGQSQSLLKNAPEAARGFIKVPAIID 97


>gi|313891636|ref|ZP_07825243.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Dialister microaerophilus UPII 345-E]
 gi|329122126|ref|ZP_08250734.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Dialister
          micraerophilus DSM 19965]
 gi|313119914|gb|EFR43099.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Dialister microaerophilus UPII 345-E]
 gi|327466933|gb|EGF12449.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Dialister
          micraerophilus DSM 19965]
          Length = 94

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 49/94 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I+  ++K+IA  SR+    +D+      +N+ L+ +E++ + + EGV P    V    
Sbjct: 1  MKINEEEIKKIAFLSRLEFDNKDLEKMNDSMNSILTHMEELKQYDTEGVVPTAHAVEQFN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R D+  +    E  LSNAP  E  +F VPK +
Sbjct: 61 VTRKDIPHESLSNEEALSNAPEREDGYFKVPKII 94


>gi|325520753|gb|EGC99776.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Burkholderia sp.
          TJI49]
          Length = 99

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 54/101 (53%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DVKRIAH +R+ + + D    L +LN+   ++E++  V+  G+EP+    P++ 
Sbjct: 1  MALTLTDVKRIAHLARLEMADADAEHTLGQLNDFFGLVEQMQAVDTAGIEPLAH--PIEH 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +       R D V +    +    +AP V+   ++VPK +E
Sbjct: 59 IQEVAQRLRDDAVTEVVNRDDNQRSAPAVQDGLYLVPKVIE 99


>gi|295675143|ref|YP_003603667.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia sp.
          CCGE1002]
 gi|295434986|gb|ADG14156.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia sp.
          CCGE1002]
          Length = 99

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 53/101 (52%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DVKRIAH +R+ + + D      +LN+   ++E++  V+  G+ P+    P++ 
Sbjct: 1  MALTLTDVKRIAHLARLELADSDAEHTRAQLNDFFGLVEQMQAVDTTGIAPLAH--PIEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +       R D V +  + E+    AP V+   ++VPK +E
Sbjct: 59 IEDVALRLRDDAVTETVEREAFQRPAPAVQDGLYLVPKVIE 99


>gi|154483458|ref|ZP_02025906.1| hypothetical protein EUBVEN_01161 [Eubacterium ventriosum ATCC
          27560]
 gi|149735710|gb|EDM51596.1| hypothetical protein EUBVEN_01161 [Eubacterium ventriosum ATCC
          27560]
          Length = 98

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 48/88 (54%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          ++ +   +++ + +E+       +   L  ++ +++++   VEPM  V P+  V R DVV
Sbjct: 10 IEYVGILAKLELSDEEKEKAKSDMGRMLDYIDMLNQLDTSNVEPMSHVFPVNNVFREDVV 69

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +GD  E+IL NAP  +   FVVPK  E
Sbjct: 70 VNGDDRENILKNAPEQKDGAFVVPKTFE 97


>gi|257126972|ref|YP_003165086.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Leptotrichia
          buccalis C-1013-b]
 gi|260890549|ref|ZP_05901812.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Leptotrichia
          hofstadii F0254]
 gi|257050911|gb|ACV40095.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Leptotrichia
          buccalis C-1013-b]
 gi|260859791|gb|EEX74291.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Leptotrichia
          hofstadii F0254]
          Length = 99

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 50/88 (56%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV +IA  S++   E +I  F + LN     +E+++ V+   VEP+ +V+ +K   R D 
Sbjct: 6  DVLKIAALSKLEFSESEIEKFRVDLNKIFEHMEELNGVDTTDVEPLFNVLDLKDKLREDK 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V D    + IL N+P+ ++ F +VPK V
Sbjct: 66 VRDAGIKKEILENSPNKDEEFIIVPKVV 93


>gi|329769736|ref|ZP_08261137.1| hypothetical protein HMPREF0433_00901 [Gemella sanguinis M325]
 gi|328838098|gb|EGF87716.1| hypothetical protein HMPREF0433_00901 [Gemella sanguinis M325]
          Length = 96

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 48/88 (54%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V  IAH SR+ I+E+++  ++ +L   + +  +++ V+ E ++P   V+ +  V R DV 
Sbjct: 9  VNHIAHLSRLEIQEDEVDGYIEKLEKVVDLFNELNSVDTENIKPTYHVLDLVNVFREDVA 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +G   E +L N+   E   F VP  +E
Sbjct: 69 QEGMNREEVLKNSKETEAGQFKVPTIIE 96


>gi|238063195|ref|ZP_04607904.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Micromonospora
          sp. ATCC 39149]
 gi|237885006|gb|EEP73834.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Micromonospora
          sp. ATCC 39149]
          Length = 101

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ EE++  F  +L+  L  + ++ EV    + P    VP+  V R DV
Sbjct: 8  EVAHLARLSRLAVTEEELDTFAGQLDTILQAVAQVGEVAAADIPPTSHSVPLTNVLREDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V  G      LS AP  E+  F VP+
Sbjct: 68 VVPGLTPAEALSGAPDAEEQRFRVPR 93


>gi|225405475|ref|ZP_03760664.1| hypothetical protein CLOSTASPAR_04695 [Clostridium asparagiforme
           DSM 15981]
 gi|225042997|gb|EEG53243.1| hypothetical protein CLOSTASPAR_04695 [Clostridium asparagiforme
           DSM 15981]
          Length = 106

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 51/93 (54%)

Query: 3   IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
           +D   ++ +   +++ +  E+       ++  L  ++K++E++ EGVEPM  + P+  V 
Sbjct: 14  VDDTTIEYVGILAKLELSGEEREAAKRDMSRMLDYVDKLNELDTEGVEPMSHLFPVHNVF 73

Query: 63  RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           R D V + D  + IL+NAP  +   F VP+ +E
Sbjct: 74  REDEVINADSRKQILANAPEQKDGAFKVPRTIE 106


>gi|170078174|ref|YP_001734812.1| glutamyl-tRNA (Gln) amidotransferase chain C [Synechococcus sp.
          PCC 7002]
 gi|229487558|sp|B1XNN1|GATC_SYNP2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|169885843|gb|ACA99556.1| glutamyl-tRNA (Gln) amidotransferase chain C [Synechococcus sp.
          PCC 7002]
          Length = 97

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 50/91 (54%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID+  V+++AH +R+ +  E+      +L+  L  +E++SE++ + VEP    + +  +
Sbjct: 1  MIDLEQVRKVAHLARLELTPEEEQRLPSQLSAILDYVEQLSELDTDNVEPTTRAIDVSNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D        + +L NAP  E ++F VPK
Sbjct: 61 TRTDEQKTFGDCQLLLDNAPDREDDYFRVPK 91


>gi|121608580|ref|YP_996387.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Verminephrobacter
          eiseniae EF01-2]
 gi|121553220|gb|ABM57369.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Verminephrobacter eiseniae EF01-2]
          Length = 99

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 52/93 (55%), Gaps = 4/93 (4%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM----VSVVPMKMVH 62
          D++RIA  +R+++   +    L +LN   +++EK+  V+  G+ P+     ++    +  
Sbjct: 7  DIERIARLARLALTPAESAGMLTQLNGFFAIVEKMRAVDTSGLTPLAHPVAAIESQALRL 66

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          R D+V + D+ ++   +AP VE   ++VPK +E
Sbjct: 67 RADLVSEPDQRQANQQSAPAVEGGLYLVPKVIE 99


>gi|226305870|ref|YP_002765830.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rhodococcus erythropolis PR4]
 gi|229493408|ref|ZP_04387197.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhodococcus
          erythropolis SK121]
 gi|259647256|sp|C0ZXK6|GATC_RHOE4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|226184987|dbj|BAH33091.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rhodococcus erythropolis PR4]
 gi|229319724|gb|EEN85556.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rhodococcus
          erythropolis SK121]
          Length = 99

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 51/86 (59%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ + ++  F  +L++ L+ ++ ++EV  + V PM +   +  V RPDV
Sbjct: 8  EVAHLARLSRLALSDAELDEFAGQLDSILNHVKVVTEVAADDVPPMANPNAVTNVTRPDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          +  G   E  LS AP VE++ F VP+
Sbjct: 68 IVPGLTPEQALSGAPAVEQDRFAVPQ 93


>gi|33864828|ref|NP_896387.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Synechococcus
          sp. WH 8102]
 gi|39931380|sp|Q7U9G6|GATC_SYNPX RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|33632351|emb|CAE06807.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Synechococcus sp.
          WH 8102]
          Length = 97

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I   DV+++A  +R+ + EE I  +  +L + L  + ++  ++ EGV      V +  V 
Sbjct: 4  ISADDVRKVAKLARLDLPEEKIATYTGQLESILEYVGQLESIDTEGVPETTRAVEVTNVT 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R D V      E IL+ AP  E +FF VPK
Sbjct: 64 REDGVTPTPVREDILNQAPQREGDFFRVPK 93


>gi|270293303|ref|ZP_06199512.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus sp.
          M143]
 gi|270278152|gb|EFA24000.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus sp.
          M143]
          Length = 100

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 46/91 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S+++  EE+   F   L+  + ++E + EV+  G+ P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLTFSEEETAAFATTLSKIVDMVELLGEVDTTGIAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV  +G   + +  N P  E  +  VP
Sbjct: 61 VLRPDVAEEGTDRDRLFKNVPEKENYYIKVP 91


>gi|148238674|ref|YP_001224061.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Synechococcus
          sp. WH 7803]
 gi|166218190|sp|A5GIJ9|GATC_SYNPW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|147847213|emb|CAK22764.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Synechococcus sp. WH 7803]
          Length = 97

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 46/86 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+++AH +R+ + E+ I  +  +L   L  ++++  V+ EGV      V +  V R D 
Sbjct: 8  DVRKVAHLARLDLPEDTIATYTGQLERILDYVDQLQAVDTEGVPATTRAVEVVNVTREDK 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V   +  E +L  AP  E +FF VPK
Sbjct: 68 VEATEVREDLLEQAPLREGDFFRVPK 93


>gi|332969146|gb|EGK08178.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Kingella kingae ATCC
           23330]
          Length = 132

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 51/94 (54%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M + + DV++IA  SR+++ E +    L +LN+   ++EK+  V+  GVEP+     + +
Sbjct: 37  MSLTMNDVEKIAQLSRLALNETEKQATLDKLNSIFELVEKMQAVDTTGVEPLTHPHEVAL 96

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
             R D V + D      + AP V+   ++VP+ +
Sbjct: 97  RLRDDAVTETDHAAEYQAVAPEVKNRLYIVPQVI 130


>gi|241765828|ref|ZP_04763767.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acidovorax
          delafieldii 2AN]
 gi|241364276|gb|EER59438.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acidovorax
          delafieldii 2AN]
          Length = 99

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM----VSVV 56
          M +   D+ RIA+ +R+ +   +    L +LN    ++EK+  V+  GV P+     ++ 
Sbjct: 1  MALTPQDIGRIANLARLELTPSESERMLTQLNGFFDIVEKMRAVDTSGVAPLAHPVAAIQ 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + +  R DV  + ++ E+   +AP VE+  F+VPK +E
Sbjct: 61 DIALRLRDDVASEPNQREANQQSAPAVERGLFLVPKVIE 99


>gi|288906063|ref|YP_003431285.1| aspartyl/glutamyl-tRNA(Gln) amidotransferase, subunit C
          [Streptococcus gallolyticus UCN34]
 gi|306832102|ref|ZP_07465256.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          gallolyticus subsp. gallolyticus TX20005]
 gi|325979027|ref|YP_004288743.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          gallolyticus subsp. gallolyticus ATCC BAA-2069]
 gi|288732789|emb|CBI14365.1| Putative aspartyl/glutamyl-tRNA(Gln) amidotransferase, subunit C
          [Streptococcus gallolyticus UCN34]
 gi|304425541|gb|EFM28659.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          gallolyticus subsp. gallolyticus TX20005]
 gi|325178955|emb|CBZ48999.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          gallolyticus subsp. gallolyticus ATCC BAA-2069]
          Length = 100

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 48/95 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  S++S  EE+   F   L+  + ++E ++EV+ EGV    ++   K 
Sbjct: 1  MKISEEEVRHVADLSKLSFSEEETAEFATTLSKIVDMVELLNEVDTEGVPVTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R DV   GD  + +  N P  E  +  VP  +E
Sbjct: 61 VMREDVAVAGDDRDELFKNVPQSENYYIKVPAILE 95


>gi|87125067|ref|ZP_01080914.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Synechococcus sp.
          RS9917]
 gi|86167387|gb|EAQ68647.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Synechococcus sp.
          RS9917]
          Length = 97

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+++A  +R+ + E+ I  +  +L   L  ++++  V+ +GV P    V +    R D 
Sbjct: 8  DVRKVAQLARLELPEDTISTYTGQLERILDYVDQLQAVDTDGVPPTTRAVEVINATRDDR 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E +L  AP  E +FF VPK
Sbjct: 68 VVATQVREELLDQAPQREGDFFRVPK 93


>gi|307703107|ref|ZP_07640054.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          oralis ATCC 35037]
 gi|322374844|ref|ZP_08049358.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus sp.
          C300]
 gi|307623500|gb|EFO02490.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          oralis ATCC 35037]
 gi|321280344|gb|EFX57383.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus sp.
          C300]
          Length = 100

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   EE+   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLKFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV  +G   + +  N P  E  +  VP
Sbjct: 61 VLRPDVAEEGTDRDRLFKNVPEKENYYIKVP 91


>gi|311747480|ref|ZP_07721265.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Algoriphagus sp.
          PR1]
 gi|126574838|gb|EAZ79209.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Algoriphagus sp.
          PR1]
          Length = 95

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   +K+IAH +R+   E         ++  L  +E++SEV+ E VEP+ ++     
Sbjct: 1  MKIDKATIKKIAHLARLEFDENSAEKMSKDMSQILDWVEQLSEVDTENVEPLTTMSSEVN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D +      E+ L NAP  +  +F VPK +E
Sbjct: 61 DMREDKIGHHISHEAGLKNAPKKDAEYFRVPKVLE 95


>gi|78186225|ref|YP_374268.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Chlorobium
          luteolum DSM 273]
 gi|123583482|sp|Q3B606|GATC_PELLD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|78166127|gb|ABB23225.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Chlorobium luteolum DSM 273]
          Length = 95

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 45/88 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV  IA  +R+S  +E+       LN+ L  +EK+ E++ EGV P+ ++   K V R DV
Sbjct: 7  DVDYIAELARLSFTDEEASRMTDELNSILHYVEKLGELDTEGVLPLSNIHDQKNVLRDDV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
                    L NAP  +  FF VPK +
Sbjct: 67 ERPSISNAEALQNAPDRQDRFFKVPKVI 94


>gi|323705996|ref|ZP_08117566.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534610|gb|EGB24391.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 95

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 48/85 (56%)

Query: 11 IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
          ++  +R+   ++++  F  +L++ +  ++K++E+N +GVEP   +VP+  V R D V   
Sbjct: 11 VSKLARLKFSDDELEKFSHQLDSIIKYVDKLNELNTDGVEPTAHIVPISNVFREDEVVPS 70

Query: 71 DKVESILSNAPHVEKNFFVVPKAVE 95
             E IL NA   E   F VPK +E
Sbjct: 71 MDREKILMNAKEKEDGCFKVPKIIE 95


>gi|303247465|ref|ZP_07333737.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfovibrio
          fructosovorans JJ]
 gi|302491161|gb|EFL51053.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfovibrio
          fructosovorans JJ]
          Length = 94

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 50/97 (51%), Gaps = 6/97 (6%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +  ++A  +R+   EE +  F  ++ + L+ ++ +  V+ +GVEP+ S V    
Sbjct: 1  MKISPEEAAKVAKLARLRFDEEALAGFAGQMEDILAYMDTLGAVDTQGVEPLYSPVLHDT 60

Query: 61 VHRPD---VVCDGDKVESILSNAPHVEKNFFVVPKAV 94
            R D     C  DKV   L+NAP  +  FFVVPK V
Sbjct: 61 PLREDKAQKTCPRDKV---LANAPATDGQFFVVPKIV 94


>gi|182414175|ref|YP_001819241.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Opitutus terrae
          PB90-1]
 gi|254791009|sp|B1ZQN2|GATC_OPITP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|177841389|gb|ACB75641.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Opitutus terrae
          PB90-1]
          Length = 94

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 50/90 (55%)

Query: 6  VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD 65
          +++  +A+ +R+++  E+   F  +L + L  +E++++V+V GVEP      +  V   D
Sbjct: 5  LNIDHVANLARLALTPEEKATFAQQLGDVLHHIEQLAKVDVAGVEPTAHAFAVTNVWADD 64

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
              G  VE+ L NAP   ++  VVPK VE
Sbjct: 65 APQPGLSVEAALKNAPAQREHMVVVPKVVE 94


>gi|83590840|ref|YP_430849.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Moorella thermoacetica ATCC 39073]
 gi|123524034|sp|Q2RGY3|GATC_MOOTA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|83573754|gb|ABC20306.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Moorella thermoacetica ATCC 39073]
          Length = 94

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 48/94 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  +R+ +  E+   +  +LN  L  ++K++ ++   VEP   V+P++ 
Sbjct: 1  MPISTAEVEHVALLARLKLSPEEKTAYTEQLNAILEYMDKLNALDTRDVEPTAHVLPLRN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R D    G   E  L  AP V +  F VP+ V
Sbjct: 61 VFRDDCARPGLPREKALQGAPEVSEGQFKVPRVV 94


>gi|293364858|ref|ZP_06611575.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus oralis
           ATCC 35037]
 gi|291316308|gb|EFE56744.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus oralis
           ATCC 35037]
          Length = 125

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 45/91 (49%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M I   +V  +A+ S++   EE+   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 26  MKITQEEVTHVANLSKLKFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 85

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
           V RPDV  +G   + +  N P  E  +  VP
Sbjct: 86  VLRPDVAEEGTDRDRLFKNVPEKENYYIKVP 116


>gi|238028928|ref|YP_002913159.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Burkholderia glumae
           BGR1]
 gi|237878122|gb|ACR30455.1| Glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia glumae
           BGR1]
          Length = 150

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 8/101 (7%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M + + DVKRIAH +R+ + + +    L RLN+   ++EK+  V+  G+ P+    P++ 
Sbjct: 52  MALTLNDVKRIAHLARLEMNDAEAEHTLGRLNDFFGLVEKMQAVDTNGIAPLAH--PIEQ 109

Query: 61  VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +       R DVV +    +     AP V+   F+VPK +E
Sbjct: 110 IQEVAQRLRDDVVTEAVDRDENQRPAPAVQDGLFLVPKVIE 150


>gi|325980989|ref|YP_004293391.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Nitrosomonas sp.
          AL212]
 gi|325530508|gb|ADZ25229.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Nitrosomonas sp.
          AL212]
          Length = 95

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DVKRIA  + I I + +    L +L+    ++E +  V+   VEPM     +  
Sbjct: 1  MTLSASDVKRIADLAYIEINDNEAKEALGQLSGIFGLIETMQTVDTSTVEPMSHAQSVLQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D+ E   S AP VE + ++VP+ +E
Sbjct: 61 RLRDDEVTETDQHELYQSIAPQVEADLYLVPQVIE 95


>gi|169833065|ref|YP_001693942.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae Hungary19A-6]
 gi|229487555|sp|B1I9M9|GATC_STRPI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|168995567|gb|ACA36179.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae Hungary19A-6]
          Length = 100

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   EE+   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDVV +G   + +  N P  +  +  VP
Sbjct: 61 VLRPDVVEEGTDRDRLFKNVPEQDNYYIKVP 91


>gi|77919761|ref|YP_357576.1| glutamyl-tRNA (Gln) amidotransferase subunit C, GatC-like
          [Pelobacter carbinolicus DSM 2380]
 gi|123573762|sp|Q3A2K1|GATC_PELCD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|77545844|gb|ABA89406.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Pelobacter carbinolicus DSM 2380]
          Length = 95

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I+   V+ +A  +R+++ E+++      ++  L  +EK++E++ + + P    VP++ 
Sbjct: 1  MKINREQVEHVARLARLALSEDELASLTDDMDAILGYVEKLNELDTDHIIPTAHAVPVEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D        +  L NAP    N FVVPK +E
Sbjct: 61 AFREDCAGSSIGTDKALQNAPEASDNCFVVPKVIE 95


>gi|147678858|ref|YP_001213073.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit [Pelotomaculum
           thermopropionicum SI]
 gi|146274955|dbj|BAF60704.1| asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit [Pelotomaculum
           thermopropionicum SI]
          Length = 103

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 47/93 (50%)

Query: 2   LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
           LI   +V  +A  SR+ + EE+  ++  +L+  L     +  ++ E V P   V+P++ V
Sbjct: 11  LITKKEVDHVALLSRLELTEEEKEIYTKQLDAILEYFRSLQRLDTENVPPTAHVLPLQNV 70

Query: 62  HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
            R D V      E  L+N P  E ++F VPK V
Sbjct: 71  FREDWVGQHMSREDALANCPDREGSYFRVPKIV 103


>gi|212704306|ref|ZP_03312434.1| hypothetical protein DESPIG_02361 [Desulfovibrio piger ATCC
          29098]
 gi|212672268|gb|EEB32751.1| hypothetical protein DESPIG_02361 [Desulfovibrio piger ATCC
          29098]
          Length = 98

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 49/87 (56%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V  +A  SR+++ +E+  LF  +  + L+ ++ +++V+   VEP+ S V      R D  
Sbjct: 12 VAHMAQLSRLAVSDEEKALFARQFGDILAYMDVLAQVDTSAVEPLYSPVSHATPMRDDQP 71

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAV 94
              + E +L NAP  ++++F+VP+ V
Sbjct: 72 ERKRRREDVLGNAPEHDEDYFIVPRIV 98


>gi|153856065|ref|ZP_01996956.1| hypothetical protein DORLON_02984 [Dorea longicatena DSM 13814]
 gi|149751727|gb|EDM61658.1| hypothetical protein DORLON_02984 [Dorea longicatena DSM 13814]
          Length = 97

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (61%)

Query: 35 LSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          L  ++ ++E++ +G+EPM  V P+K V R DVV +GD     L+NAP  +   F VPK +
Sbjct: 37 LDYIDTLNELDTDGIEPMSHVFPVKNVFREDVVTNGDGSAETLANAPLEKDQSFKVPKTI 96


>gi|78211839|ref|YP_380618.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Synechococcus
          sp. CC9605]
 gi|123578885|sp|Q3AMW9|GATC_SYNSC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|78196298|gb|ABB34063.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Synechococcus sp.
          CC9605]
          Length = 97

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 45/86 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+++A  +R+ + E+ I  +  +L + L  + ++ +V+ EGV      V +  V R D 
Sbjct: 8  DVRKVAQLARLDLPEDKIATYTGQLESILEYVGQLQQVDTEGVPETTRAVEVTNVTRVDG 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E IL  AP  E +FF VPK
Sbjct: 68 VQPTAVREDILDQAPQREGDFFRVPK 93


>gi|67924743|ref|ZP_00518146.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Crocosphaera
          watsonii WH 8501]
 gi|67853400|gb|EAM48756.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Crocosphaera
          watsonii WH 8501]
          Length = 98

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 47/91 (51%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          ++D   V+RIAH +R+ I   +   F  +L++ L   E++SE++ E V P    + +  +
Sbjct: 1  MLDKEQVQRIAHLARLDITSAEEEQFSGQLSSILDYFEQLSELDTENVPPTTRAIELSNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D         ++L  AP+ E  FF VP+
Sbjct: 61 TRQDKSEVYGDCAALLEEAPNPEGEFFRVPQ 91


>gi|17230684|ref|NP_487232.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Nostoc sp. PCC
          7120]
 gi|20138166|sp|P58527|GATC_ANASP RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|17132287|dbj|BAB74891.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Nostoc sp. PCC
          7120]
          Length = 96

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 50/91 (54%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   V+++A  +R+ +  E+   F  +L + L  +E+++E++V  V P    + +  +
Sbjct: 1  MIDREQVRKVALLARLELTPEEEEQFTTQLGSILDYVEQLNELDVSNVPPTARAIDVSNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D +      E+ILS+AP  E  FF VPK
Sbjct: 61 TREDNLQPYADREAILSSAPEQEGEFFKVPK 91


>gi|134300181|ref|YP_001113677.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Desulfotomaculum
          reducens MI-1]
 gi|134052881|gb|ABO50852.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Desulfotomaculum reducens MI-1]
          Length = 93

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 52/93 (55%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +I   DV+ +A  +R+ +KEE+  L+  +LN  L     + E+N + V P   V+P++ V
Sbjct: 1  MISKQDVEHVALLARLELKEEEKELYTQQLNKILDAARALQELNTDDVPPTAHVLPIQNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
           R D V      E  L+NAP  E+NFF VPK V
Sbjct: 61 FREDKVGKHIDPEKALANAPDREENFFKVPKIV 93


>gi|125973548|ref|YP_001037458.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Clostridium
          thermocellum ATCC 27405]
 gi|256003366|ref|ZP_05428357.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          thermocellum DSM 2360]
 gi|281417752|ref|ZP_06248772.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          thermocellum JW20]
 gi|166198861|sp|A3DE86|GATC_CLOTH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|125713773|gb|ABN52265.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Clostridium thermocellum ATCC 27405]
 gi|255992656|gb|EEU02747.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          thermocellum DSM 2360]
 gi|281409154|gb|EFB39412.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          thermocellum JW20]
 gi|316940211|gb|ADU74245.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          thermocellum DSM 1313]
          Length = 95

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 53/95 (55%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   ++ +A+ +R+ + E++     L L + +S ++K++E++   + P   V+P+K 
Sbjct: 1  MKVDKETIEYVANLARLRLSEKEKEKLALDLESIISYVDKLNELDTSKIIPTDHVIPIKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V D    + +L NAP  E   F VPK VE
Sbjct: 61 VFRDDEVRDSYPKDKMLMNAPEKEDGCFKVPKVVE 95


>gi|294102357|ref|YP_003554215.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Aminobacterium
          colombiense DSM 12261]
 gi|293617337|gb|ADE57491.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Aminobacterium
          colombiense DSM 12261]
          Length = 97

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   D++ +A  +R+ I E+++          ++   +++E+++EG++     V   +
Sbjct: 1  MAVSADDIRHVAALARLEITEDEVQAMHQHFEEIMTYFNRLNELDLEGIDAFALKVEENI 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D   D    E +L+ APH  ++FF VP+ VE
Sbjct: 61 PWREDRAIDSSVREDVLAEAPHRYEDFFRVPRIVE 95


>gi|294497114|ref|YP_003560814.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
          subunit C [Bacillus megaterium QM B1551]
 gi|295702479|ref|YP_003595554.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
          subunit C [Bacillus megaterium DSM 319]
 gi|294347051|gb|ADE67380.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Bacillus megaterium QM B1551]
 gi|294800138|gb|ADF37204.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Bacillus megaterium DSM 319]
          Length = 96

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 52/93 (55%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I V  VK +A+ +R+++ +++  LF  +L+  ++  E++ E++   V+P   V+ MK V 
Sbjct: 4  ISVDQVKHVANLARLAVTDDEAELFTKQLDAIITYAEQLDELDTTNVKPTSHVLDMKNVM 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          R D    G  +E ++ NAP  +  +  VP  +E
Sbjct: 64 REDKPAKGLPIEDVVKNAPDHKDGYIRVPTILE 96


>gi|312128133|ref|YP_003993007.1| glutamyl-tRNA(Gln) amidotransferase subunit C
          [Caldicellulosiruptor hydrothermalis 108]
 gi|311778152|gb|ADQ07638.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Caldicellulosiruptor hydrothermalis 108]
          Length = 94

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 46/89 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ +A+ +R+++ EE+I      L   +    K+SE+N EG+EP   V  +  V R D 
Sbjct: 6  DVEYVANLARLTLTEEEIEKMTKELGAIIEFANKLSELNTEGIEPTAHVFNLYNVFRSDE 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V      E IL NAP  +     VPK VE
Sbjct: 66 VKPSYPREEILKNAPSHDDVCIKVPKIVE 94


>gi|257069040|ref|YP_003155295.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Brachybacterium faecium DSM 4810]
 gi|256559858|gb|ACU85705.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Brachybacterium faecium DSM 4810]
          Length = 98

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 43/86 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV R+A  +RI + EE+I  F    ++ ++ +  +SEV  E V      + M  V R DV
Sbjct: 8  DVARLADLARIQLTEEEIARFAGEFDSIMNAVASVSEVATEDVPATSHPIAMTNVFREDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V +    E  L+ AP  +   F VP+
Sbjct: 68 VANTLTQEQALAAAPEAQDGRFAVPQ 93


>gi|332077723|gb|EGI88184.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          pneumoniae GA41301]
          Length = 100

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   EE+   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDVV +G   + +  N P  +  +  VP
Sbjct: 61 VLRPDVVEEGTDRDRLFKNVPEKDNYYIKVP 91


>gi|222528766|ref|YP_002572648.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Caldicellulosiruptor bescii DSM 6725]
 gi|254790980|sp|B9MQ83|GATC_ANATD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|222455613|gb|ACM59875.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Caldicellulosiruptor bescii DSM 6725]
          Length = 94

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 47/89 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ +A+ +R+++ EE+I      L   +    K+SE+N EG+EP   V+ +  V R D 
Sbjct: 6  DVEYVANLARLTLTEEEIEKMTKELGAIIEFANKLSELNTEGIEPTAHVLNIYNVFRSDE 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V      E IL NAP  +     VPK VE
Sbjct: 66 VKPSYPREEILKNAPSHDDVCIKVPKIVE 94


>gi|167631045|ref|YP_001681544.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase, c subunit
          [Heliobacterium modesticaldum Ice1]
 gi|229487510|sp|B0TDK8|GATC_HELMI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|167593785|gb|ABZ85533.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase, c subunit
          [Heliobacterium modesticaldum Ice1]
          Length = 94

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 49/94 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   +V+ +A  +R+ + E D+  +  +LN  L   +++  ++ + V P   V P+  
Sbjct: 1  MALTKAEVEYVAMLARLELSEADLERYTTQLNAILDYAQRLQGLDTKDVPPTAHVFPLHN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R D +    + E I++NAP  E  FF VP+ V
Sbjct: 61 VMRDDRIDPSMERERIVANAPEEEDGFFRVPRIV 94


>gi|311109322|ref|YP_003982175.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
          subunit C [Achromobacter xylosoxidans A8]
 gi|310764011|gb|ADP19460.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Achromobacter xylosoxidans A8]
          Length = 102

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 51/99 (51%), Gaps = 7/99 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMK- 59
          M ++  DV RIA  +RI +  +   L    LN  L ++E++  V+ +GVEP+   +    
Sbjct: 1  MALNDTDVARIARLARIELTPDQRTLAQAELNGILHLIERLQSVDTQGVEPLAHPLSAHE 60

Query: 60 ---MVHRPDVVCDGD---KVESILSNAPHVEKNFFVVPK 92
             +  R D V +     + E +L+NAP  ++  F+VPK
Sbjct: 61 DIVLRLREDAVTEPSSEARREELLANAPDAQEGLFLVPK 99


>gi|306825782|ref|ZP_07459121.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus sp.
           oral taxon 071 str. 73H25AP]
 gi|304432143|gb|EFM35120.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus sp.
           oral taxon 071 str. 73H25AP]
          Length = 125

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 46/91 (50%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M I   +V  +A+ S+++  EE+   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 26  MKITQEEVTHVANLSKLTFSEEETATFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 85

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
           V RPDV  +G   + +  N P  +  +  VP
Sbjct: 86  VLRPDVAEEGTDRDRLFKNVPEKDNYYIKVP 116


>gi|313672050|ref|YP_004050161.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit c
          [Calditerrivibrio nitroreducens DSM 19672]
 gi|312938806|gb|ADR17998.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Calditerrivibrio nitroreducens DSM 19672]
          Length = 97

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 49/89 (55%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +VK IA  S+++ ++++I  F+  LN+ L  + K++E++   VEP    + +  V RPD+
Sbjct: 9  NVKHIAKLSKLTFEDKEIGRFVNELNSILDYINKLNELDTSDVEPTSHALDLTNVTRPDI 68

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
                 E  L NAP    N F VP+ +E
Sbjct: 69 PERVITREEALQNAPDEGYNHFKVPRIIE 97


>gi|306834214|ref|ZP_07467334.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          bovis ATCC 700338]
 gi|304423787|gb|EFM26933.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          bovis ATCC 700338]
          Length = 100

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 48/95 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  S++S  EE+   F   L+  + ++E ++EV+ EG+    ++   K 
Sbjct: 1  MKISEEEVRHVADLSKLSFAEEETAEFATTLSKIVDMVELLNEVDTEGIPVTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R DV   GD  + +  N P  E  +  VP  +E
Sbjct: 61 VMREDVAVAGDDRDELFKNVPQSENYYIKVPAILE 95


>gi|295093035|emb|CBK82126.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Coprococcus sp. ART55/1]
          Length = 95

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 38/65 (58%)

Query: 31 LNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVV 90
          +++ L  + K++E+N +GVE M    P   V R DVV +GD  E++L NAP  +   + V
Sbjct: 31 MSDMLDYVSKLNELNTDGVEAMSHTFPYNNVFREDVVVNGDDRENMLKNAPEQKDGCYKV 90

Query: 91 PKAVE 95
          PK  +
Sbjct: 91 PKTFD 95


>gi|83720669|ref|YP_440705.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          thailandensis E264]
 gi|167579377|ref|ZP_02372251.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          thailandensis TXDOH]
 gi|167617478|ref|ZP_02386109.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          thailandensis Bt4]
 gi|257140647|ref|ZP_05588909.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          thailandensis E264]
 gi|123538303|sp|Q2T294|GATC_BURTA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|83654494|gb|ABC38557.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
          thailandensis E264]
          Length = 99

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMV----SVV 56
          M + + DVKRIAH +R+ + + D    L +LN    ++E++  V+  G+ P+      ++
Sbjct: 1  MALTLTDVKRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVDTTGIAPLAHPIEQIL 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +    R DVV +    +     AP V+   ++VPK +E
Sbjct: 61 EVAQRLRDDVVTEHVNRDDNQRPAPAVQDGLYLVPKVIE 99


>gi|237748826|ref|ZP_04579306.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Oxalobacter formigenes OXCC13]
 gi|229380188|gb|EEO30279.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Oxalobacter formigenes OXCC13]
          Length = 100

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 53/100 (53%), Gaps = 5/100 (5%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVP--- 57
           M +D+ DV RIA  +++ + +        +LN+ L+++E++ +V+  GVEP+   +    
Sbjct: 1   MSLDLSDVDRIAQLAQLEVSDSQKQKTATQLNDILALVEQLRQVDTTGVEPLAHPISAFE 60

Query: 58  --MKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             + +  R D V + +      + AP VE   ++VPK +E
Sbjct: 61  DDLALRLREDAVTEENHRSEYQACAPAVENGLYLVPKVIE 100


>gi|254479918|ref|ZP_05093166.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [marine gamma
          proteobacterium HTCC2148]
 gi|214039480|gb|EEB80139.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [marine gamma
          proteobacterium HTCC2148]
          Length = 95

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 54/97 (55%), Gaps = 4/97 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I+  ++++IA  +RI I ++ I     R+   L +++++   +  G+EPM +  P+  
Sbjct: 1  MAIEQDEIEKIAELARIRIADDQIGEVTQRITEILGMVDQLQAADTAGIEPMAN--PLDA 58

Query: 61 VHR--PDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          + R   D V + ++ ++  + AP VE   ++VPK +E
Sbjct: 59 IQRLRADEVTETNRRDAFQAIAPAVENGLYLVPKVIE 95


>gi|332637420|ref|ZP_08416283.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Weissella cibaria KACC 11862]
          Length = 103

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 45/85 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ +A+ +++++ + +  +F   L     V+  +SEV+ EGV P  SV  M+ V R DV
Sbjct: 10 EVEHVANLAKLTLTDAEADMFTDHLEKIFEVVTTLSEVDTEGVAPTYSVTEMRTVLREDV 69

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
            +  +   +L+NAP        VP
Sbjct: 70 AVNAHQSAELLANAPEHTDTLIKVP 94


>gi|159902799|ref|YP_001550143.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Prochlorococcus marinus str. MIT 9211]
 gi|229487532|sp|A9BDK3|GATC_PROM4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|159887975|gb|ABX08189.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Prochlorococcus
          marinus str. MIT 9211]
          Length = 97

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 50/86 (58%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+++A  +R+++ E+ I  +  +L   L  + ++ EV+ E + P    V +  V R D+
Sbjct: 8  DVRKVATLARLNLPEDLIDTYTSQLEKILGYVAQLEEVDTEDIPPTSRAVEVTNVLREDI 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          + + D  E +++ AP+ E +FF VPK
Sbjct: 68 IQETDIREDLINLAPNREGDFFRVPK 93


>gi|320547446|ref|ZP_08041733.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          equinus ATCC 9812]
 gi|320447923|gb|EFW88679.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          equinus ATCC 9812]
          Length = 100

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A+ S++S  +E+   F   L+  + ++E ++EV+ EGV    ++   K 
Sbjct: 1  MKISEEEVRHVANLSKLSFSDEETTEFATTLSKIVDMVELLNEVDTEGVPVTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R DV   GD  + +  N P  E  +  VP  +E
Sbjct: 61 VMREDVAVAGDDRDELFKNVPQSENYYIKVPAILE 95


>gi|258651692|ref|YP_003200848.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Nakamurella
          multipartita DSM 44233]
 gi|258554917|gb|ACV77859.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Nakamurella
          multipartita DSM 44233]
          Length = 102

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEG-VEPMVSVVPMKMVHRPD 65
          DV  +AH +R+ + E+++  ++ +L+  L  +  +S V  +  VEP    VP+  V+R D
Sbjct: 10 DVAHLAHLARLELTEQELDTYVGQLSVILDSVATVSAVAGDSEVEPTSHAVPLTNVYRDD 69

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVPK 92
          VV  G   E  L++AP  E   F VP+
Sbjct: 70 VVRPGLSREDALASAPAAEDGRFRVPQ 96


>gi|116750923|ref|YP_847610.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Syntrophobacter
          fumaroxidans MPOB]
 gi|116699987|gb|ABK19175.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Syntrophobacter fumaroxidans MPOB]
          Length = 96

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 46/88 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ +A  +R+ + E +      ++N  L  +E ++E+N EGV P    + ++ V R D 
Sbjct: 9  EVRHVAGLARLELSEREEMRMTEQMNRILEYMETLNELNTEGVPPTTHAIQLRNVFRADE 68

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V    +    L+NAP  +   FVVPK +
Sbjct: 69 VQPSLERRDTLANAPETDGASFVVPKVI 96


>gi|124027985|ref|YP_001013305.1| glutamyl-tRNA amidotransferase subunit C [Hyperthermus butylicus
          DSM 5456]
 gi|123978679|gb|ABM80960.1| glutamyl-tRNA amidotransferase subunit C [Hyperthermus butylicus
          DSM 5456]
          Length = 94

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 50/90 (55%)

Query: 6  VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD 65
          VDVK +A  +RI + +E++ LF   +N+ + ++ K+ E  VE VEP+   +  + + R D
Sbjct: 4  VDVKHVAWLARIQLSDEEVELFKRLVNSAMKLINKLLEAPVEDVEPLYHALDKEGLLRSD 63

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
                  E +L+NA   ++ + V P+ VE
Sbjct: 64 KPSIHLDRERVLANAAKSQEGYIVAPRTVE 93


>gi|332295472|ref|YP_004437395.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Thermodesulfobium narugense DSM 14796]
 gi|332178575|gb|AEE14264.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Thermodesulfobium narugense DSM 14796]
          Length = 99

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 50/94 (53%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   +  +A  +R+ +K+ ++      L   L+    +++VN + VEP     P+  +
Sbjct: 1  MIDKEIILHVAKLARLELKDNEVESLKEDLGKILNYFITLNDVNTDNVEPTFHPFPINNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           R D++ +   VE ILSNAP     +F+VP+ VE
Sbjct: 61 FREDIIKESYPVEEILSNAPESTLTYFLVPRIVE 94


>gi|322387224|ref|ZP_08060834.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          infantis ATCC 700779]
 gi|321141753|gb|EFX37248.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          infantis ATCC 700779]
          Length = 100

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   EE+   F   L+  + ++E +SEV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLKFSEEETAEFATTLSKIVDMVELLSEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV  +G   + +  N P  +  +  VP
Sbjct: 61 VLRPDVAEEGTDRDRLFKNVPEKDNYYIKVP 91


>gi|58336858|ref|YP_193443.1| Glu-tRNA(Gln) amidotransferase subunit C [Lactobacillus
          acidophilus NCFM]
 gi|227903417|ref|ZP_04021222.1| Glu-tRNA(Gln) amidotransferase subunit C [Lactobacillus
          acidophilus ATCC 4796]
 gi|75433013|sp|Q5FLL2|GATC_LACAC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|58254175|gb|AAV42412.1| Glu-tRNA(Gln) amidotransferase subunit C [Lactobacillus
          acidophilus NCFM]
 gi|227868893|gb|EEJ76314.1| Glu-tRNA(Gln) amidotransferase subunit C [Lactobacillus
          acidophilus ATCC 4796]
          Length = 102

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV- 66
          +K +A  SR++  EE++  F  ++ + +++ +++SEV+ EGVE  V VV    V R D+ 
Sbjct: 8  IKHVATLSRLAFNEEELDKFTDQMGSIINMADQLSEVDTEGVEETVQVVDRDTVFREDIP 67

Query: 67 -VCDGDKVESILSNAPHVEKNFFVVP 91
              G   E+++ N P     +  VP
Sbjct: 68 EHWQGQTRETLMENVPEKANGYIKVP 93


>gi|269467792|gb|EEZ79550.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit [uncultured
          SUP05 cluster bacterium]
          Length = 95

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 50/88 (56%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V +IA+ +R+S+ ++++      LNN L++ E++++V+   VEPM   + M    R D V
Sbjct: 8  VGQIAYLARLSLSKKELESNTKDLNNILNLAEQLAQVDTHDVEPMAHPLHMSQRLRTDEV 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + D+     S AP   K+ ++VP  +E
Sbjct: 68 TEKDQSTLFQSIAPKTGKDHYLVPTVIE 95


>gi|218132401|ref|ZP_03461205.1| hypothetical protein BACPEC_00260 [Bacteroides pectinophilus ATCC
          43243]
 gi|217992739|gb|EEC58741.1| hypothetical protein BACPEC_00260 [Bacteroides pectinophilus ATCC
          43243]
          Length = 101

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 37/59 (62%)

Query: 35 LSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKA 93
          L  ++ ++E++  GVEPM  V P+  V R DVV +GD  ++I +NAP  +   F+VPK 
Sbjct: 41 LDYVDMLNELDTSGVEPMSHVFPVNNVFREDVVTNGDDRDNITANAPQKKDGAFMVPKT 99


>gi|20093307|ref|NP_619382.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Methanosarcina
          acetivorans C2A]
 gi|19918665|gb|AAM07862.1| glutamyl-tRNA (Gln) amidotransferase, subunit C [Methanosarcina
          acetivorans C2A]
          Length = 93

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 45/86 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ I   +RI I E++   ++ +LN+ L    ++ E+  E V P   V  +  V R DV
Sbjct: 6  DVEHIGWLARIDINEQETVEYMEKLNSVLEYFGQLDELPTEDVAPTYHVAEIHNVFREDV 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V +    E++L+N  H +   F VPK
Sbjct: 66 VEECLSQETVLANTEHKQDGTFRVPK 91


>gi|241896424|ref|ZP_04783720.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Weissella paramesenteroides ATCC 33313]
 gi|241870404|gb|EER74155.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Weissella paramesenteroides ATCC 33313]
          Length = 108

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 47/85 (55%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ +A  +++++ + +  +F   L     ++  ++EV+ E V+P  SV  M+ V R DV
Sbjct: 15 EVEHVASLAKLALTDAEADMFTDHLGKIFDIVTTLAEVDTENVKPTYSVTEMQTVLRDDV 74

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
            +  + +S+L+NAP  +     VP
Sbjct: 75 AVNAQQSQSLLNNAPEHQDTLIKVP 99


>gi|186683675|ref|YP_001866871.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Nostoc
          punctiforme PCC 73102]
 gi|229487526|sp|B2J1S6|GATC_NOSP7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|186466127|gb|ACC81928.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Nostoc
          punctiforme PCC 73102]
          Length = 97

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 49/91 (53%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   V ++A+ +R+ +  E+   F  +L + L  ++++ E++V  V P    + +  +
Sbjct: 1  MIDQEQVHKVANLARLELTPEEEEQFTTQLGSILDYIQQLDELDVSNVPPTTRAIDVSNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D +      ESIL++AP  E  FF VPK
Sbjct: 61 TREDELQPYANRESILNSAPEQEGEFFKVPK 91


>gi|299820615|ref|ZP_07052505.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Listeria grayi DSM
          20601]
 gi|299818110|gb|EFI85344.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Listeria grayi DSM
          20601]
          Length = 97

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 49/88 (55%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+++AH +++ + E +  +F  +L N ++++EK++ ++   VEP    + +  V R DV 
Sbjct: 9  VEKVAHLAKLEVSEREAEVFAEQLGNIITMVEKLNTLDTANVEPTSHAIDVSNVLREDVA 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
            G   + +L NAP  +   F VP  +E
Sbjct: 69 HPGLDRKLVLKNAPETQDGMFKVPTILE 96


>gi|53802669|ref|YP_112638.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Methylococcus
          capsulatus str. Bath]
 gi|81683213|sp|Q60CK7|GATC_METCA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|53756430|gb|AAU90721.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methylococcus
          capsulatus str. Bath]
          Length = 95

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   +V +IA  +R++I ++ +  +   L+  L  +E++  V+   V PM   +    
Sbjct: 1  MSLSAAEVNKIAWLARLAIDDDKVEAYARDLSQILGFVEQLGSVDTSRVAPMAHPLDEAQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD V + D+     ++AP VE   ++VPK +E
Sbjct: 61 RLRPDDVTETDQRALFQAHAPLVEAGLYLVPKVIE 95


>gi|78188296|ref|YP_378634.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Chlorobium
          chlorochromatii CaD3]
 gi|123580415|sp|Q3ATT4|GATC_CHLCH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|78170495|gb|ABB27591.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Chlorobium chlorochromatii CaD3]
          Length = 95

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 46/94 (48%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV  IA  +++   E ++      LNN L  + K+ E+N +G++P+  +     
Sbjct: 1  MSVTIKDVTYIAELAKLRFSEPEMETMTNELNNILHYIAKLDEINTDGIQPLSGIYDPVN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R DV         +L NAP  +  FF VPK +
Sbjct: 61 VLREDVELQPLTSSEVLHNAPDRQDRFFKVPKVI 94


>gi|54026230|ref|YP_120472.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Nocardia
          farcinica IFM 10152]
 gi|81602525|sp|Q5YRT3|GATC_NOCFA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|54017738|dbj|BAD59108.1| putative glutamyl-tRNA amidotransferase subunit C [Nocardia
          farcinica IFM 10152]
          Length = 99

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ + ++  F  +L++ LS +  ISEV    V    S  P+  V RPD 
Sbjct: 8  EVAHLARLSRLALSDAELDQFAGQLDSILSHVRTISEVAAADVPATASPDPVTNVTRPDT 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V  G   +  L+ AP VE+  F+VP+
Sbjct: 68 VVPGLTPDQALAAAPAVEEQRFMVPQ 93


>gi|332799844|ref|YP_004461343.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Tepidanaerobacter sp. Re1]
 gi|332697579|gb|AEE92036.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Tepidanaerobacter sp. Re1]
          Length = 96

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M++D   V R+A  + + I EE+       L+  L   +K+++ + EGV P +  +  + 
Sbjct: 1  MIMDKDTVGRMADIAHMYISEEEKSRISKELSFLLECFDKLNQADTEGVMPTIHPITDRN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          + R DVV +   +E +L N+P  +  FF VP+ +E
Sbjct: 61 ILREDVVWESLPIEEVLKNSPDKDNRFFRVPRIIE 95


>gi|304310263|ref|YP_003809861.1| Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase, subunit C [gamma
           proteobacterium HdN1]
 gi|301795996|emb|CBL44200.1| Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase, subunit C [gamma
           proteobacterium HdN1]
          Length = 101

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 47/88 (53%)

Query: 8   VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
           V++IAH +R+ I ++ +  +  RL   L ++ K+ +  V  + PM   +      R D V
Sbjct: 14  VRKIAHLARLGISDDQLGEYAQRLGGVLDLVAKLQDAPVGDLAPMAHPLDATQRLRADAV 73

Query: 68  CDGDKVESILSNAPHVEKNFFVVPKAVE 95
            + ++ +++ + AP  E   ++VPK +E
Sbjct: 74  TETNQRKALQNVAPETEDGLYLVPKVIE 101


>gi|119509188|ref|ZP_01628338.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Nodularia
          spumigena CCY9414]
 gi|119466030|gb|EAW46917.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Nodularia
          spumigena CCY9414]
          Length = 97

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 49/91 (53%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   V ++A  +R+ +  E+   F  +L + L  +E+++EV+V  V P    + +  V
Sbjct: 1  MIDREQVHKVALLARLELTPEEEQQFTTQLGSILDYIEQLNEVDVSDVPPTTRAIDVSNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D +    + E+IL+ AP  E  FF VPK
Sbjct: 61 TRKDELQPYPEREAILNGAPEQEGEFFKVPK 91


>gi|325288908|ref|YP_004265089.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Syntrophobotulus glycolicus DSM 8271]
 gi|324964309|gb|ADY55088.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Syntrophobotulus glycolicus DSM 8271]
          Length = 94

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 48/94 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   +V+ +A  +R+ + EE+I  +  +LN+ L   E + +++  G+ P    V +  
Sbjct: 1  MKLSRQEVEHVALLARLELSEEEIGRYTEQLNSVLGHAEMLQKLDTTGIMPTAHAVELYN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R D V    + E  L NAP  E  FF VP+ V
Sbjct: 61 VMRDDEVKASIEQEKALQNAPDSEGGFFRVPRIV 94


>gi|253681084|ref|ZP_04861887.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum D str. 1873]
 gi|253562933|gb|EES92379.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum D str. 1873]
          Length = 94

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 54/94 (57%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +I  +DV+ IA  ++++  EE+  + +  LN  L  +EK++E+N + +   V+   ++  
Sbjct: 1  MISKIDVEYIAKLAKLNFSEEEEKILIDDLNKILDNMEKLNELNTDDINITVNPYYIENQ 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +R D V +   ++ +L NAP  +  + VVPK +E
Sbjct: 61 YREDEVEESFTLDMVLKNAPDSQSQYIVVPKVIE 94


>gi|310643936|ref|YP_003948694.1| glutamyl-tRNA(gln) amidotransferase, c subunit [Paenibacillus
          polymyxa SC2]
 gi|309248886|gb|ADO58453.1| Glutamyl-tRNA(Gln) amidotransferase, C subunit [Paenibacillus
          polymyxa SC2]
          Length = 95

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   DV+ +A  SR+++ E +      +LN  L   EK++E++ E V+P   V+ +  
Sbjct: 1  MNISKEDVRHVARLSRLNLTENEEETMTGQLNAILHYAEKLNELDTEQVKPTTHVLHVSN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V +    E ++ NAP  E   F VP  +E
Sbjct: 61 VMRDDEVRESLTHEQVMRNAPEEEDGQFKVPAVLE 95


>gi|168485571|ref|ZP_02710079.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae CDC1087-00]
 gi|183571206|gb|EDT91734.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae CDC1087-00]
          Length = 100

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   EE+   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV  +G   + +  N P  +  +  VP
Sbjct: 61 VLRPDVAEEGTNRDRLFKNVPEQDNYYIKVP 91


>gi|149003535|ref|ZP_01828409.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP14-BS69]
 gi|147758471|gb|EDK65470.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP14-BS69]
          Length = 100

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   EE+   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV  +G   + +  N P  +  +  VP
Sbjct: 61 VLRPDVAEEGTNRDRLFKNVPEQDNYYIKVP 91


>gi|148244480|ref|YP_001219174.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Candidatus
          Vesicomyosocius okutanii HA]
 gi|166218193|sp|A5CX64|GATC_VESOH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|146326307|dbj|BAF61450.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Candidatus
          Vesicomyosocius okutanii HA]
          Length = 95

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 49/89 (55%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           V +IAH + +S+ E  +      LN   S+ E+++ + ++GVEPM+  + M    R DV
Sbjct: 7  QVSQIAHLACLSLNEAQLKDNTQNLNTITSLFEQLANIEIDGVEPMLHPLHMFQRLREDV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V + +++    S AP V   +++VP  ++
Sbjct: 67 VSEKEQLALFQSIAPKVRNGYYLVPTVIK 95


>gi|254443659|ref|ZP_05057135.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Verrucomicrobiae
          bacterium DG1235]
 gi|198257967|gb|EDY82275.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Verrucomicrobiae
          bacterium DG1235]
          Length = 96

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 47/90 (52%)

Query: 6  VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD 65
          +D+   A  +RI++ + +      +L++ +  +EK+ E++  GVEP     P+  V + D
Sbjct: 7  IDIDYTAKLARINLTDAEKEKLSSQLDSIIGYVEKLEELDTSGVEPTAHPHPVYNVWQED 66

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          VV     +E  L NAP    N  VVPK V+
Sbjct: 67 VVASELSIEEALKNAPAQRDNMIVVPKVVD 96


>gi|330818668|ref|YP_004362373.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit [Burkholderia
          gladioli BSR3]
 gi|327371061|gb|AEA62417.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit [Burkholderia
          gladioli BSR3]
          Length = 99

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 54/101 (53%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DVKRIAH +R+ I + +    L +LN+   ++E++  V+  G+ P+    P++ 
Sbjct: 1  MALTLNDVKRIAHLARLEIADAEAEHTLAQLNDFFGLVEQMRAVDTTGIAPLAH--PIEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +       R DVV +    +     AP V++  F+VPK +E
Sbjct: 59 IQDVAQRLREDVVTEHVNRDENQRPAPAVQEGLFLVPKVIE 99


>gi|189500988|ref|YP_001960458.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Chlorobium
          phaeobacteroides BS1]
 gi|229487461|sp|B3EMY8|GATC_CHLPB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|189496429|gb|ACE04977.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Chlorobium
          phaeobacteroides BS1]
          Length = 95

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 48/94 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV  IA  +R+S  + +       LN  L  +EK+ EV+ +GVEP+ S+     
Sbjct: 1  MSVTIKDVAYIAELARLSFTDTEKEKMTSELNAILQYVEKLDEVDTDGVEPLSSIHDEVN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R DV  +    E+ L NAP     FF VPK +
Sbjct: 61 VLRDDVRQESVPNETALLNAPDKLDRFFRVPKVI 94


>gi|327537789|gb|EGF24494.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Rhodopirellula
          baltica WH47]
          Length = 107

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 47/86 (54%)

Query: 6  VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD 65
          VD++++A  +R+ + E++   F  ++ + L  +E++SE++  GVEPM S + ++   R D
Sbjct: 12 VDIQKLARLARLQLTEQEQTDFGPQITDILGFVEQLSELDTSGVEPMTSALDVENRFRDD 71

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVP 91
          V       E     AP  +   F+VP
Sbjct: 72 VPDQSLSAEVATRTAPASQDGTFLVP 97


>gi|171464297|ref|YP_001798410.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Polynucleobacter
          necessarius subsp. necessarius STIR1]
 gi|171193835|gb|ACB44796.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Polynucleobacter
          necessarius subsp. necessarius STIR1]
          Length = 97

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 49/97 (50%), Gaps = 12/97 (12%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVV--------PM 58
          DV+RIAH SR+ + + +    L +L    S++E++  V+  G+EP+   +        PM
Sbjct: 5  DVQRIAHLSRLELNQAEAEAILPQLQAIFSLVEEMQAVDTTGLEPLAHPILFLRDLAQPM 64

Query: 59 KMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
              R D + + D     + +AP     +F+VP+ +E
Sbjct: 65 ----RADQITESDHRAENMQSAPAQHDGYFLVPRVIE 97


>gi|15902439|ref|NP_357989.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae R6]
 gi|116515845|ref|YP_815908.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae D39]
 gi|148993979|ref|ZP_01823349.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP9-BS68]
 gi|149012187|ref|ZP_01833296.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP19-BS75]
 gi|168488127|ref|ZP_02712326.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae SP195]
 gi|221231301|ref|YP_002510453.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae ATCC 700669]
 gi|225854010|ref|YP_002735522.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae JJA]
 gi|225858289|ref|YP_002739799.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae 70585]
 gi|30315904|sp|P59661|GATC_STRR6 RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|122279206|sp|Q04M40|GATC_STRP2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|254791015|sp|C1C5H3|GATC_STRP7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|254791016|sp|B8ZLK2|GATC_STRPJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|254791018|sp|C1CCK1|GATC_STRZJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|15457957|gb|AAK99199.1| Glutamyl tRNA-Gln amidotransferase, subunit C [Streptococcus
          pneumoniae R6]
 gi|116076421|gb|ABJ54141.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae D39]
 gi|147763789|gb|EDK70723.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP19-BS75]
 gi|147927568|gb|EDK78595.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP9-BS68]
 gi|183573184|gb|EDT93712.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae SP195]
 gi|220673761|emb|CAR68260.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae ATCC 700669]
 gi|225720218|gb|ACO16072.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae 70585]
 gi|225722226|gb|ACO18079.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae JJA]
 gi|301793676|emb|CBW36061.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae INV104]
 gi|332075281|gb|EGI85751.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          pneumoniae GA17570]
          Length = 100

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   EE+   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV  +G   + +  N P  +  +  VP
Sbjct: 61 VLRPDVAEEGTDRDRLFKNVPEQDNYYIKVP 91


>gi|241889989|ref|ZP_04777287.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Gemella
          haemolysans ATCC 10379]
 gi|241863611|gb|EER67995.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Gemella
          haemolysans ATCC 10379]
          Length = 96

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 44/88 (50%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V  IAH SR+ I+E ++  ++ +L   + +   I+    E V+P   V+ +  V R DV 
Sbjct: 9  VAHIAHLSRLEIQESEVDGYIEKLEKVVDLFNTINSAPTENVKPTYHVLDLVNVFREDVA 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           DG   E +L N+   E   F VP  +E
Sbjct: 69 HDGMDREEVLKNSKETEAGQFKVPTIIE 96


>gi|304317507|ref|YP_003852652.1| glutamyl-tRNA(Gln) amidotransferase subunit C
          [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302779009|gb|ADL69568.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 95

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 50/95 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A  +R+   +E++  +  +L+N +  ++K++E+N +  EP   +VP+  
Sbjct: 1  MSITKDEVIHVAKLARLKFTDEELEKYSHQLDNIIKYVDKLNELNTDDAEPTAHIVPISN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V      E +L NA   E   F VPK +E
Sbjct: 61 VFREDEVVPSMDREKVLMNAKEKEDGCFKVPKIIE 95


>gi|75910094|ref|YP_324390.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Anabaena
          variabilis ATCC 29413]
 gi|123608491|sp|Q3M691|GATC_ANAVT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|75703819|gb|ABA23495.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Anabaena variabilis ATCC 29413]
          Length = 96

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 50/91 (54%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   V+++A  +R+ +  ++   F  +L + L  +E+++E++V  V P    + +  +
Sbjct: 1  MIDREQVRKVALLARLELTPQEEEQFTTQLGSILDYVEQLNELDVSNVPPTARAIDVSNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D +      E+ILS+AP  E  FF VPK
Sbjct: 61 TREDNLQPYADREAILSSAPEQEGEFFKVPK 91


>gi|149006425|ref|ZP_01830137.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP18-BS74]
 gi|307126653|ref|YP_003878684.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae 670-6B]
 gi|147762202|gb|EDK69164.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP18-BS74]
 gi|306483715|gb|ADM90584.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae 670-6B]
 gi|332076882|gb|EGI87344.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          pneumoniae GA17545]
          Length = 100

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   EE+   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV  +G   + +  N P  +  +  VP
Sbjct: 61 VLRPDVAEEGTNRDRLFKNVPEKDNYYIKVP 91


>gi|146328910|ref|YP_001209857.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Dichelobacter
          nodosus VCS1703A]
 gi|146232380|gb|ABQ13358.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Dichelobacter
          nodosus VCS1703A]
          Length = 96

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 45/88 (51%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V++ A  S +++ EE++  F   L     + + ++  ++  + P+   + +    RPD+ 
Sbjct: 9  VRKTAKLSLLALSEEEVAQFSQELAQIFPLFDALNHEDISALSPLAHPLELHQPMRPDIA 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + D + SI  NAP  E+ F  VPK +E
Sbjct: 69 IECDLLASIAENAPEFEQQFITVPKVIE 96


>gi|262203133|ref|YP_003274341.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Gordonia
          bronchialis DSM 43247]
 gi|262086480|gb|ACY22448.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Gordonia
          bronchialis DSM 43247]
          Length = 103

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 48/86 (55%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+ +  +++ ++  +L++ L+ + ++SEV  + V        +  V RPDV
Sbjct: 12 EVAHLARLSRLDLTPDELDVYAEQLDSILTHVAQVSEVAADDVPGTAHPAELANVLRPDV 71

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V  G   E  LS AP VE++ F VP+
Sbjct: 72 VVPGLTTEQALSGAPAVEQDRFAVPQ 97


>gi|303255415|ref|ZP_07341481.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae BS455]
 gi|303259510|ref|ZP_07345487.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP-BS293]
 gi|303262373|ref|ZP_07348316.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP14-BS292]
 gi|303264791|ref|ZP_07350708.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae BS397]
 gi|303266630|ref|ZP_07352515.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae BS457]
 gi|303268863|ref|ZP_07354650.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae BS458]
 gi|307704286|ref|ZP_07641205.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus mitis
          SK597]
 gi|307706084|ref|ZP_07642903.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          mitis SK321]
 gi|307708259|ref|ZP_07644726.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          mitis NCTC 12261]
 gi|322377040|ref|ZP_08051532.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus sp.
          M334]
 gi|331266948|ref|YP_004326578.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          oralis Uo5]
 gi|301801347|emb|CBW34030.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae INV200]
 gi|302597660|gb|EFL64740.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae BS455]
 gi|302636472|gb|EFL66964.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP14-BS292]
 gi|302639444|gb|EFL69902.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP-BS293]
 gi|302641644|gb|EFL72004.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae BS458]
 gi|302643874|gb|EFL74136.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae BS457]
 gi|302645658|gb|EFL75888.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae BS397]
 gi|307615705|gb|EFN94911.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          mitis NCTC 12261]
 gi|307618484|gb|EFN97632.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          mitis SK321]
 gi|307622197|gb|EFO01215.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus mitis
          SK597]
 gi|321281753|gb|EFX58761.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus sp.
          M334]
 gi|326683620|emb|CBZ01238.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          oralis Uo5]
          Length = 100

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   EE+   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV  +G   + +  N P  +  +  VP
Sbjct: 61 VLRPDVAEEGTDRDRLFKNVPEKDNYYIKVP 91


>gi|167561084|ref|ZP_02354000.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
          oklahomensis EO147]
 gi|167574208|ref|ZP_02367082.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
          oklahomensis C6786]
          Length = 99

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 51/101 (50%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DVKRIAH +R+ + + D    L +LN    ++E++  V+  G+ P+    P++ 
Sbjct: 1  MALTLTDVKRIAHLARLEMADADAEHTLTQLNEFFGLVEQMQAVDTTGIAPLAH--PIEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +       R D V +    +     AP V+   ++VPK +E
Sbjct: 59 IQAVAQRLRDDAVTEHVSRDENQRPAPSVQDGLYLVPKVIE 99


>gi|182683402|ref|YP_001835149.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
           pneumoniae CGSP14]
 gi|182628736|gb|ACB89684.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
           pneumoniae CGSP14]
          Length = 120

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M I   +V  +A+ S++   EE+   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 21  MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 80

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
           V RPDV  +G   + +  N P  +  +  VP
Sbjct: 81  VLRPDVAEEGTDRDRLFKNVPEKDNYYIKVP 111


>gi|88607517|ref|YP_505661.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Anaplasma
           phagocytophilum HZ]
 gi|88598580|gb|ABD44050.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Anaplasma
           phagocytophilum HZ]
          Length = 106

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 9/94 (9%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMV-----SVVPMKMV 61
           ++ R++   R+ I EE++  +  +L + +S    ++EV+   V+P++     SV+P+   
Sbjct: 17  ELARVSKLVRLQIPEEEVDTYCRQLGDVVSWFGMLAEVDTTDVDPVLHGGVHSVLPL--- 73

Query: 62  HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V +GD  + IL NA   E  FFVV K VE
Sbjct: 74  -RQDEVHEGDMRDQILRNASSTEMGFFVVKKVVE 106


>gi|315612613|ref|ZP_07887526.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
           sanguinis ATCC 49296]
 gi|315315594|gb|EFU63633.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
           sanguinis ATCC 49296]
          Length = 125

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M I   +V  +A+ S++   EE+   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 26  MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 85

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
           V RPDV  +G   + +  N P  +  +  VP
Sbjct: 86  VLRPDVAEEGTDRDRLFKNVPEKDNYYIKVP 116


>gi|302865768|ref|YP_003834405.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Micromonospora
          aurantiaca ATCC 27029]
 gi|315502324|ref|YP_004081211.1| glutamyl-tRNA(gln) amidotransferase, c subunit [Micromonospora
          sp. L5]
 gi|302568627|gb|ADL44829.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Micromonospora
          aurantiaca ATCC 27029]
 gi|315408943|gb|ADU07060.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Micromonospora
          sp. L5]
          Length = 101

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 45/86 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ EE++  F  +L+  L  + ++ EV    + P    VP+  V R DV
Sbjct: 8  EVAHLARLSRLAVTEEELDTFAGQLDVILQSVAQVGEVAAADIPPTSHSVPLTNVLREDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V  G   +  LS AP  E+  F VP+
Sbjct: 68 VRPGLTPQEALSGAPDAEEQRFRVPR 93


>gi|219849029|ref|YP_002463462.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Chloroflexus
          aggregans DSM 9485]
 gi|254790990|sp|B8GCI2|GATC_CHLAD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|219543288|gb|ACL25026.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Chloroflexus
          aggregans DSM 9485]
          Length = 96

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 46/90 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +    V+ +A  +RI++ +E++ +   +L+  L  +  + EV+V  V P   V  +  
Sbjct: 1  MSLSEAQVRHVARLARIALSDEEVNVMRAQLSAILDYIAMLQEVDVSNVPPTAQVTGLTT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVV 90
          V RPDVV +    E  L+NAP  +   F V
Sbjct: 61 VWRPDVVGEMLTQEQALANAPDQQDGMFRV 90


>gi|89897482|ref|YP_520969.1| hypothetical protein DSY4736 [Desulfitobacterium hafniense Y51]
 gi|89336930|dbj|BAE86525.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 94

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 46/92 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   DV+R+A  SR+ + +E+   +   L  +LS L+ + + +   VE    V+PM  
Sbjct: 1  MKITPKDVERLAFVSRLELTDEEKTAYTRSLQESLSYLDLLKQADTTAVEAAERVLPMIN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          + R D    G   E + +NAP  E   F VP+
Sbjct: 61 LFREDKAQPGLASELVFANAPEEEDGAFKVPR 92


>gi|297559144|ref|YP_003678118.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Nocardiopsis
          dassonvillei subsp. dassonvillei DSM 43111]
 gi|296843592|gb|ADH65612.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Nocardiopsis
          dassonvillei subsp. dassonvillei DSM 43111]
          Length = 99

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ E ++     +L + L+ + K+ EV    + P    +P+  V+RPD 
Sbjct: 8  EVAHLARLSRLALDESELDTLAAQLGDILTAVAKVQEVAQGDIPPSSHALPLTNVYRPDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
             G   +  L+ AP VE   F VP+
Sbjct: 68 ARPGLAHDQALAGAPAVEDQRFRVPR 93


>gi|296119557|ref|ZP_06838115.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Corynebacterium
          ammoniagenes DSM 20306]
 gi|295967440|gb|EFG80707.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Corynebacterium
          ammoniagenes DSM 20306]
          Length = 98

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 45/85 (52%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          +  +A  SR+++ EE++  F  +++  +  +  + +V+ EGVEPM     +    R DV+
Sbjct: 9  ISHLAKLSRLALSEEELDQFASQIDEIVDSVSAVGKVDTEGVEPMSHPHSITTSMREDVI 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPK 92
                E  L  AP VE + FVVP+
Sbjct: 69 VRTLNAEQALDQAPAVEDDRFVVPQ 93


>gi|225181782|ref|ZP_03735220.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Dethiobacter
          alkaliphilus AHT 1]
 gi|225167556|gb|EEG76369.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Dethiobacter
          alkaliphilus AHT 1]
          Length = 95

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 47/88 (53%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V  +A+ +R+ I + +   F ++LN+ L   +K++ ++ + + P   V+PM+ V R D V
Sbjct: 8  VDHVANLARLEITDAEADEFTIQLNSILEYADKLNRLDTKDITPTAHVMPMQNVFREDEV 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
                E  L+NAP  E   F VP  +E
Sbjct: 68 HTCLPREQALANAPEEEDGMFRVPPVIE 95


>gi|306828970|ref|ZP_07462162.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus mitis
           ATCC 6249]
 gi|304429148|gb|EFM32236.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus mitis
           ATCC 6249]
          Length = 125

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 46/91 (50%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M I   +V  +A+ S++   E++   F   L+  + ++E +SEV+  GV P  ++   K 
Sbjct: 26  MKITQEEVTHVANLSKLRFSEDETAAFATTLSKIVDMVELLSEVDTTGVAPTTTMADRKT 85

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
           V RPDV  +G   + +  N P  +  +  VP
Sbjct: 86  VLRPDVAEEGTDRDRLFKNVPEKDNYYIKVP 116


>gi|152980596|ref|YP_001351885.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
           [Janthinobacterium sp. Marseille]
 gi|166199151|sp|A6SUD8|GATC_JANMA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit C; Short=Asp/Glu-ADT subunit C
 gi|151280673|gb|ABR89083.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Janthinobacterium
           sp. Marseille]
          Length = 100

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 56/100 (56%), Gaps = 5/100 (5%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM----VSVV 56
           M +++ DVKR++  ++I +  E     L +LN   +++E++  V+  G+EP+     +++
Sbjct: 1   MSLELSDVKRLSTLAQIELTTEQSAQTLDKLNGIFALVEQLRAVDTTGIEPLNHPIATML 60

Query: 57  P-MKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           P + +  R DVV + ++ +     AP  +   ++VPK +E
Sbjct: 61  PDLALRLREDVVSEANRRDDYQKVAPATQDGLYLVPKVIE 100


>gi|51893960|ref|YP_076651.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Symbiobacterium
          thermophilum IAM 14863]
 gi|81610383|sp|Q67KJ1|GATC_SYMTH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|51857649|dbj|BAD41807.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Symbiobacterium
          thermophilum IAM 14863]
          Length = 96

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 50/95 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   +++R+A  +R+S+ EE+I  F  +LN  L  +E+I+ ++V  V P    V ++ 
Sbjct: 1  MAVTRDEIQRVARLARLSLSEEEIETFAEQLNRILEHVERINRLDVADVPPTYHGVALQH 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D        E++L+ AP  E   + VPK  E
Sbjct: 61 PFREDKPLPSLDREAVLALAPEAEAGCYKVPKITE 95


>gi|328462073|gb|EGF34246.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Lactobacillus helveticus MTCC 5463]
          Length = 102

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV- 66
          +K +A  SR++  EE++  F  ++ + +++ +++SEV+ EGVE  V VV    V R D  
Sbjct: 8  IKHVATLSRLAFNEEELGKFTDQMGSIINMADQLSEVDTEGVEETVQVVDRDTVFREDKP 67

Query: 67 -VCDGDKVESILSNAPHVEKNFFVVP 91
              G   E++++N P     +  VP
Sbjct: 68 EHWQGQNRETLMANVPEKANGYIKVP 93


>gi|227488029|ref|ZP_03918345.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Corynebacterium glucuronolyticum ATCC 51867]
 gi|227542670|ref|ZP_03972719.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Corynebacterium glucuronolyticum ATCC 51866]
 gi|227091891|gb|EEI27203.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Corynebacterium glucuronolyticum ATCC 51867]
 gi|227181553|gb|EEI62525.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Corynebacterium glucuronolyticum ATCC 51866]
          Length = 97

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+++ EE+I  F  +++  +  +  +  V+ EGVEPM          R D 
Sbjct: 8  EVAHLATLARLALSEEEITTFASQIDGIIGHVSAVQNVDTEGVEPMSHPHATHTAMRKDT 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E+ L  AP  E++ FVVP+
Sbjct: 68 VAPSLSQEAALDQAPEKEEDKFVVPQ 93


>gi|317968659|ref|ZP_07970049.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Synechococcus
          sp. CB0205]
          Length = 97

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+++A  +R+ + E+ I  +  +L   L  ++ +  V+ +GV      V +  V R D 
Sbjct: 8  DVRKVAKLARLDLPEDKIATYTGQLERILDYVDHLQAVDTDGVPATTRAVEVVNVTREDT 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V   D  E +L+ AP  E +FF VPK
Sbjct: 68 VVATDVREQLLNEAPLREGDFFRVPK 93


>gi|323467078|gb|ADX70765.1| Glu-tRNA(Gln) amidotransferase subunit C [Lactobacillus helveticus
           H10]
          Length = 118

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 8   VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV- 66
           +K +A  SR++  EE++  F  ++ + +++ +++SEV+ EGVE  V VV    V R D  
Sbjct: 24  IKHVATLSRLAFNEEELGKFTDQMGSIINMADQLSEVDTEGVEETVQVVDRDTVFREDKP 83

Query: 67  -VCDGDKVESILSNAPHVEKNFFVVP 91
               G   E++++N P     +  VP
Sbjct: 84  EHWQGQNRETLMANVPEKANGYIKVP 109


>gi|262375782|ref|ZP_06069014.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acinetobacter
           lwoffii SH145]
 gi|262309385|gb|EEY90516.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acinetobacter
           lwoffii SH145]
          Length = 104

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 46/88 (52%)

Query: 8   VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
           V  IA+ +R+S+ +     +   LN  L ++E +  +N +GVEP+ S        R DVV
Sbjct: 17  VSAIANLARLSLNDTQSAEYAQSLNKILGMMETLKGINTDGVEPLKSPFDHPQPLREDVV 76

Query: 68  CDGDKVESILSNAPHVEKNFFVVPKAVE 95
            + +  E   + AP V+   ++VP+ +E
Sbjct: 77  SESNHREEYQAVAPAVQDGLYLVPRVIE 104


>gi|95931419|ref|ZP_01314127.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfuromonas
          acetoxidans DSM 684]
 gi|95132537|gb|EAT14228.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfuromonas
          acetoxidans DSM 684]
          Length = 95

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  +R+++ ++++      ++  L  +E+++E++ + + PM   VP++ 
Sbjct: 1  MKITRSEVENVARLARLALADDELDRLTGEMDAILGYVEQLNELDTDDIIPMAHAVPLEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V      E  L+NAP  +   F VPK +E
Sbjct: 61 AFRADEVTPSLGTEKALANAPDPDDGCFGVPKVIE 95


>gi|291520974|emb|CBK79267.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Coprococcus catus GD/7]
          Length = 95

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 49/88 (55%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          ++ +A  +++ + +E+       L N +  ++ +++++  G+EPM  V     V R D+V
Sbjct: 8  IEYVAALAKLDLTDEEKERAKKDLGNIIGYVDTMNQLDTTGIEPMSHVFAYHNVFREDLV 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +G   ++IL+NAP  +   F VP+ VE
Sbjct: 68 TNGPDRDNILANAPEEKDGGFKVPRTVE 95


>gi|260102792|ref|ZP_05753029.1| glutamyl-tRNA(Gln) amidotransferase [Lactobacillus helveticus DSM
           20075]
 gi|260083396|gb|EEW67516.1| glutamyl-tRNA(Gln) amidotransferase [Lactobacillus helveticus DSM
           20075]
          Length = 113

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 8   VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV- 66
           +K +A  SR++  EE++  F  ++ + +++ +++SEV+ EGVE  V VV    V R D  
Sbjct: 19  IKHVATLSRLAFNEEELGKFTDQMGSIINMADQLSEVDTEGVEETVQVVDRDTVFREDKP 78

Query: 67  -VCDGDKVESILSNAPHVEKNFFVVP 91
               G   E++++N P     +  VP
Sbjct: 79  EHWQGQNRETLMANVPEKANGYIKVP 104


>gi|91205948|ref|YP_538303.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rickettsia
           bellii RML369-C]
 gi|122425317|sp|Q1RHF0|GATC_RICBR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit C; Short=Asp/Glu-ADT subunit C
 gi|91069492|gb|ABE05214.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Rickettsia bellii
           RML369-C]
          Length = 100

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 50/95 (52%), Gaps = 6/95 (6%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           +VK+IA  +R+  +E+ +  F  RL++ + +++ ++E++   V+P+ SV  M+   RPD 
Sbjct: 6   EVKKIAKLARLKFEEDKVEEFSSRLSSIMDMIDILNEIDCTDVKPLTSVCDMQARMRPDE 65

Query: 67  VCDGDKVESILSNAPHVEKN------FFVVPKAVE 95
           V   D    +  N     +       +F+ PK VE
Sbjct: 66  VTSKDHSNELFDNVQGASQQLAKEVKYFITPKVVE 100


>gi|161507070|ref|YP_001577024.1| Glu-tRNA(Gln) amidotransferase subunit C [Lactobacillus helveticus
           DPC 4571]
 gi|160348059|gb|ABX26733.1| Glu-tRNA(Gln) amidotransferase subunit C [Lactobacillus helveticus
           DPC 4571]
          Length = 111

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 8   VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV- 66
           +K +A  SR++  EE++  F  ++ + +++ +++SEV+ EGVE  V VV    V R D  
Sbjct: 17  IKHVATLSRLAFNEEELGKFTDQMGSIINMADQLSEVDTEGVEETVQVVDRDTVFREDKP 76

Query: 67  -VCDGDKVESILSNAPHVEKNFFVVP 91
               G   E++++N P     +  VP
Sbjct: 77  EHWQGQNRETLMANVPEKANGYIKVP 102


>gi|219670626|ref|YP_002461061.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Desulfitobacterium
          hafniense DCB-2]
 gi|219540886|gb|ACL22625.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Desulfitobacterium hafniense DCB-2]
          Length = 94

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 46/92 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   DV+R+A  SR+ + +E+   +   L  +LS L+ + + +   VE    V+PM  
Sbjct: 1  MKITPKDVERLAFVSRLELTDEEKTAYTRSLQESLSYLDLLKQADTTAVEAAERVLPMIN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          + R D    G   E + +NAP  E   F VP+
Sbjct: 61 LFREDKAQPGLARELVFANAPEEEDGAFKVPR 92


>gi|163815776|ref|ZP_02207147.1| hypothetical protein COPEUT_01956 [Coprococcus eutactus ATCC
          27759]
 gi|158448917|gb|EDP25912.1| hypothetical protein COPEUT_01956 [Coprococcus eutactus ATCC
          27759]
          Length = 95

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 44/82 (53%)

Query: 14 FSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKV 73
           +++ + +E+       +++ L  + K++E+N +GVE M    P   V R DVV + D  
Sbjct: 14 LAKLELSQEEKEQAKKDMSDMLDYVSKLNELNTDGVEAMSHTFPYNNVFREDVVTNNDDR 73

Query: 74 ESILSNAPHVEKNFFVVPKAVE 95
          E++L NAP  +   + VPK  +
Sbjct: 74 ENMLKNAPEQKDGCYKVPKTFD 95


>gi|11499909|ref|NP_071153.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Archaeoglobus
          fulgidus DSM 4304]
 gi|6225421|sp|O27956|GATC_ARCFU RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|2648183|gb|AAB88922.1| Glu-tRNA amidotransferase, subunit C (gatC) [Archaeoglobus
          fulgidus DSM 4304]
          Length = 93

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 44/94 (46%), Gaps = 1/94 (1%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          ++ + DV   A  ++I I EE    F       L     + EV  E VEP   V+P+  V
Sbjct: 1  MVSIEDVYHTAELAKIEITEEQAEKFRKEFETILDYFNILDEVE-EDVEPTFHVLPLTNV 59

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           R D   +  K E  LSNA H E+ +F  P+ VE
Sbjct: 60 FREDEPGECLKQEEALSNAKHKEEGYFKGPRVVE 93


>gi|148544655|ref|YP_001272025.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
          reuteri DSM 20016]
 gi|184154008|ref|YP_001842349.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
          reuteri JCM 1112]
 gi|227363778|ref|ZP_03847885.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
          reuteri MM2-3]
 gi|325682989|ref|ZP_08162505.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Lactobacillus
          reuteri MM4-1A]
 gi|148531689|gb|ABQ83688.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Lactobacillus reuteri DSM 20016]
 gi|183225352|dbj|BAG25869.1| glutamyl-tRNA amidotransferase C subunit [Lactobacillus reuteri
          JCM 1112]
 gi|227071135|gb|EEI09451.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
          reuteri MM2-3]
 gi|324977339|gb|EGC14290.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Lactobacillus
          reuteri MM4-1A]
          Length = 105

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 2/86 (2%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD-- 65
          V+ +A  +++   ++++  F  +L N + + E +  V+ +GVEPM S      V R D  
Sbjct: 10 VEHVAELAKLEFPKDELGKFTTQLGNIIDMFEDLEAVDTDGVEPMTSATDRVNVMREDKA 69

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVP 91
          V    D+ E++L+NAP  +  +  VP
Sbjct: 70 VKSSKDEQEALLNNAPETDGGYIKVP 95


>gi|52550498|gb|AAU84347.1| glutamyl-tRNA amidotransferase subunit C [uncultured archaeon
          GZfos9D8]
          Length = 93

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +++ I   +RI + E +  LF  +L++ L     + E++ E VEP  +V+ +K V R D 
Sbjct: 6  EIEHIGWLARIELSEAEKELFEKQLSSILDYFAVLDELDTEDVEPTYNVIGIKDVVRKDE 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
            +G     +L NAP  EK +F  P+
Sbjct: 66 PKEGLSQSEVLRNAPKKEKGYFKSPR 91


>gi|166030611|ref|ZP_02233440.1| hypothetical protein DORFOR_00277 [Dorea formicigenerans ATCC
          27755]
 gi|166029613|gb|EDR48370.1| hypothetical protein DORFOR_00277 [Dorea formicigenerans ATCC
          27755]
          Length = 97

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (61%)

Query: 35 LSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          L  ++ ++E++ +G+EPM  V P+  V R DVV +GD     L+NAP ++   F VPK +
Sbjct: 37 LDYIDVLNELDTDGIEPMSHVFPVNNVFREDVVTNGDGSSDTLANAPLMKDQSFKVPKTI 96


>gi|237746689|ref|ZP_04577169.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Oxalobacter formigenes HOxBLS]
 gi|229378040|gb|EEO28131.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Oxalobacter formigenes HOxBLS]
          Length = 100

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 55/100 (55%), Gaps = 5/100 (5%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVP--- 57
           M +++ DV+RIA  +++ I +  +     +LNN L+++E++  ++  G+EP+   +    
Sbjct: 1   MPLELSDVERIAQLAQLEISDAQVRKTAEQLNNILAMVEQLRSIDTTGIEPLAHPISAFK 60

Query: 58  --MKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             + +  R DVV + +      + AP VE   ++VPK +E
Sbjct: 61  DDVALRLRDDVVTEENHRAEYQAPAPAVENGLYLVPKVIE 100


>gi|217967552|ref|YP_002353058.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Dictyoglomus
          turgidum DSM 6724]
 gi|226709618|sp|B8E2U4|GATC_DICTD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|217336651|gb|ACK42444.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Dictyoglomus
          turgidum DSM 6724]
          Length = 100

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          +K+ AH +R+ +  E+  L+  +L + L   +K+ EV+   +EPM  V+ +  + R D  
Sbjct: 10 LKKTAHLARLYLTPEEEELYAKQLQDILDYFKKLQEVDTSNIEPMAHVLSLSNIWREDEP 69

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAV 94
                E    NAP +E   F +P+ +
Sbjct: 70 KGSISQEEAFKNAPEIENLGFKIPRII 96


>gi|221633730|ref|YP_002522956.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Thermomicrobium
          roseum DSM 5159]
 gi|254791021|sp|B9L146|GATC_THERP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|221155675|gb|ACM04802.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thermomicrobium
          roseum DSM 5159]
          Length = 97

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 48/88 (54%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V  +A  +R+ + EE+  L   +L++ L  + +I E++ E + P   V+ ++ V R D V
Sbjct: 8  VDHVAMLARLGLTEEERELMREQLSSILEHVSRIQELDTEAIPPTAQVITLQNVWREDDV 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
               VE++L+NAP  E  FF V   +E
Sbjct: 68 RPSLPVEAVLANAPESEDGFFRVHAVLE 95


>gi|253579110|ref|ZP_04856381.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251850053|gb|EES78012.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 97

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 52/93 (55%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   ++ +   +++S+ EE+       +   L  +EK+ E++   VEPM  +   + V
Sbjct: 4  IIDDETMENVCILAKLSLSEEEKEKAKAEMQKMLDYVEKLDELDTSEVEPMSHIFQDENV 63

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
           R DVV +GD  E++L+NAP  ++  + VPK +
Sbjct: 64 FREDVVTNGDNKEAMLANAPKAKEGQYQVPKTI 96


>gi|225569280|ref|ZP_03778305.1| hypothetical protein CLOHYLEM_05362 [Clostridium hylemonae DSM
          15053]
 gi|225162079|gb|EEG74698.1| hypothetical protein CLOHYLEM_05362 [Clostridium hylemonae DSM
          15053]
          Length = 97

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%)

Query: 35 LSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          L  ++ ++E++ EG+EPM  V P+  V R D   +GD     L+NAP  ++  FVVPK +
Sbjct: 37 LDYIDTLNELDTEGIEPMSHVFPLNNVFRSDEAENGDGSAHTLANAPVQKEGSFVVPKTI 96


>gi|166367644|ref|YP_001659917.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Microcystis
          aeruginosa NIES-843]
 gi|189045167|sp|B0JVY2|GATC_MICAN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|166090017|dbj|BAG04725.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Microcystis
          aeruginosa NIES-843]
          Length = 98

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 49/91 (53%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   V++IAH +R+ I   +   F L+L+  L   E++SE++ E V P    + ++ +
Sbjct: 1  MIDRATVEKIAHLARLEINSGEEEQFALQLSGILDYFEQLSELDTENVLPTTRAIEIQNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D        E ++  +P  E ++F+VP+
Sbjct: 61 TRADSNRLYPDHEVLVQESPAPEGDYFLVPR 91


>gi|91200831|emb|CAJ73885.1| similar to glutamyl-tRNA(Gln) amidotransferase subunit C
          [Candidatus Kuenenia stuttgartiensis]
          Length = 95

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   D++ +A  S+  + +++  +F  +L   L  +EK++++N E + P++    +  
Sbjct: 1  MNISNKDIEYVASLSKFELSDDEKKIFTSQLREVLLYIEKLNKLNTENIAPLIHPFNITN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          + R D + +  + E  LS AP  E  FF VPK +E
Sbjct: 61 IFREDTLEESIRREKALSLAPATEGFFFKVPKVLE 95


>gi|33864082|ref|NP_895642.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Prochlorococcus marinus str. MIT 9313]
 gi|39931362|sp|Q7TUN4|GATC_PROMM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|33635666|emb|CAE21990.1| Glu-tRNAGln amidotransferase C subunit [Prochlorococcus marinus
          str. MIT 9313]
          Length = 97

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 48/90 (53%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I   DV+++A  +R+ + ++ I  +  +L   L+ + ++ E++   V+P    V +  V 
Sbjct: 4  ITAKDVRKVAQLARLDLPDDQIATYTEQLERILAYVAQLEEIDTTNVKPTTRAVEVVNVT 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R D V +    E +L+ AP  E +FF VPK
Sbjct: 64 RTDEVSETPVREELLNLAPQREGDFFRVPK 93


>gi|194337427|ref|YP_002019221.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Pelodictyon
          phaeoclathratiforme BU-1]
 gi|229487529|sp|B4SES8|GATC_PELPB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|194309904|gb|ACF44604.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Pelodictyon
          phaeoclathratiforme BU-1]
          Length = 95

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 49/94 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DV  IA  +++   ++++      LNN L  +EK++EV+ EGV P+ ++     
Sbjct: 1  MSVTTKDVTYIAELAKLKFSDDEMLTMTSELNNILHYVEKLNEVDTEGVLPLSTIHDAVN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R DV        ++L NAP  +  FF VPK +
Sbjct: 61 VLREDVEHQPLSSTAVLLNAPDRQDRFFKVPKVI 94


>gi|327438554|dbj|BAK14919.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit [Solibacillus
          silvestris StLB046]
          Length = 96

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 47/89 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +VK +AH +R++I EE+   F  +L       E+++E++   VEP   V+P+  V R DV
Sbjct: 8  EVKHVAHLARLAITEEEAEKFAEQLGKITDFAEQLNELDTTNVEPTSHVLPLVNVLREDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            +G  +E ++ N    E     VP  +E
Sbjct: 68 AKEGLPLEKVMLNVKEQEAGQIKVPSIME 96


>gi|149925924|ref|ZP_01914187.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Limnobacter sp.
          MED105]
 gi|149825212|gb|EDM84423.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Limnobacter sp.
          MED105]
          Length = 99

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVS----VV 56
          M +D   + +IA  SR+ +  E       +LNN + + +++S  N EGVEP+      + 
Sbjct: 1  MSLDSGQIAKIAALSRLKVAPEQAQALEQQLNNIMQLADRLSSENTEGVEPLAHPISLIQ 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          P+ +  R D V + D   + ++NAP  EK  F+VPK +E
Sbjct: 61 PIALRLREDAVTEADNRAANMANAPAAEKGLFLVPKVIE 99


>gi|257460075|ref|ZP_05625179.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Campylobacter
          gracilis RM3268]
 gi|257442516|gb|EEV17655.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Campylobacter
          gracilis RM3268]
          Length = 95

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M+ID   + ++   S + I +E    F  +LNN +  +E ++E++++  E  ++ +    
Sbjct: 1  MIIDDALLSKLERLSALKIPDEKREEFKGQLNNIVDFVEILNELDLQSGEAAITTLKGGT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D+    D  ES+L +AP  E  +FVVPK ++
Sbjct: 61 PFRKDIPRKSDVAESVLKHAPQSEGGYFVVPKIID 95


>gi|257064865|ref|YP_003144537.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Slackia heliotrinireducens DSM 20476]
 gi|256792518|gb|ACV23188.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Slackia heliotrinireducens DSM 20476]
          Length = 103

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 1/87 (1%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVS-VVPMKMVHRPD 65
          DV+ +A ++RI +  +++    + LNN L+ L++I E +++ VEP    +  +  V R D
Sbjct: 9  DVRGMAAYARIGLDADELAQMTVDLNNILATLDRIKEYDLDAVEPTFHPIAGLSNVMRDD 68

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVPK 92
          V       E  L NAP  +   F+VP 
Sbjct: 69 VETSSFTQEESLVNAPKQQDGSFLVPS 95


>gi|284992466|ref|YP_003411020.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Geodermatophilus
           obscurus DSM 43160]
 gi|284065711|gb|ADB76649.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Geodermatophilus
           obscurus DSM 43160]
          Length = 121

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           DV  +A  +R+++ EE++  F  +L+  L  +  + + +   V PM   VP+  V R DV
Sbjct: 30  DVAHLARLARLALTEEELDHFAGQLSAVLDAVAAVGKADTGDVPPMTHAVPLTNVTREDV 89

Query: 67  VCDGDKVESILSNAPHVEKNFFVVPK 92
           V      + +L+ AP  E + F VP+
Sbjct: 90  VTPSLPRDVVLAQAPAAEDDRFRVPQ 115


>gi|255022183|ref|ZP_05294185.1| Aspartyl-tRNA(Asn)/Glutamyl-tRNA(Gln) amidotransferase subunit C
          [Acidithiobacillus caldus ATCC 51756]
 gi|254968365|gb|EET25925.1| Aspartyl-tRNA(Asn)/Glutamyl-tRNA(Gln) amidotransferase subunit C
          [Acidithiobacillus caldus ATCC 51756]
          Length = 97

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 2/97 (2%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M   +  VKR A  +R+++ E ++     +L   L ++EK+S V+ EGVE M   + M+ 
Sbjct: 1  MAFTIDTVKRTASLARLALPETELEQVAEQLEGILVLIEKLSAVSTEGVEIMAHPLEMQQ 60

Query: 61 VHRPDVVCDGDKV--ESILSNAPHVEKNFFVVPKAVE 95
            R D   + D    ++ L NAP      F+VPK +E
Sbjct: 61 PLREDRAHERDLAGRDANLKNAPQSADGLFLVPKVIE 97


>gi|149378475|ref|ZP_01896161.1| Sec-independent periplasmic protein translocase [Marinobacter
          algicola DG893]
 gi|149357239|gb|EDM45775.1| Sec-independent periplasmic protein translocase [Marinobacter
          algicola DG893]
          Length = 99

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 50/91 (54%), Gaps = 4/91 (4%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH--RP 64
          D++++A  +RI + EE +      L N L +++++S  + + V PM    P+  V   RP
Sbjct: 11 DIEKVAVLARIRVDEEQVSALEKDLGNILDLVDQLSAADTDSVAPMAH--PLDAVQRLRP 68

Query: 65 DVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          D V + ++ E+  + AP  E   ++VP+ +E
Sbjct: 69 DEVSETNEREAFQAIAPATENGLYLVPRVIE 99


>gi|297156984|gb|ADI06696.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptomyces
          bingchenggensis BCW-1]
          Length = 98

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +K+E++  F  +L++ +  + ++SEV  + V P    +P+  V RPDV
Sbjct: 8  EVAHLARLARLELKDEELDHFAGQLDDIIGAVARVSEVADQDVPPTSHPLPLTNVMRPDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
                 +  LS AP  E+  F VP+
Sbjct: 68 ARPSLTPQEALSGAPAQEQQRFKVPQ 93


>gi|227543582|ref|ZP_03973631.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
          reuteri CF48-3A]
 gi|300909389|ref|ZP_07126850.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Lactobacillus
          reuteri SD2112]
 gi|77745323|gb|ABB02562.1| amidotransferase c subunit [Lactobacillus reuteri]
 gi|227186422|gb|EEI66493.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
          reuteri CF48-3A]
 gi|300893254|gb|EFK86613.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Lactobacillus
          reuteri SD2112]
          Length = 105

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 46/86 (53%), Gaps = 2/86 (2%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD-- 65
          V+ +A  +++   ++++  F  +L N + + E +  V+ +GVEPM S      V R D  
Sbjct: 10 VEHVAELAKLEFPKDELGKFTTQLGNIIDMFEDLEAVDTDGVEPMTSATDRVNVMREDKA 69

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVP 91
          +    D+ E++L+NAP  +  +  VP
Sbjct: 70 IKSSKDEQEALLNNAPETDGGYIKVP 95


>gi|89896633|ref|YP_520120.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Desulfitobacterium hafniense Y51]
 gi|219667571|ref|YP_002458006.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Desulfitobacterium hafniense DCB-2]
 gi|122481316|sp|Q24QL6|GATC_DESHY RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|254790995|sp|B8FP45|GATC_DESHD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|89336081|dbj|BAE85676.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219537831|gb|ACL19570.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Desulfitobacterium hafniense DCB-2]
          Length = 94

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 49/94 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  +R+ + EE++     +LN+ L     + ++N + ++P    VP+  
Sbjct: 1  MKISREEVEHVAFLARLELTEEELVTNTEQLNSILDYAAMLEKLNTDDIKPTAHAVPLHN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R D V      E +L+NAP  +  FF VP+ V
Sbjct: 61 VLREDQVKPSMAREKVLANAPDAQDGFFKVPRIV 94


>gi|255324554|ref|ZP_05365671.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Corynebacterium
          tuberculostearicum SK141]
 gi|255298460|gb|EET77760.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Corynebacterium
          tuberculostearicum SK141]
          Length = 98

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ EE++  F  +++  +  +  +  V+ EGVEPM     +    R DV
Sbjct: 8  EVAHLAKLSRLALSEEELAQFATQIDEIVDSVSAVGNVDTEGVEPMSHPHSVDAPMREDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          +      E  L  AP VE   FVVP+
Sbjct: 68 IVRTLTAEQALDQAPAVEDERFVVPQ 93


>gi|78067929|ref|YP_370698.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          sp. 383]
 gi|123567376|sp|Q39BW2|GATC_BURS3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|77968674|gb|ABB10054.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Burkholderia sp. 383]
          Length = 99

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 51/101 (50%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DVKRIAH +R+ + + D    L +LN    ++E++  V+  G+ P+    P++ 
Sbjct: 1  MALTLTDVKRIAHLARLEMADADAEHMLGQLNELFGLVEQMQAVDTAGIAPLAH--PIEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +       R D V +    +     AP V+   ++VPK +E
Sbjct: 59 IQEVAQRLREDAVTEVVNRDDNQRPAPAVQDGLYLVPKVIE 99


>gi|317495348|ref|ZP_07953718.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
          [Gemella moribillum M424]
 gi|316914770|gb|EFV36246.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
          [Gemella moribillum M424]
          Length = 96

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V  IAH SR+ IKEE++  ++ +L   + +  +++    E V+P   V+ +  V R DV 
Sbjct: 9  VNHIAHLSRLEIKEEEVAGYIEKLEKVVDLFNEVNSAPTENVKPTYHVLDLVNVFREDVA 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVP 91
            G   E +L NA   E   F VP
Sbjct: 69 EPGMDREEVLKNAHETEAGQFKVP 92


>gi|262199916|ref|YP_003271125.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Haliangium
          ochraceum DSM 14365]
 gi|262083263|gb|ACY19232.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Haliangium
          ochraceum DSM 14365]
          Length = 102

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 45/85 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  IA  +R+++ +E+       L   L+ ++ + EV+ EGV PM  VVPM +  R D 
Sbjct: 9  EVDEIALLARLALSDEESERLRGELGAILAHMDALQEVDTEGVAPMTHVVPMHLRLRDDQ 68

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
          V     VE  +  AP  + ++F VP
Sbjct: 69 VEASLPVEEAVGAAPDSKDDYFQVP 93


>gi|73749018|ref|YP_308257.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Dehalococcoides
          sp. CBDB1]
 gi|123619953|sp|Q3ZYM6|GATC_DEHSC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|73660734|emb|CAI83341.1| glutamyl-tRNA(gln) amidotransferase, C subunit [Dehalococcoides
          sp. CBDB1]
          Length = 95

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 46/87 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV  IA  +R+ ++E++I      L+  L   E + +V+  GVEP     P+K 
Sbjct: 1  MKLNREDVLHIARLARLGLEEDEINRLSKELSALLEHFEVLQQVDTTGVEPTSQSTPVKS 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNF 87
          V + D++      E ILSNAP  E ++
Sbjct: 61 VLKEDIIKSSYAREDILSNAPRREGDY 87


>gi|289168498|ref|YP_003446767.1| glutamyl tRNA-Gln amidotransferase C subunit [Streptococcus mitis
          B6]
 gi|288908065|emb|CBJ22905.1| glutamyl tRNA-Gln amidotransferase C subunit [Streptococcus mitis
          B6]
          Length = 100

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 44/91 (48%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   EE+   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV  +G     +  N P  +  +  VP
Sbjct: 61 VLRPDVAEEGTDRNRLFKNVPEKDNYYIKVP 91


>gi|303228994|ref|ZP_07315804.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Veillonella
          atypica ACS-134-V-Col7a]
 gi|302516408|gb|EFL58340.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Veillonella
          atypica ACS-134-V-Col7a]
          Length = 96

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   ++K+IA  SR+ +KE+ +      L++ L+ + +++E+ ++ VE M   VP+  
Sbjct: 1  MKISQEEIKKIALLSRLEVKEDKMASVEKELSDILTYVAELNELELDDVEVMAHAVPLHN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D        +  LSNAP  E  +F VP+ V+
Sbjct: 61 VFREDETKPSLDHDLALSNAPEEEDGYFKVPRVVQ 95


>gi|307710568|ref|ZP_07647003.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus mitis
          SK564]
 gi|307618676|gb|EFN97817.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus mitis
          SK564]
          Length = 100

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 43/85 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A+ S++   EE+   F   L+  + ++E + EV+  GV P  ++   K V RPDV
Sbjct: 7  EVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKTVLRPDV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
            +G   + +  N P  +  +  VP
Sbjct: 67 AEEGTDRDRLFKNVPKKDNYYIKVP 91


>gi|311740577|ref|ZP_07714404.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Corynebacterium
           pseudogenitalium ATCC 33035]
 gi|311304097|gb|EFQ80173.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Corynebacterium
           pseudogenitalium ATCC 33035]
          Length = 109

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           +V  +A  SR+++ EE++  F  +++  +  +  +  V+ EGVEPM     +    R DV
Sbjct: 19  EVAHLAKLSRLALSEEELAQFATQIDEIVDSVSAVGNVDTEGVEPMSHPHSVDAPMREDV 78

Query: 67  VCDGDKVESILSNAPHVEKNFFVVPK 92
           +      E  L  AP VE   FVVP+
Sbjct: 79  IVRTLTAEQALDQAPAVEDERFVVPQ 104


>gi|50084038|ref|YP_045548.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acinetobacter sp. ADP1]
 gi|49530014|emb|CAG67726.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acinetobacter sp. ADP1]
          Length = 103

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 47/93 (50%)

Query: 3   IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
           ++   V +IA+ +R+S+ +     +   LN  L ++E +  ++ +GVEP+ S        
Sbjct: 11  LNAQTVSQIANLARLSLNDTQSAEYAQSLNKILDMMESLKSIDTDGVEPLKSPFDTAQPL 70

Query: 63  RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           R D V + +  E   + AP  E   ++VP+ +E
Sbjct: 71  RQDAVTETNHREEYQAVAPATEAGLYLVPRVIE 103


>gi|312891408|ref|ZP_07750925.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Mucilaginibacter paludis DSM 18603]
 gi|311296102|gb|EFQ73254.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Mucilaginibacter paludis DSM 18603]
          Length = 95

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 47/94 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   V +IAH +R+ I E +       +   L  + K++EV+  GVEP+V +  +  
Sbjct: 1  MKIDNDTVDKIAHLARLEINETERQEMATDMGKILDFMAKLNEVDTSGVEPLVYMTEIVN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
            R DVV      E  L NAP  + ++F V K +
Sbjct: 61 SVREDVVKQEISHEEALENAPSHDADYFRVAKVI 94


>gi|167834995|ref|ZP_02461878.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
          thailandensis MSMB43]
          Length = 99

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 50/99 (50%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMV----SVV 56
          M + + DVKRIAH +R+ + + D    L +LN    ++E++  V+  G+ P+      ++
Sbjct: 1  MALTLTDVKRIAHLARLEMADADAERTLAQLNEFFCLVEQMQAVDTTGIAPLAHPIEQIL 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +    R D V +    +     AP V+   ++VPK +E
Sbjct: 61 EVAQRLRDDAVTEHVNRDDNQRPAPAVQDGLYLVPKVIE 99


>gi|208780279|ref|ZP_03247621.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Francisella
          novicida FTG]
 gi|208743928|gb|EDZ90230.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Francisella
          novicida FTG]
          Length = 93

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 45/88 (51%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK IA  S   + EE +  +   L+N   +L+ +   + +GVEPM+S + +    R D+ 
Sbjct: 6  VKHIAKLSCFDLTEEQLEQYTKDLSNICKILDTVKNFDAQGVEPMISPISVDFKFREDIP 65

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           D D   S    A  V  ++F+VP+ V+
Sbjct: 66 QDQDNRTSFDKFACEVVDDYFMVPQVVK 93


>gi|260435025|ref|ZP_05788995.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Synechococcus sp.
          WH 8109]
 gi|260412899|gb|EEX06195.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Synechococcus sp.
          WH 8109]
          Length = 97

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+++A  +R+ + E+ I  +  +L + L  + ++ +V+ E V      V +  V R D 
Sbjct: 8  DVRKVAQLARLDLPEDKIATYTDQLESILEYVSQLQQVDTEDVPETTRAVEVTNVTRADG 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E IL+ AP  E +FF VPK
Sbjct: 68 VQPTPVREDILNQAPQREGDFFRVPK 93


>gi|258645493|ref|ZP_05732962.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Dialister invisus
          DSM 15470]
 gi|260402846|gb|EEW96393.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Dialister invisus
          DSM 15470]
          Length = 94

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 45/92 (48%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I + + ++IA  SR+    ED+      +N+ L+ +E++++ +  GVEP    V    
Sbjct: 1  MKIRIEEARKIALLSRLEFSAEDLEKMRESMNSILTHMEELNQHDTYGVEPTAHAVEQYN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          V R D        E  L NAP  E  +F VPK
Sbjct: 61 VMREDEPHQSLSNEEALFNAPEKEGGYFKVPK 92


>gi|312134643|ref|YP_004001981.1| glutamyl-tRNA(Gln) amidotransferase subunit C
          [Caldicellulosiruptor owensensis OL]
 gi|311774694|gb|ADQ04181.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Caldicellulosiruptor owensensis OL]
          Length = 94

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 47/89 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ +A+ +R+++ EE+I      L   +    K+S+++ EG+EP   V+ +  V R D 
Sbjct: 6  DVEYVANLARLTLTEEEIERMTKELGAIIEFANKLSDLDTEGIEPTAHVLNLYNVFRSDE 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V      E IL NAP  +     VPK VE
Sbjct: 66 VKPSYPREKILQNAPSHDDVCIKVPKIVE 94


>gi|256852260|ref|ZP_05557646.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          jensenii 27-2-CHN]
 gi|260661708|ref|ZP_05862619.1| glutamyl-tRNA(Gln) amidotransferase, C subunit protein
          [Lactobacillus jensenii 115-3-CHN]
 gi|282934846|ref|ZP_06340079.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          jensenii 208-1]
 gi|297205573|ref|ZP_06922969.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Lactobacillus
          jensenii JV-V16]
 gi|256615306|gb|EEU20497.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          jensenii 27-2-CHN]
 gi|260547455|gb|EEX23434.1| glutamyl-tRNA(Gln) amidotransferase, C subunit protein
          [Lactobacillus jensenii 115-3-CHN]
 gi|281301077|gb|EFA93388.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          jensenii 208-1]
 gi|297150151|gb|EFH30448.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Lactobacillus
          jensenii JV-V16]
          Length = 100

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 43/91 (47%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   ++K +A  SR+  K+E++  F  ++   + + E++ EVN EGV     VV    
Sbjct: 1  MEITKEEIKHVAALSRLEFKDEELDQFTSQMGKIIEMAEQLGEVNTEGVPETTQVVDRDT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V+R D        + +L N P     F  VP
Sbjct: 61 VYREDKPEHWQDRKEMLKNVPETSDGFIKVP 91


>gi|148381212|ref|YP_001255753.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum A str. ATCC 3502]
 gi|153931742|ref|YP_001385587.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Clostridium
          botulinum A str. ATCC 19397]
 gi|153936185|ref|YP_001388993.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Clostridium
          botulinum A str. Hall]
 gi|166198858|sp|A7FYL4|GATC_CLOB1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|166198859|sp|A5I6Z4|GATC_CLOBH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|148290696|emb|CAL84826.1| glutamyl-tRNA amidotransferase subunit C [Clostridium botulinum A
          str. ATCC 3502]
 gi|152927786|gb|ABS33286.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum A str. ATCC 19397]
 gi|152932099|gb|ABS37598.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum A str. Hall]
          Length = 95

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 53/89 (59%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ +A  +R+  KEE+   F+  LN  L+ +EK+ E+N + V+ +V+   ++  +R D 
Sbjct: 7  DVEYVAELARLEFKEEEKDSFVNDLNKILNYMEKLDELNTDDVDIVVNPYYIENKYREDN 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V    +++ ++ NAP   + + +VPK ++
Sbjct: 67 VEKSMELKEVIDNAPESLEEYVIVPKVID 95


>gi|332204463|gb|EGJ18528.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          pneumoniae GA47901]
          Length = 100

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   E++   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLRFSEKETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV  +G   + +  N P  +  +  VP
Sbjct: 61 VLRPDVAEEGTNRDRLFKNVPEQDNYYIKVP 91


>gi|107024040|ref|YP_622367.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          cenocepacia AU 1054]
 gi|115353215|ref|YP_775054.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          ambifaria AMMD]
 gi|116691127|ref|YP_836750.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          cenocepacia HI2424]
 gi|170703870|ref|ZP_02894559.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
          ambifaria IOP40-10]
 gi|170734458|ref|YP_001766405.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          cenocepacia MC0-3]
 gi|171321048|ref|ZP_02910032.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
          ambifaria MEX-5]
 gi|172062087|ref|YP_001809739.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          ambifaria MC40-6]
 gi|254246880|ref|ZP_04940201.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Burkholderia
          cenocepacia PC184]
 gi|122321945|sp|Q0BAV3|GATC_BURCM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|123371174|sp|Q1BSL1|GATC_BURCA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|166198845|sp|A0KBI0|GATC_BURCH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|229487454|sp|B1YPV9|GATC_BURA4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|229487455|sp|B1K0H8|GATC_BURCC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|105894229|gb|ABF77394.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Burkholderia cenocepacia AU 1054]
 gi|115283203|gb|ABI88720.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Burkholderia ambifaria AMMD]
 gi|116649216|gb|ABK09857.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Burkholderia cenocepacia HI2424]
 gi|124871656|gb|EAY63372.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Burkholderia
          cenocepacia PC184]
 gi|169817700|gb|ACA92283.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
          cenocepacia MC0-3]
 gi|170131223|gb|EDS99861.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
          ambifaria IOP40-10]
 gi|171093683|gb|EDT38831.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
          ambifaria MEX-5]
 gi|171994604|gb|ACB65523.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
          ambifaria MC40-6]
          Length = 99

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 51/101 (50%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DVKRIAH +R+ + + D    L +LN    ++E++  V+  G+ P+    P++ 
Sbjct: 1  MALTLTDVKRIAHLARLEMADADAEHMLGQLNEFFGLVEQMQAVDTAGIAPLAH--PIEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +       R D V +    +     AP V+   ++VPK +E
Sbjct: 59 IQEVAQRLRDDAVTEVVNRDDNQRPAPAVQDGLYLVPKVIE 99


>gi|256827599|ref|YP_003151558.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Cryptobacterium curtum DSM 15641]
 gi|256583742|gb|ACU94876.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Cryptobacterium curtum DSM 15641]
          Length = 103

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVS-VVPMKMVHRPD 65
          DV+ IA ++RI + + ++P     LN  +  L  I+E ++EGVEP    +  +  V R D
Sbjct: 9  DVRAIAEYARIGLADGELPQMTADLNAIIDSLAPITEYDLEGVEPTFHPIGDLSNVMRDD 68

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVPK 92
          +       E  L NAP  ++  F++P 
Sbjct: 69 IEQPSFTQEQALENAPAQQEGSFLIPS 95


>gi|330466193|ref|YP_004403936.1| glutamyl-tRNA(gln) amidotransferase subunit C [Verrucosispora
          maris AB-18-032]
 gi|328809164|gb|AEB43336.1| glutamyl-tRNA(gln) amidotransferase, c subunit [Verrucosispora
          maris AB-18-032]
          Length = 101

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ EE++  F  +L+  L  + ++ EV    + P    VP+  V R DV
Sbjct: 8  EVAHLARLSRLAVTEEELDTFAGQLDVILQAVAQVGEVAAADIPPTSHSVPLTNVFREDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      +  LS AP  E+  F VP+
Sbjct: 68 VTPCLTPQEALSGAPDAEEQRFRVPR 93


>gi|297616695|ref|YP_003701854.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Syntrophothermus
          lipocalidus DSM 12680]
 gi|297144532|gb|ADI01289.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Syntrophothermus
          lipocalidus DSM 12680]
          Length = 95

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          ML+   +V+ +A  +R+ + +E++  F  +L   L  + ++++++   +EP+  V+P+  
Sbjct: 1  MLLTREEVEHVAALARLKLSDEELERFAEQLTAILDYMSRLNDLDTSKIEPLTHVLPLSN 60

Query: 61 VHRPDVVC-DGDKVESILSNAPHVEKNFFVVPKAV 94
          V R D V  +    + IL+NAP  E   F VP+ V
Sbjct: 61 VFRDDGVSPEETNRDDILANAPLEENGCFKVPRIV 95


>gi|218662698|ref|ZP_03518628.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rhizobium etli
          IE4771]
          Length = 65

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 36/54 (66%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVS 54
          M +D+  VKR+A  +RI++ E++    +  LN  L  +E++SEVNV+GVE M S
Sbjct: 7  MSVDLAIVKRVAKLARIAVSEDEANRMVGELNGILGFVEQLSEVNVDGVEAMTS 60


>gi|313682297|ref|YP_004060035.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit c
          [Sulfuricurvum kujiense DSM 16994]
 gi|313155157|gb|ADR33835.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Sulfuricurvum kujiense DSM 16994]
          Length = 96

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 55/96 (57%), Gaps = 1/96 (1%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   ++R+   S + I +E     + +L+  +S ++ +SE++ EGV+   ++  +  
Sbjct: 1  MKIDETLLQRLEKLSYLQIPQEHREEMIAQLSEIVSFVDNLSELSTEGVDATFAMSEVST 60

Query: 61 VHRPDV-VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DV   D    + IL++APH +++FF+VPK +E
Sbjct: 61 RLREDVGTVDRAVNDDILAHAPHSQEHFFIVPKIIE 96


>gi|118498252|ref|YP_899302.1| Glu-tRNAGln amidotransferase C subunit [Francisella tularensis
          subsp. novicida U112]
 gi|194324436|ref|ZP_03058209.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Francisella
          tularensis subsp. novicida FTE]
 gi|118424158|gb|ABK90548.1| Glu-tRNAGln amidotransferase C subunit [Francisella novicida
          U112]
 gi|194321501|gb|EDX18986.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Francisella
          tularensis subsp. novicida FTE]
          Length = 93

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK IA  S   + EE +  +   L+N   +L+ +   + +GVEPM+S + +    R D+ 
Sbjct: 6  VKHIAKLSCFDLTEEQLEQYTKDLSNICKILDTVKNFDAQGVEPMISPISVDFKFREDIP 65

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           D D   S    A  +  ++F+VP+ V+
Sbjct: 66 QDQDNRTSFDKFACEIVDDYFMVPQVVK 93


>gi|257462341|ref|ZP_05626756.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium sp.
          D12]
 gi|317060007|ref|ZP_07924492.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium sp.
          D12]
 gi|313685683|gb|EFS22518.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium sp.
          D12]
          Length = 97

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 47/88 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V ++A  +++   EE I  F   LN+ L  ++ ++EV+   VEP++ V   +   R D 
Sbjct: 7  EVLKVAKLAKLEFSEEKIEKFQEELNDILGYVDMLNEVDTTEVEPLIYVHEAQNHFREDE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
               KVE +L NAP+ E    +VP+ V
Sbjct: 67 ARASLKVEEVLRNAPNAEDGAIIVPRVV 94


>gi|194334668|ref|YP_002016528.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Prosthecochloris aestuarii DSM 271]
 gi|229487531|sp|B4S4I5|GATC_PROA2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|194312486|gb|ACF46881.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Prosthecochloris
          aestuarii DSM 271]
          Length = 95

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 45/88 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV  IA  +++   E +       LN  L  ++K++EV+ +GVEP+ S+     V R D 
Sbjct: 7  DVAYIAELAKLRFTEAEQEKMTTELNAILHYVDKLNEVDTDGVEPLSSIHDQVNVLREDC 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
          +      E  L NAP  ++ FF VPK +
Sbjct: 67 LKPSLDNEEALKNAPDRQERFFRVPKVI 94


>gi|206558885|ref|YP_002229645.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          cenocepacia J2315]
 gi|229487456|sp|B4E7X5|GATC_BURCJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|198034922|emb|CAR50794.1| glutamyl-tRNA amidotransferase subunit C [Burkholderia
          cenocepacia J2315]
          Length = 99

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 51/101 (50%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DVKRIAH +R+ + + D    L +LN    ++E++  V+  G+ P+    P++ 
Sbjct: 1  MALTLTDVKRIAHLARLEMADADAEHMLGQLNEFFGLVEQMQAVDTAGIAPLAH--PIEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +       R D V +    +     AP V+   ++VPK +E
Sbjct: 59 IQEVAQRLRDDAVTEVVDRDDNQRPAPAVQDGLYLVPKVIE 99


>gi|134093456|ref|YP_001098531.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Herminiimonas
           arsenicoxydans]
 gi|166199150|sp|A4G1L5|GATC_HERAR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit C; Short=Asp/Glu-ADT subunit C
 gi|133737359|emb|CAL60402.1| Putative Glutamyl-tRNA(Gln) amidotransferase subunit C (Glu-ADT
           subunit C) [Herminiimonas arsenicoxydans]
          Length = 100

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 56/100 (56%), Gaps = 5/100 (5%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM----VSVV 56
           M + + DVKR++  ++I + +      L +LN   +++E++S V+  GVEP+     +++
Sbjct: 1   MSLALSDVKRLSMLAQIDLTDAQSAQTLDKLNGIFALVEQLSAVDTTGVEPLNHPIAALL 60

Query: 57  P-MKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           P + +  R DVV + ++ +     AP  +   ++VPK +E
Sbjct: 61  PDLSLRLRDDVVSEPNRRDDYQQVAPATQDGLYLVPKVIE 100


>gi|167585096|ref|ZP_02377484.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
          ubonensis Bu]
          Length = 99

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 50/101 (49%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DVKRIAH +R+ +   D    L +LN    ++E++  V+  G+ P+    P++ 
Sbjct: 1  MALTLTDVKRIAHLARLEMAAADAEHTLGQLNEFFGLVEQMQAVDTAGIAPLAH--PIEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +       R D V +    +     AP V+   ++VPK +E
Sbjct: 59 IQEVAQRLRDDAVTETVNRDDNQRPAPAVQDGLYLVPKVIE 99


>gi|302554318|ref|ZP_07306660.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptomyces
          viridochromogenes DSM 40736]
 gi|302471936|gb|EFL35029.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptomyces
          viridochromogenes DSM 40736]
          Length = 98

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +K E++  F  +L++ +  + ++SEV  + V P    +P+  V RPD 
Sbjct: 8  EVAHLARLARLELKPEELDHFAGQLDDIIGAVARVSEVADQDVPPTSHPLPLTNVMRPDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  LS AP  E+  F VP+
Sbjct: 68 VRPSLTPEQALSGAPAQEQQRFKVPR 93


>gi|15900356|ref|NP_344960.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae TIGR4]
 gi|111657909|ref|ZP_01408620.1| hypothetical protein SpneT_02000918 [Streptococcus pneumoniae
          TIGR4]
 gi|148996840|ref|ZP_01824558.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP11-BS70]
 gi|168576844|ref|ZP_02722694.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae MLV-016]
 gi|225860461|ref|YP_002741970.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae Taiwan19F-14]
 gi|237650349|ref|ZP_04524601.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae CCRI 1974]
 gi|237822037|ref|ZP_04597882.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae CCRI 1974M2]
 gi|298229393|ref|ZP_06963074.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae str. Canada MDR_19F]
 gi|298254601|ref|ZP_06978187.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae str. Canada MDR_19A]
 gi|298502233|ref|YP_003724173.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae TCH8431/19A]
 gi|307067082|ref|YP_003876048.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase subunit C [Streptococcus
          pneumoniae AP200]
 gi|20138299|sp|Q97SE5|GATC_STRPN RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|254791020|sp|C1CPU8|GATC_STRZT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|14971908|gb|AAK74600.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae TIGR4]
 gi|147757415|gb|EDK64454.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP11-BS70]
 gi|183577492|gb|EDT98020.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae MLV-016]
 gi|225727009|gb|ACO22860.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae Taiwan19F-14]
 gi|298237828|gb|ADI68959.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae TCH8431/19A]
 gi|306408619|gb|ADM84046.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit [Streptococcus
          pneumoniae AP200]
 gi|327390846|gb|EGE89186.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          pneumoniae GA04375]
 gi|332202343|gb|EGJ16412.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          pneumoniae GA41317]
          Length = 100

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   EE+   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV  +G   + +  N P  +  +  VP
Sbjct: 61 VLRPDVAEEGIDRDRLFKNVPEKDNYYIKVP 91


>gi|153938892|ref|YP_001392613.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Clostridium
          botulinum F str. Langeland]
 gi|168179085|ref|ZP_02613749.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum NCTC 2916]
 gi|168183569|ref|ZP_02618233.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum Bf]
 gi|170756377|ref|YP_001782891.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Clostridium
          botulinum B1 str. Okra]
 gi|187776816|ref|ZP_02993289.1| hypothetical protein CLOSPO_00332 [Clostridium sporogenes ATCC
          15579]
 gi|226950693|ref|YP_002805784.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum A2 str. Kyoto]
 gi|237796708|ref|YP_002864260.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum Ba4 str. 657]
 gi|166198860|sp|A7GIK3|GATC_CLOBL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|229487466|sp|B1INF8|GATC_CLOBK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|254790992|sp|C1FLE0|GATC_CLOBJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|259647245|sp|C3KU98|GATC_CLOB6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|152934788|gb|ABS40286.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum F str. Langeland]
 gi|169121589|gb|ACA45425.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum B1 str. Okra]
 gi|182670275|gb|EDT82251.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum NCTC 2916]
 gi|182673306|gb|EDT85267.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum Bf]
 gi|187775475|gb|EDU39277.1| hypothetical protein CLOSPO_00332 [Clostridium sporogenes ATCC
          15579]
 gi|226842910|gb|ACO85576.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum A2 str. Kyoto]
 gi|229264104|gb|ACQ55137.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum Ba4 str. 657]
 gi|295320600|gb|ADG00978.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum F str. 230613]
 gi|322807578|emb|CBZ05153.1| aspartyl-tRNA(Asn) amidotransferase subunit C [Clostridium
          botulinum H04402 065]
          Length = 95

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 53/89 (59%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ +A  +R+  KEE+   F+  LN  L+ +EK+ E+N + V+ +V+   ++  +R D 
Sbjct: 7  DVEYVAELARLEFKEEEKDNFVNDLNKILNYMEKLDELNTDDVDIVVNPYYIENKYREDN 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V    +++ ++ NAP   + + +VPK ++
Sbjct: 67 VEKSMELKEVIDNAPESLEEYVIVPKVID 95


>gi|108803672|ref|YP_643609.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rubrobacter xylanophilus DSM 9941]
 gi|122381985|sp|Q1AXT1|GATC_RUBXD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|108764915|gb|ABG03797.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Rubrobacter xylanophilus DSM 9941]
          Length = 93

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 47/91 (51%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +I    V+ +A  +R+ + +E++     +L   L  +EKI E+++EGV P  + + +  V
Sbjct: 1  MISEEQVRHVAELARLGLTDEEVARMGGQLGAILDSIEKIRELDLEGVPPTANPLNLTNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           RPD   +  + E  L+ AP      F VP+
Sbjct: 61 FRPDEPRESLRREEALAVAPETADGMFAVPR 91


>gi|323702805|ref|ZP_08114464.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfotomaculum
          nigrificans DSM 574]
 gi|323532193|gb|EGB22073.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfotomaculum
          nigrificans DSM 574]
          Length = 93

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 49/93 (52%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +I   DV+ +A   R+ + EE+  L+  +LN  L     + E++   + P   V+P++ V
Sbjct: 1  MISKKDVEHVALLGRLELSEEEKELYTQQLNKILEAARALQELDTADIPPTAHVLPIQNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
           R D V      E  L+NAP  E+NFF VPK V
Sbjct: 61 FREDRVGQHMDPEKALANAPEREENFFKVPKIV 93


>gi|295112168|emb|CBL28918.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Synergistetes bacterium SGP1]
          Length = 96

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 54/89 (60%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ IA  +R+ + E+++   +  +N  L +L++ +E+++E VEP      M+   R DV
Sbjct: 7  EVRDIALEARLILTEDELAAAVGYINGFLDMLDRFNELDLEDVEPFCFAETMECPLRDDV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +   +  ++IL  + HVE+++F VP+ +E
Sbjct: 67 LKPFEDRDAILRESAHVERDYFKVPRIME 95


>gi|239982453|ref|ZP_04704977.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptomyces
          albus J1074]
 gi|291454300|ref|ZP_06593690.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptomyces
          albus J1074]
 gi|291357249|gb|EFE84151.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptomyces
          albus J1074]
          Length = 98

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 45/86 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +K E++  F  +L++ L  + ++SEV  + V P    +PM  V R D 
Sbjct: 8  EVAHLARLARLELKAEELEHFAGQLDDILGAVARVSEVAGQDVPPTSHPLPMTNVMRADE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  LS AP  E+  F VP+
Sbjct: 68 VRPSLTPEQALSGAPAQEQQRFKVPQ 93


>gi|148988189|ref|ZP_01819652.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP6-BS73]
 gi|147926653|gb|EDK77726.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP6-BS73]
          Length = 100

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   EE+   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV  +G   + +  N P  +  +  VP
Sbjct: 61 VLRPDVAEEGIDRDRLFKNVPEKDNYYIKVP 91


>gi|168482677|ref|ZP_02707629.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae CDC1873-00]
 gi|172043596|gb|EDT51642.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae CDC1873-00]
 gi|332203608|gb|EGJ17675.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          pneumoniae GA47368]
          Length = 100

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   E++   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLRFSEKETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV  +G   + +  N P  +  +  VP
Sbjct: 61 VLRPDVAEEGTNRDRLFKNVPEKDNYYIKVP 91


>gi|148983832|ref|ZP_01817151.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP3-BS71]
 gi|168490649|ref|ZP_02714792.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae CDC0288-04]
 gi|225856166|ref|YP_002737677.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae P1031]
 gi|254791019|sp|C1CIT9|GATC_STRZP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|147923979|gb|EDK75091.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP3-BS71]
 gi|183575054|gb|EDT95582.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae CDC0288-04]
 gi|225726114|gb|ACO21966.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae P1031]
 gi|301799534|emb|CBW32082.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae OXC141]
          Length = 100

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   E++   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLRFSEKETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV  +G   + +  N P  +  +  VP
Sbjct: 61 VLRPDVAEEGTDRDRLFKNVPEQDNYYIKVP 91


>gi|308070712|ref|YP_003872317.1| glutamyl-tRNA(Gln) amidotransferase subunit C (Glu-ADT subunit C)
          [Paenibacillus polymyxa E681]
 gi|305859991|gb|ADM71779.1| Glutamyl-tRNA(Gln) amidotransferase subunit C (Glu-ADT subunit C)
          [Paenibacillus polymyxa E681]
          Length = 95

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   DV+ +A  SR+++   +      +LN  L   EK++E++ E V+P   V+ +  
Sbjct: 1  MNISTEDVRHVAKLSRLNLTAAEEETMTGQLNAILHYAEKLNELDTEQVKPTTHVLHVSN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V +    E ++ NAP  E   F VP  +E
Sbjct: 61 VMRDDEVRESLTHEQVMRNAPEEEDGQFKVPAVLE 95


>gi|21223854|ref|NP_629633.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptomyces
          coelicolor A3(2)]
 gi|256785050|ref|ZP_05523481.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptomyces
          lividans TK24]
 gi|289768943|ref|ZP_06528321.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptomyces
          lividans TK24]
 gi|6225429|sp|Q9Z581|GATC_STRCO RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|4467249|emb|CAB37574.1| probable Glu-tRNAGln amidotransferase subunit C [Streptomyces
          coelicolor A3(2)]
 gi|289699142|gb|EFD66571.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptomyces
          lividans TK24]
          Length = 98

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +K E++  F  +L++ +  + ++SEV  + V P    +P+  V RPD 
Sbjct: 8  EVAHLARLARLELKPEELEHFAGQLDDIIGAVARVSEVADQDVPPTSHPLPLTNVMRPDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  LS AP  E+  F VP+
Sbjct: 68 VRPSLTPEQALSGAPAQEQQRFKVPQ 93


>gi|146295942|ref|YP_001179713.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|172046020|sp|A4XHY7|GATC_CALS8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|145409518|gb|ABP66522.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 94

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 47/89 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ +A+ +R+++ EE+I      L   +    K+S+++ EG+EP   V+ +  V R D 
Sbjct: 6  DVEYVANLARLTLTEEEIEKMTKELGAIIEFANKLSDLDTEGIEPTAHVLNLYNVFRSDE 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V      E IL NAP  +     VPK VE
Sbjct: 66 VKPSYPREEILKNAPSHDDVCIKVPKIVE 94


>gi|168186075|ref|ZP_02620710.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum C str. Eklund]
 gi|169296015|gb|EDS78148.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum C str. Eklund]
          Length = 94

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 52/89 (58%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ IA  S++S  EE+    +  LN  L+V+EK++E+  + +E  V+   ++  +R D 
Sbjct: 6  DVEYIARLSKLSFNEEEEEKIIKDLNKVLTVMEKLNELKTDDIEITVNPYYIENEYREDE 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +     ++ +L NAP   K++ VVPK +E
Sbjct: 66 IQKSLPLDKVLKNAPEFNKDYIVVPKVIE 94


>gi|303239319|ref|ZP_07325847.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acetivibrio
          cellulolyticus CD2]
 gi|302593105|gb|EFL62825.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acetivibrio
          cellulolyticus CD2]
          Length = 95

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 48/88 (54%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          ++ +A+ +R+++ E++     L +   +S ++K++E++   V+P   V+P+  V R D  
Sbjct: 8  IEHVANLARLNLTEDEKSKLTLDMEQIISYVDKLNELDTSKVKPTDHVIPISNVFREDEA 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
                E IL NAP  E   F VPK VE
Sbjct: 68 KPSYPREKILENAPSSEDGCFKVPKIVE 95


>gi|315037780|ref|YP_004031348.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Lactobacillus amylovorus GRL 1112]
 gi|325956255|ref|YP_004286865.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Lactobacillus acidophilus 30SC]
 gi|312275913|gb|ADQ58553.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Lactobacillus amylovorus GRL 1112]
 gi|325332820|gb|ADZ06728.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Lactobacillus acidophilus 30SC]
 gi|327183071|gb|AEA31518.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Lactobacillus amylovorus GRL 1118]
          Length = 102

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV- 66
          +K +A  SR++  EE++  F  ++ + +++ +++SEV+ EGV+  V VV    V R D  
Sbjct: 8  IKHVATLSRLAFNEEELDKFTDQMGSIINMADQLSEVDTEGVDETVQVVDRDTVFREDKP 67

Query: 67 -VCDGDKVESILSNAPHVEKNFFVVP 91
              G   E++++N P     +  VP
Sbjct: 68 EHWQGQTRETLMANVPEKANGYIKVP 93


>gi|254373593|ref|ZP_04989079.1| hypothetical protein FTCG_01690 [Francisella tularensis subsp.
          novicida GA99-3549]
 gi|151571317|gb|EDN36971.1| hypothetical protein FTCG_01690 [Francisella novicida GA99-3549]
 gi|332678988|gb|AEE88117.1| Aspartyl-tRNA(Asn) amidotransferase subunit C /
          Glutamyl-tRNA(Gln) amidotransferase subunit C
          [Francisella cf. novicida Fx1]
          Length = 93

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 46/88 (52%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK IA  S   + EE +  +   L+N   +L+ + + + +GV+PM+S + +    R D+ 
Sbjct: 6  VKHIAKLSCFDLTEEQLEQYTKDLSNICKILDTVKDFDAQGVKPMISPISVDFKFREDIP 65

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           D D   S    A  V  ++F+VP+ V+
Sbjct: 66 QDQDNRTSFDKFACEVVDDYFMVPQVVK 93


>gi|149175393|ref|ZP_01854014.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Planctomyces
          maris DSM 8797]
 gi|148845661|gb|EDL60003.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Planctomyces
          maris DSM 8797]
          Length = 96

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 44/85 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V ++A  SR+ + E ++     ++ + L  +  + E++   +EPM   + +  V R D 
Sbjct: 9  EVLKVASLSRLKLSETEVTALGEQMGSVLKYIAMLDELDTADIEPMAHAIEISNVFRDDQ 68

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
          +      E  LSNAP  + N+F+VP
Sbjct: 69 LQKSLPREQALSNAPQTDGNYFLVP 93


>gi|313889689|ref|ZP_07823332.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Streptococcus pseudoporcinus SPIN 20026]
 gi|313121986|gb|EFR45082.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Streptococcus pseudoporcinus SPIN 20026]
          Length = 100

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 47/95 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  S+++  +++   F   L   + ++E ++EV+ EGV    ++   K 
Sbjct: 1  MKISEEEVRHVATLSKLTFSDQETSAFATSLTKIVDMIELLNEVDTEGVAITTTMADRKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D+   G   + +  N P  E NF  VP  +E
Sbjct: 61 VMRQDIAQTGTDRQLLFKNVPEKENNFIKVPAILE 95


>gi|302879993|ref|YP_003848557.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Gallionella
          capsiferriformans ES-2]
 gi|302582782|gb|ADL56793.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Gallionella
          capsiferriformans ES-2]
          Length = 95

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DV+++A  +R+++ + +I     +L+    ++ ++  V+  G++PM     +  
Sbjct: 1  MSLSTADVQKVARLARLAMNDTEIEAARTQLSGIFELIAEMQAVDTTGIQPMSHAQDLSQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + ++ E     AP VE   ++VP+ +E
Sbjct: 61 RLREDRVTEDNQRELFQRIAPQVEDGLYLVPQVIE 95


>gi|116072092|ref|ZP_01469360.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Synechococcus sp.
          BL107]
 gi|116065715|gb|EAU71473.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Synechococcus sp.
          BL107]
          Length = 97

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 47/90 (52%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I   DV+++A  +R+++ ++ I  +  +L + L  + ++ +V+  GV      V +  V 
Sbjct: 4  ISADDVRKVAKLARLNLPDDKIATYTGQLESILGYVSQLEQVDTTGVPETTRAVEVTNVT 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R D V      E IL+ AP  E +FF VPK
Sbjct: 64 RQDGVDPTPVREEILNQAPQREGDFFRVPK 93


>gi|227877015|ref|ZP_03995107.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
          crispatus JV-V01]
 gi|256844674|ref|ZP_05550159.1| Glu-tRNA(Gln) amidotransferase subunit C [Lactobacillus crispatus
          125-2-CHN]
 gi|256850558|ref|ZP_05555984.1| Glu-tRNA(Gln) amidotransferase subunit C [Lactobacillus crispatus
          MV-1A-US]
 gi|262047042|ref|ZP_06020001.1| Glu-tRNA(Gln) amidotransferase subunit C [Lactobacillus crispatus
          MV-3A-US]
 gi|293381899|ref|ZP_06627867.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          crispatus 214-1]
 gi|295692392|ref|YP_003601002.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit c
          [Lactobacillus crispatus ST1]
 gi|312984359|ref|ZP_07791700.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          crispatus CTV-05]
 gi|227863386|gb|EEJ70813.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
          crispatus JV-V01]
 gi|256613215|gb|EEU18419.1| Glu-tRNA(Gln) amidotransferase subunit C [Lactobacillus crispatus
          125-2-CHN]
 gi|256712581|gb|EEU27576.1| Glu-tRNA(Gln) amidotransferase subunit C [Lactobacillus crispatus
          MV-1A-US]
 gi|260572619|gb|EEX29180.1| Glu-tRNA(Gln) amidotransferase subunit C [Lactobacillus crispatus
          MV-3A-US]
 gi|290921546|gb|EFD98580.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          crispatus 214-1]
 gi|295030498|emb|CBL49977.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Lactobacillus crispatus ST1]
 gi|310894253|gb|EFQ43334.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          crispatus CTV-05]
          Length = 102

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV- 66
          +K +A  SR++  EE++  F  ++ + +++ +++SEV+ EGV+  V VV    V R D  
Sbjct: 8  IKHVATLSRLAFNEEELDKFTDQMGSIINMADQLSEVDTEGVDETVQVVDRDTVFREDKP 67

Query: 67 -VCDGDKVESILSNAPHVEKNFFVVP 91
              G   E++++N P     +  VP
Sbjct: 68 EHWQGQDRETLMANVPEKANGYIKVP 93


>gi|298528462|ref|ZP_07015866.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Desulfonatronospira thiodismutans ASO3-1]
 gi|298512114|gb|EFI36016.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Desulfonatronospira thiodismutans ASO3-1]
          Length = 94

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 46/92 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   V RIA  +R+    E    F ++  + +  ++ +++V+  GVEP  S      
Sbjct: 1  MNIDKEYVSRIAALARLETSPEQAEKFAVQFRDIIGYMDSLNQVDTSGVEPFYSPSENIS 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          V R D      +   IL++APH +  +F+VP+
Sbjct: 61 VLREDETRKTCRRSDILASAPHHDGEYFIVPR 92


>gi|149023724|ref|ZP_01836204.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP23-BS72]
 gi|168495042|ref|ZP_02719185.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae CDC3059-06]
 gi|147929661|gb|EDK80653.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae SP23-BS72]
 gi|183575111|gb|EDT95639.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          pneumoniae CDC3059-06]
          Length = 100

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   E++   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLRFSEKETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV  +G   + +  N P  +  +  VP
Sbjct: 61 VLRPDVAEEGTDRDRLFKNVPEKDNYYIKVP 91


>gi|239928775|ref|ZP_04685728.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptomyces
          ghanaensis ATCC 14672]
 gi|291437096|ref|ZP_06576486.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptomyces
          ghanaensis ATCC 14672]
 gi|302558231|ref|ZP_07310573.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptomyces
          griseoflavus Tu4000]
 gi|291339991|gb|EFE66947.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptomyces
          ghanaensis ATCC 14672]
 gi|302475849|gb|EFL38942.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptomyces
          griseoflavus Tu4000]
          Length = 98

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +K E++  F  +L++ +  + ++SEV  + V P    +P+  V RPD 
Sbjct: 8  EVAHLARLARLELKPEELDHFAGQLDDIIGAVARVSEVADQDVPPTSHPLPLTNVMRPDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  LS AP  E+  F VP+
Sbjct: 68 VRPSLTPEQALSGAPAQEQQRFKVPQ 93


>gi|168704721|ref|ZP_02736998.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Gemmata
          obscuriglobus UQM 2246]
          Length = 106

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 50/95 (52%), Gaps = 4/95 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + +  V ++A  +R+ + + D+     +L+  L  +++++++N +GVEP+   +P++ 
Sbjct: 1  MSLSLEQVAKVAKLARLEMSDADLARMQQQLSAILDYIDQLNQLNTDGVEPLAHPLPVQN 60

Query: 61 VHRPDVVCDGDKVESILSNAPH----VEKNFFVVP 91
          V RPD         + L NAP      +  +F VP
Sbjct: 61 VFRPDTPVPSLPAAAALQNAPSKILDKDSGYFGVP 95


>gi|298492555|ref|YP_003722732.1| glutamyl-tRNA(Gln) amidotransferase subunit C ['Nostoc azollae'
          0708]
 gi|298234473|gb|ADI65609.1| glutamyl-tRNA(Gln) amidotransferase, C subunit ['Nostoc azollae'
          0708]
          Length = 96

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 49/91 (53%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   V ++A+ +R+ +  ++   F  +L   L  +E++SE++V  V P    + +  +
Sbjct: 1  MIDREQVHKVANLARLELTPDEEEKFTTQLGTILEYIEQLSELDVTDVLPTTRAIDVSNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D +     +E+IL ++P  E  FF VPK
Sbjct: 61 TREDKLQPYPDIEAILRSSPEQEGEFFKVPK 91


>gi|284162408|ref|YP_003401031.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Archaeoglobus
          profundus DSM 5631]
 gi|284012405|gb|ADB58358.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Archaeoglobus
          profundus DSM 5631]
          Length = 94

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A+ ++I +K ED+  F    +  L     + EV  E VEP   V+P+K V R DV
Sbjct: 6  EVLHVANLAKIELKPEDVKKFKEEFSKILEYFSILDEVG-EDVEPTYHVLPLKNVFREDV 64

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            +    E +L NA HVE  +F  PK +E
Sbjct: 65 PKEPLPRELVLMNAKHVEDGYFKGPKIME 93


>gi|329115768|ref|ZP_08244485.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Streptococcus parauberis NCFD 2020]
 gi|326906173|gb|EGE53087.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Streptococcus parauberis NCFD 2020]
          Length = 100

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 48/95 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  S++S  +++   F   L   + ++E ++EV+ EGV    ++   K 
Sbjct: 1  MKISEEEVRHVATLSKLSFTDQETSEFATTLTKIVEMVEMLNEVDTEGVAVTSTMADRKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R DV   G  ++ +  N P  E NF  VP  +E
Sbjct: 61 VMRQDVAEKGTDLDLLFKNVPEKENNFIKVPAILE 95


>gi|317127165|ref|YP_004093447.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Bacillus
          cellulosilyticus DSM 2522]
 gi|315472113|gb|ADU28716.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus
          cellulosilyticus DSM 2522]
          Length = 96

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 49/88 (55%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+ +A+ +R+    E+I +F  +L++ +   E+++E++   V+P   V+ +K V R D V
Sbjct: 9  VEHVANLARLEFTNEEIDMFQQQLDDIIGYAEQLNELDTSNVKPTSHVLDIKNVLREDEV 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
              + E +L NAP  E   F VP  +E
Sbjct: 69 KPSLEREKVLKNAPDHEDGQFKVPSVLE 96


>gi|78185624|ref|YP_378058.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Synechococcus
          sp. CC9902]
 gi|123581045|sp|Q3AW42|GATC_SYNS9 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|78169918|gb|ABB27015.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Synechococcus sp. CC9902]
          Length = 97

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 47/90 (52%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I   DV+++A  +R+++ ++ I  +  +L + L  + ++ +V+  GV      V +  V 
Sbjct: 4  ISADDVRKVAKLARLNLPDDKIATYTGQLESILGYVSQLEQVDTTGVPETTRAVEVTNVT 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R D V      E IL+ AP  E +FF VPK
Sbjct: 64 RQDGVDPTPVREEILNQAPQREGDFFRVPK 93


>gi|218782323|ref|YP_002433641.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfatibacillum
          alkenivorans AK-01]
 gi|226709616|sp|B8FCL0|GATC_DESAA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|218763707|gb|ACL06173.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfatibacillum
          alkenivorans AK-01]
          Length = 94

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 51/94 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  +R+++ +E++ +F  ++ + L  +++++ V+ EGVE     + +  
Sbjct: 1  MKISEEEVRHVAKLARLNLTDEEVAMFSRQVGDILDYVDQLNTVDTEGVEGASHAISVNN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
            R D V D    +  LSNAP  E    +VPK +
Sbjct: 61 AFREDKVKDSMDPDLALSNAPEREDTDIIVPKVI 94


>gi|134297284|ref|YP_001121019.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          vietnamiensis G4]
 gi|189349011|ref|YP_001944639.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          multivorans ATCC 17616]
 gi|221201876|ref|ZP_03574913.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia multivorans CGD2M]
 gi|221207618|ref|ZP_03580626.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia multivorans CGD2]
 gi|254251092|ref|ZP_04944410.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Burkholderia
          dolosa AUO158]
 gi|166198851|sp|A4JIT1|GATC_BURVG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|124893701|gb|EAY67581.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Burkholderia
          dolosa AUO158]
 gi|134140441|gb|ABO56184.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Burkholderia vietnamiensis G4]
 gi|189333033|dbj|BAG42103.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Burkholderia multivorans ATCC 17616]
 gi|221172464|gb|EEE04903.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia multivorans CGD2]
 gi|221178296|gb|EEE10706.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia multivorans CGD2M]
          Length = 99

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 51/101 (50%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DVKRIAH +R+ + + D    L +LN    ++E++  V+  G+ P+    P++ 
Sbjct: 1  MALTLTDVKRIAHLARLEMADADAEHTLGQLNEFFGLVEQMQAVDTAGIAPLAH--PIEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +       R D V +    +     AP V+   ++VPK +E
Sbjct: 59 IQEVAQRLRDDAVTEVVNRDDNQRPAPAVQDGLYLVPKVIE 99


>gi|300858289|ref|YP_003783272.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Corynebacterium
          pseudotuberculosis FRC41]
 gi|300685743|gb|ADK28665.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Corynebacterium
          pseudotuberculosis FRC41]
 gi|302206009|gb|ADL10351.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Corynebacterium pseudotuberculosis C231]
 gi|302330562|gb|ADL20756.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Corynebacterium pseudotuberculosis 1002]
 gi|308276244|gb|ADO26143.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Corynebacterium pseudotuberculosis I19]
          Length = 97

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 46/86 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ +E++  F  +++  +  +  + +V  EGVEPM     +K   R D+
Sbjct: 8  EVAHLAKLSRLALTDEELDCFAAQIDGIIGNVSAVQKVAAEGVEPMSHPHSIKTTMREDI 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          +      E  L  AP V++  FVVP+
Sbjct: 68 IEQIMTPEQALDQAPAVDQQRFVVPQ 93


>gi|194397149|ref|YP_002037116.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pneumoniae G54]
 gi|229487540|sp|B5E1P8|GATC_STRP4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|194356816|gb|ACF55264.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit [Streptococcus
          pneumoniae G54]
          Length = 100

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   E++   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLRFSEKETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV  +G   + +  N P  +  +  VP
Sbjct: 61 VLRPDVAEEGTDRDRLFKNVPKKDNYYIKVP 91


>gi|147669784|ref|YP_001214602.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Dehalococcoides sp. BAV1]
 gi|289433013|ref|YP_003462886.1| glutamyl-tRNA(Gln) amidotransferase subunit chi [Dehalococcoides
          sp. GT]
 gi|189045162|sp|A5FQ06|GATC_DEHSB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|146270732|gb|ABQ17724.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Dehalococcoides sp. BAV1]
 gi|288946733|gb|ADC74430.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Dehalococcoides
          sp. GT]
          Length = 95

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 48/95 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV  IA  +R+ ++E++I      L+  L   E + +V+  GVEP     P+K 
Sbjct: 1  MKLNREDVLHIARLARLGLEEDEINRLSKELSALLEHFEVLQQVDTTGVEPTSQSTPVKS 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V + D +      E ILSNAP  E ++  +   +E
Sbjct: 61 VLKEDTIKPSYAREDILSNAPRREGDYIRIRAVME 95


>gi|38233673|ref|NP_939440.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Corynebacterium diphtheriae NCTC 13129]
 gi|81564880|sp|Q6NHQ2|GATC_CORDI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|38199934|emb|CAE49602.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Corynebacterium
          diphtheriae]
          Length = 99

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ +E++  F  +++  +  +  + +V  EGVEPM     +K   R DV
Sbjct: 8  EVAHLAKLSRLALTDEELDRFAEQIDGIIGNVSAVQQVAAEGVEPMSHPHSIKTTMREDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  L  AP V++  FVVP+
Sbjct: 68 VEQILTPEQALDQAPAVDQQRFVVPQ 93


>gi|327400264|ref|YP_004341103.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Archaeoglobus veneficus SNP6]
 gi|327315772|gb|AEA46388.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Archaeoglobus veneficus SNP6]
          Length = 93

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 44/89 (49%), Gaps = 1/89 (1%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV +IA  ++I IK E++  F     + L     + EV  E VEP   V+P+  V R DV
Sbjct: 6  DVYKIAGLAKIEIKPEEVENFRKEFQSILEYFNILDEV-TEDVEPTFHVLPISNVFRDDV 64

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
                 E  L NA H+E  +F  P+ VE
Sbjct: 65 PKPCLSREEALKNAKHIEDGYFKGPRVVE 93


>gi|170759907|ref|YP_001788584.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Clostridium
          botulinum A3 str. Loch Maree]
 gi|229487467|sp|B1L1H0|GATC_CLOBM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|169406896|gb|ACA55307.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum A3 str. Loch Maree]
          Length = 95

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 53/89 (59%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ +A  +R+  KEE+   F+  LN  L+ +EK+ E+N + V+ +V+   ++  +R D 
Sbjct: 7  DVEYVAELARLEFKEEEKDNFVNDLNKILNYMEKLDELNTDDVDIVVNPYYIENKYREDN 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V    +++ ++ NAP   + + +VPK ++
Sbjct: 67 VEKSMELKEVIDNAPENLEEYVIVPKVID 95


>gi|124024120|ref|YP_001018427.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Prochlorococcus marinus str. MIT 9303]
 gi|166199387|sp|A2CCF2|GATC_PROM3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|123964406|gb|ABM79162.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Prochlorococcus
          marinus str. MIT 9303]
          Length = 97

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 47/90 (52%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I   DV+++A  +R+ + ++ I  +  +L   L+ + ++ E++   V+P    V +  V 
Sbjct: 4  ITAKDVRKVAQLARLDLPDDQIATYTEQLEKILAYVAQLEEIDTTNVKPTTRAVEVVNVT 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R D V      E +L+ AP  E +FF VPK
Sbjct: 64 RTDEVSATPVREELLNLAPQREGDFFRVPK 93


>gi|255318768|ref|ZP_05359994.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acinetobacter radioresistens SK82]
 gi|262378967|ref|ZP_06072124.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acinetobacter
           radioresistens SH164]
 gi|255304024|gb|EET83215.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acinetobacter radioresistens SK82]
 gi|262300252|gb|EEY88164.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acinetobacter
           radioresistens SH164]
          Length = 104

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 47/93 (50%)

Query: 3   IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
           ++   V  IA+ +R+S+ +     +   LN  L +++ +  ++ EGVEP+ S        
Sbjct: 12  LNAQTVSAIANLARLSLNDTQSAEYAQSLNKILGMMDTLKAIDTEGVEPLKSPFDHPQPL 71

Query: 63  RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           R DVV + +  E   + AP  E   ++VP+ +E
Sbjct: 72  RQDVVTETNHREEYQAVAPATEAGLYLVPRVIE 104


>gi|312797578|ref|YP_004030500.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Burkholderia rhizoxinica HKI 454]
 gi|312169353|emb|CBW76356.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (EC
          6.3.5.-) [Burkholderia rhizoxinica HKI 454]
          Length = 99

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 50/101 (49%), Gaps = 8/101 (7%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV RIAH +RI + + +    L +LN    ++E++  V+  G+ P+    P + 
Sbjct: 1  MALTLTDVNRIAHLARIELGQREAEHTLEQLNQFFGLVEQMQAVDTTGIAPLAH--PTEQ 58

Query: 61 VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +       R D V +  + E     AP V+   ++VP+ +E
Sbjct: 59 IEDVALRLREDAVTEHVRREDNQCCAPAVQDGLYLVPQVIE 99


>gi|118586787|ref|ZP_01544223.1| Glu-tRNA amidotransferase, C subunit [Oenococcus oeni ATCC
           BAA-1163]
 gi|118432780|gb|EAV39510.1| Glu-tRNA amidotransferase, C subunit [Oenococcus oeni ATCC
           BAA-1163]
          Length = 109

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 47/89 (52%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           D   +A  +++   ++ + LF  +L N L ++E ++EV+ +GV+P  +V     V R DV
Sbjct: 18  DAAHVAKLAKLHFNDQQLNLFTGQLANILDLVETLNEVDTDGVKPTYTVSDNINVLREDV 77

Query: 67  VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
               ++   +L+NAP  +     VP  ++
Sbjct: 78  AVKSNQKNELLANAPETQDGQIKVPAIID 106


>gi|254375060|ref|ZP_04990540.1| hypothetical protein FTDG_01248 [Francisella novicida GA99-3548]
 gi|151572778|gb|EDN38432.1| hypothetical protein FTDG_01248 [Francisella novicida GA99-3548]
          Length = 93

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK IA  S   + EE +  +   L+N   +L+ +   + +GV+PM+S + +    R D+ 
Sbjct: 6  VKHIAKLSCFDLTEEQLEQYTKDLSNICKILDTVKNFDAQGVKPMISPISVDFKFREDIP 65

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           D D   S    A  V  ++F+VP+ V+
Sbjct: 66 QDQDNRTSFDKFACEVVDDYFIVPQVVK 93


>gi|262371806|ref|ZP_06065085.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acinetobacter junii
           SH205]
 gi|262311831|gb|EEY92916.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acinetobacter junii
           SH205]
          Length = 105

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 46/93 (49%)

Query: 3   IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
           ++   V  IAH +R+S+ +     +   LN  L ++E +  +N + VEP+ S        
Sbjct: 13  LNTQTVSAIAHLARLSLSDSQSTEYAESLNKILGMMESLKGINTDNVEPLKSPFDNPQPL 72

Query: 63  RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           R DVV + +  +   + AP  E   ++VP+ +E
Sbjct: 73  RADVVTETNHRDEYQAVAPATEAGLYLVPRVIE 105


>gi|148243307|ref|YP_001228464.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Synechococcus
          sp. RCC307]
 gi|166218191|sp|A5GW52|GATC_SYNR3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|147851617|emb|CAK29111.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Synechococcus sp. RCC307]
          Length = 97

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 46/90 (51%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I   DV+++A  +R+ + ++ I  F  +L   L  + ++  ++ EG+ P    V +  V 
Sbjct: 4  ISADDVRKVAQLARLDLPDDSIATFTPQLERILDFVAQLEAIDTEGLPPTTRAVEVVNVT 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R D V      E +L+ AP  E +FF VP+
Sbjct: 64 REDGVEPTPVREELLNQAPQREGDFFRVPR 93


>gi|163781650|ref|ZP_02176650.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Hydrogenivirga
          sp. 128-5-R1-1]
 gi|159882870|gb|EDP76374.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Hydrogenivirga
          sp. 128-5-R1-1]
          Length = 94

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 54/97 (55%), Gaps = 7/97 (7%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVV---PM 58
          ++D   VK+IA  +R+ + EE++ LF  +L + L  +E++ E++  GVEP +  +   PM
Sbjct: 1  MVDRDWVKKIALLARLELTEEEVELFSRQLGDILGFVEQLGELDTTGVEPYIQNIEETPM 60

Query: 59 KMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
              R D   +    E  L NAP  E  FFVVP+ VE
Sbjct: 61 ----REDKPGESLTQEEALKNAPERENGFFVVPRIVE 93


>gi|223934115|ref|ZP_03626061.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          suis 89/1591]
 gi|330832190|ref|YP_004401015.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus suis ST3]
 gi|223897224|gb|EEF63639.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          suis 89/1591]
 gi|329306413|gb|AEB80829.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus suis ST3]
          Length = 100

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  S++   +++   F   L+  + ++E ++EV+  GV    ++   K 
Sbjct: 1  MKISEAEVRHVAKLSKLEFSDQETAEFATSLSKIVDMVELLNEVDTTGVAVTTTMADRKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V R D+   G+  E +  N P  + NF  VP
Sbjct: 61 VLRADIAQKGESREELFKNVPETQDNFIKVP 91


>gi|116491663|ref|YP_811207.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Oenococcus oeni PSU-1]
 gi|290891276|ref|ZP_06554338.1| hypothetical protein AWRIB429_1728 [Oenococcus oeni AWRIB429]
 gi|116092388|gb|ABJ57542.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Oenococcus oeni PSU-1]
 gi|290479240|gb|EFD87902.1| hypothetical protein AWRIB429_1728 [Oenococcus oeni AWRIB429]
          Length = 100

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 47/89 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          D   +A  +++   ++ + LF  +L N L ++E ++EV+ +GV+P  +V     V R DV
Sbjct: 9  DAAHVAKLAKLHFNDQQLNLFTGQLANILDLVETLNEVDTDGVKPTYTVSDNINVLREDV 68

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
              ++   +L+NAP  +     VP  ++
Sbjct: 69 AVKSNQKNELLANAPETQDGQIKVPAIID 97


>gi|329767129|ref|ZP_08258657.1| hypothetical protein HMPREF0428_00354 [Gemella haemolysans M341]
 gi|328837854|gb|EGF87479.1| hypothetical protein HMPREF0428_00354 [Gemella haemolysans M341]
          Length = 96

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 44/88 (50%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V  IAH SR+ I+E ++  ++ +L   + + + I+    E V+P   V+ +  V R DV 
Sbjct: 9  VAHIAHLSRLEIQENEVDGYIEKLEKVVELFDTINNAPTENVKPTYHVLDLVNVFREDVA 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
            G   E +L NA   E   F VP  +E
Sbjct: 69 KPGMDREEVLKNAHETEAGQFKVPTIIE 96


>gi|323484765|ref|ZP_08090122.1| hypothetical protein HMPREF9474_01873 [Clostridium symbiosum
          WAL-14163]
 gi|323401871|gb|EGA94212.1| hypothetical protein HMPREF9474_01873 [Clostridium symbiosum
          WAL-14163]
          Length = 97

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 48/88 (54%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          ++ +   +++++ EE+       ++  L  ++K++E++  G  PM  +  +  V R D +
Sbjct: 10 IEYVGILAKLNLSEEEKKKAGEDMSRMLEYIDKLNELDTRGTAPMSHIFDISNVFREDEI 69

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +GD+   +LSNAP  +   + VP+ VE
Sbjct: 70 TNGDQSGEMLSNAPRQKDKQYQVPRTVE 97


>gi|237785835|ref|YP_002906540.1| glutamyl-tRNA(gln) amidotransferase subunit C [Corynebacterium
          kroppenstedtii DSM 44385]
 gi|259647246|sp|C4LJJ2|GATC_CORK4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|237758747|gb|ACR17997.1| glutamyl-tRNA(Gln) amidotransferase, subunit C [Corynebacterium
          kroppenstedtii DSM 44385]
          Length = 97

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+S+ ++++  F  +++  +  ++K+S V+ EGVEPM     +  V R D 
Sbjct: 8  EVAHLARLSRLSLTDDELDEFADQIDGIIEHVQKVSNVDTEGVEPMSHPSDLAGVMREDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  L  AP  +++ F VP+
Sbjct: 68 VHPTLTAEQALDQAPASQRDRFEVPR 93


>gi|72161009|ref|YP_288666.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Thermobifida
          fusca YX]
 gi|123630067|sp|Q47SC4|GATC_THEFY RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|71914741|gb|AAZ54643.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Thermobifida fusca YX]
          Length = 99

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 46/86 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+++ E+++     +L+  +S + K+ EV    + P    +P+  V+RPD 
Sbjct: 8  EVAHLARLARLALPEDELDQLAAQLDVIISAVAKVQEVAKGDIPPTSHALPLTNVYRPDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V  G   +  L+ AP VE   F VP+
Sbjct: 68 VKPGLTPDQALAEAPAVEDGRFRVPQ 93


>gi|254787703|ref|YP_003075132.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Teredinibacter
          turnerae T7901]
 gi|237687143|gb|ACR14407.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Teredinibacter
          turnerae T7901]
          Length = 93

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 50/91 (54%), Gaps = 4/91 (4%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH--RP 64
          D++++AH +R+ I  E I      +   L++++++S VN +GV PM    P+  V   R 
Sbjct: 5  DIEKLAHLARLEISAETIEQTAKSITEVLALVDQLSSVNTDGVVPMAH--PLDAVQRLRA 62

Query: 65 DVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          D V + ++ ++    AP  E   ++VPK ++
Sbjct: 63 DDVNETNQRDAFQQIAPATEDGLYLVPKVID 93


>gi|193212040|ref|YP_001997993.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Chlorobaculum
          parvum NCIB 8327]
 gi|229487460|sp|B3QL05|GATC_CHLP8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|193085517|gb|ACF10793.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Chlorobaculum
          parvum NCIB 8327]
          Length = 95

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 46/94 (48%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DV  IA  +R+   + +       LN  L  ++K++EV+ EGVEP+ ++     
Sbjct: 1  MSVTTKDVAYIAELARLKFTDAEQERMTDELNMILHYVDKLNEVDTEGVEPLNTIHDQIN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R DV       E  L NAP  +  FF VPK +
Sbjct: 61 VLRADVEHTPLSNEEALKNAPDRQDRFFKVPKVI 94


>gi|53724969|ref|YP_102002.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          mallei ATCC 23344]
 gi|76810772|ref|YP_331781.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          pseudomallei 1710b]
 gi|121600172|ref|YP_994080.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          mallei SAVP1]
 gi|124384336|ref|YP_001028257.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          mallei NCTC 10229]
 gi|126442273|ref|YP_001057224.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          pseudomallei 668]
 gi|126448320|ref|YP_001081901.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          mallei NCTC 10247]
 gi|126455226|ref|YP_001064465.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          pseudomallei 1106a]
 gi|134284070|ref|ZP_01770764.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei 305]
 gi|167001944|ref|ZP_02267734.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia mallei PRL-20]
 gi|167717543|ref|ZP_02400779.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          pseudomallei DM98]
 gi|167736585|ref|ZP_02409359.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          pseudomallei 14]
 gi|167813685|ref|ZP_02445365.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          pseudomallei 91]
 gi|167822201|ref|ZP_02453672.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          pseudomallei 9]
 gi|167843795|ref|ZP_02469303.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          pseudomallei B7210]
 gi|167892294|ref|ZP_02479696.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          pseudomallei 7894]
 gi|167900789|ref|ZP_02487994.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          pseudomallei NCTC 13177]
 gi|167909013|ref|ZP_02496104.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          pseudomallei 112]
 gi|167917051|ref|ZP_02504142.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          pseudomallei BCC215]
 gi|217425077|ref|ZP_03456573.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei 576]
 gi|226194612|ref|ZP_03790207.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei Pakistan 9]
 gi|237810362|ref|YP_002894813.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          (Asp/Glu-ADT subunit C) [Burkholderia pseudomallei
          MSHR346]
 gi|238561927|ref|ZP_00441227.2| glutamyl-tRNA(Gln) amidotransferase subunit C (Glu-ADTsubunit C)
          [Burkholderia mallei GB8 horse 4]
 gi|242317259|ref|ZP_04816275.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei 1106b]
 gi|254176984|ref|ZP_04883641.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia mallei ATCC 10399]
 gi|254182233|ref|ZP_04888830.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei 1655]
 gi|254188160|ref|ZP_04894672.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei Pasteur 52237]
 gi|254197051|ref|ZP_04903475.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei S13]
 gi|254203682|ref|ZP_04910042.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia mallei FMH]
 gi|254208658|ref|ZP_04915006.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia mallei JHU]
 gi|254258038|ref|ZP_04949092.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei 1710a]
 gi|254360287|ref|ZP_04976557.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia mallei 2002721280]
 gi|81605679|sp|Q62MR5|GATC_BURMA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|123600675|sp|Q3JXC2|GATC_BURP1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|166198846|sp|A3MNR5|GATC_BURM7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|166198847|sp|A2S8I8|GATC_BURM9 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|166198848|sp|A1V777|GATC_BURMS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|166198849|sp|A3NQ44|GATC_BURP0 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|166198850|sp|A3N4F3|GATC_BURP6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|52428392|gb|AAU48985.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
          mallei ATCC 23344]
 gi|76580225|gb|ABA49700.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
          pseudomallei 1710b]
 gi|121228982|gb|ABM51500.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia mallei SAVP1]
 gi|124292356|gb|ABN01625.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia mallei NCTC 10229]
 gi|126221766|gb|ABN85272.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei 668]
 gi|126228868|gb|ABN92408.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei 1106a]
 gi|126241190|gb|ABO04283.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia mallei NCTC 10247]
 gi|134244522|gb|EBA44626.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei 305]
 gi|147745194|gb|EDK52274.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia mallei FMH]
 gi|147750534|gb|EDK57603.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia mallei JHU]
 gi|148029527|gb|EDK87432.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia mallei 2002721280]
 gi|157935840|gb|EDO91510.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei Pasteur 52237]
 gi|160698025|gb|EDP87995.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia mallei ATCC 10399]
 gi|169653794|gb|EDS86487.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei S13]
 gi|184212771|gb|EDU09814.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei 1655]
 gi|217392097|gb|EEC32123.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei 576]
 gi|225933313|gb|EEH29305.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei Pakistan 9]
 gi|237503307|gb|ACQ95625.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          (Asp/Glu-ADT subunit C) [Burkholderia pseudomallei
          MSHR346]
 gi|238523632|gb|EEP87069.1| glutamyl-tRNA(Gln) amidotransferase subunit C (Glu-ADTsubunit C)
          [Burkholderia mallei GB8 horse 4]
 gi|242140498|gb|EES26900.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei 1106b]
 gi|243062352|gb|EES44538.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia mallei PRL-20]
 gi|254216727|gb|EET06111.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei 1710a]
          Length = 99

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 49/99 (49%), Gaps = 4/99 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMV----SVV 56
          M + + DV RIAH +R+ + + D    L +LN    ++E++  V+  G+ P+      ++
Sbjct: 1  MALTLTDVTRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVDTTGIAPLAHPIEQIL 60

Query: 57 PMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +    R D V +    +     AP V+   ++VPK +E
Sbjct: 61 EVAQRLREDAVTEHVNRDDNQRPAPAVQDGLYLVPKVIE 99


>gi|303231488|ref|ZP_07318218.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Veillonella
          atypica ACS-049-V-Sch6]
 gi|302513831|gb|EFL55843.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Veillonella
          atypica ACS-049-V-Sch6]
          Length = 96

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   ++K+IA  SR+ +KE+ +      L++ L+ + +++E+ ++ VE M   VP+  
Sbjct: 1  MKISQEEIKKIALLSRLEVKEDKMASVEKELSDILTYVAELNELELDDVEVMAHAVPLHN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D        +  LSNAP  +  +F VP+ V+
Sbjct: 61 VFREDETKPSLDHDLALSNAPEEDDGYFKVPRVVQ 95


>gi|21227328|ref|NP_633250.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Methanosarcina
          mazei Go1]
 gi|20905683|gb|AAM30922.1| Glutamyl-tRNA(Gln) amidotransferase, subunit C [Methanosarcina
          mazei Go1]
          Length = 93

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 46/91 (50%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +I   DV+ I   +RI I E++   ++ +LN+ L    ++ +V  E V P   V  +  V
Sbjct: 1  MITKEDVEHIGWLARIEINEQETVEYMEKLNSVLEYFGQLDKVPTEDVAPTYHVAEVYNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R DV  +    E++L+N  H +   F VPK
Sbjct: 61 FREDVAEECLPQETVLANTEHKQDGTFRVPK 91


>gi|332184808|gb|AEE27062.1| Aspartyl-tRNA(Asn) amidotransferase subunit C /Glutamyl-tRNA(Gln)
          amidotransferase subunit C [Francisella cf. novicida
          3523]
          Length = 93

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK IA  S   + EE +  +   L N   +L+ + + + +GV+PM+S + +    R D+ 
Sbjct: 6  VKHIAKLSCFDLTEEQLEQYTKDLTNICKILDTVKKFDAQGVKPMISPISVDFKFREDIP 65

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           D D   S    A  V  ++F+VP+ V+
Sbjct: 66 QDQDNRASFDKFACEVVDDYFMVPQVVK 93


>gi|269976749|ref|ZP_06183725.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Mobiluncus
          mulieris 28-1]
 gi|269935114|gb|EEZ91672.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Mobiluncus
          mulieris 28-1]
          Length = 98

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 44/90 (48%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          ID  +V+R+A  +RI++ E++I      L      + K+SEV    V      +P+  V 
Sbjct: 4  IDAEEVRRVASLARIALTEDEITKIAADLGVISDAVAKVSEVATPDVPATSHPIPLTNVW 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R DVV      +  L+ APH E   F VP+
Sbjct: 64 REDVVGPTLDHDETLAQAPHPEAGMFGVPQ 93


>gi|270308500|ref|YP_003330558.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit
          [Dehalococcoides sp. VS]
 gi|270154392|gb|ACZ62230.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit
          [Dehalococcoides sp. VS]
          Length = 95

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV  IA  +++ ++E+++      L+  L   E + +V+  GVEP     P+K 
Sbjct: 1  MKLNREDVLHIARLAKLGLEEDEMNRLSKELSALLEHFEVLQQVDTTGVEPTSQSTPVKS 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V + D++      E ILSNAP  E N+  +   +E
Sbjct: 61 VLKEDIIKPSYDREEILSNAPRREGNYVRIRAVME 95


>gi|74316277|ref|YP_314017.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Thiobacillus denitrificans ATCC 25259]
 gi|74055772|gb|AAZ96212.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Thiobacillus
          denitrificans ATCC 25259]
          Length = 95

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DVKRIA  +RI I + +      +LN    ++  +  V+ + V PM     +  
Sbjct: 1  MSLSLDDVKRIAGLARIEIDDAEAHTTQTQLNTIFGLIAAMQAVDTDQVTPMAHAQEVYQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V + D+  +  + AP VE   ++VPK +E
Sbjct: 61 RLRVDAVDEIDRHAAFQAVAPAVENGLYLVPKVIE 95


>gi|57233938|ref|YP_182045.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Dehalococcoides
          ethenogenes 195]
 gi|123618360|sp|Q3Z6V4|GATC_DEHE1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|57224386|gb|AAW39443.1| glutamyl-tRNA(gln) amidotransferase, C subunit [Dehalococcoides
          ethenogenes 195]
          Length = 95

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  DV  IA  +++ ++E++I      L+  L   E + +V+  GVEP     P+K 
Sbjct: 1  MKLNREDVLHIARLAKLGLEEDEINRLSKELSALLEHFEVLQQVDTTGVEPTAQSTPVKS 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V + D++      E ILSNAP  E ++  +   +E
Sbjct: 61 VLKEDIIKPSYDREEILSNAPRREGDYVRIRAVME 95


>gi|72092693|ref|XP_784647.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
 gi|115965104|ref|XP_001195288.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
          Length = 128

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 6   VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RP 64
           VD + I +  R+++   +    + RL + +++ E++ +V+  GVEPM SV+  + ++ R 
Sbjct: 18  VDPQTIENLERLALVNFNSSAGVERLEHAITLAEQLDDVDTTGVEPMASVLEDRELYLRD 77

Query: 65  DVVCDGDKVESILSNAPHVEKNFFVVP 91
           D V +G   E IL NA    + +FV P
Sbjct: 78  DTVTEGYCAEEILMNAAKTCEEYFVAP 104


>gi|269127763|ref|YP_003301133.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Thermomonospora
          curvata DSM 43183]
 gi|268312721|gb|ACY99095.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thermomonospora
          curvata DSM 43183]
          Length = 99

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ E+++     +L+  +S + ++ +V  E + P    +P+  V RPD 
Sbjct: 8  EVAHLARLSRLALDEDELDHLAAQLDVIISAVARVQQVAAEDIPPTSHALPITNVFRPDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  LS AP  E+  F VP+
Sbjct: 68 VRPSLTPEQALSGAPAAEEQRFRVPR 93


>gi|84498245|ref|ZP_00997042.1| glutamyl-tRNA amidotransferase subunit C [Janibacter sp.
          HTCC2649]
 gi|84381745|gb|EAP97628.1| glutamyl-tRNA amidotransferase subunit C [Janibacter sp.
          HTCC2649]
          Length = 98

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV  +A  +RI + + ++   +  L   L  +  + +  +EGVEPM   +P+  V RPDV
Sbjct: 8  DVAHLAGLARIDLSDAELDKMVGELGVILESVATVQQSPIEGVEPMSHPMPIVNVTRPDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      +  LS AP  +   F VP+
Sbjct: 68 VRPSLTADEALSGAPEADHQRFSVPR 93


>gi|319892944|ref|YP_004149819.1| Aspartyl-tRNA(Asn) / Glutamyl-tRNA(Gln) amidotransferase subunit
          C [Staphylococcus pseudintermedius HKU10-03]
 gi|317162640|gb|ADV06183.1| Aspartyl-tRNA(Asn) / Glutamyl-tRNA(Gln) amidotransferase subunit
          C [Staphylococcus pseudintermedius HKU10-03]
 gi|323464003|gb|ADX76156.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          pseudintermedius ED99]
          Length = 100

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 43/84 (51%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+ IA+ +R+++ EED       L   L+   +I  V+ E V+P   V+ ++ V R DV 
Sbjct: 9  VEHIANLARLNVTEEDTADMQQTLEGILNFCHQIDSVDTEQVKPTNHVLDLQNVLRDDVA 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVP 91
            G   E  L+NA  VE   F VP
Sbjct: 69 VTGLPQEKALTNAKEVEAGQFKVP 92


>gi|227503899|ref|ZP_03933948.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Corynebacterium striatum ATCC 6940]
 gi|227199522|gb|EEI79570.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Corynebacterium striatum ATCC 6940]
          Length = 100

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 46/90 (51%), Gaps = 8/90 (8%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVS----VVPMKMVH 62
          +V  +A  SR+++ +E++  F  +++  +  +  + +V+ EGVEPM      V PM    
Sbjct: 8  EVAHLAKLSRLALSDEELEQFATQIDKIVDSVSAVGKVDAEGVEPMSHPHSVVAPM---- 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R DV+      E  L  AP  E   FVVP+
Sbjct: 64 REDVIVRTLTAEQALDQAPAAEDERFVVPQ 93


>gi|298345132|ref|YP_003717819.1| glutamyl-tRNA amidotransferase subunit C [Mobiluncus curtisii
          ATCC 43063]
 gi|304390719|ref|ZP_07372671.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Mobiluncus
          curtisii subsp. curtisii ATCC 35241]
 gi|315655581|ref|ZP_07908479.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Mobiluncus
          curtisii ATCC 51333]
 gi|315656504|ref|ZP_07909393.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Mobiluncus
          curtisii subsp. holmesii ATCC 35242]
 gi|298235193|gb|ADI66325.1| glutamyl-tRNA amidotransferase subunit C [Mobiluncus curtisii
          ATCC 43063]
 gi|304325602|gb|EFL92848.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Mobiluncus
          curtisii subsp. curtisii ATCC 35241]
 gi|315489645|gb|EFU79272.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Mobiluncus
          curtisii ATCC 51333]
 gi|315493063|gb|EFU82665.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Mobiluncus
          curtisii subsp. holmesii ATCC 35242]
          Length = 98

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 47/90 (52%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          ID  +V+R+A  +RI++ +E+I  F   L+     + K++EV    +      +P+  V 
Sbjct: 4  IDADEVRRVAGLARIALTDEEIQKFAAELDVITQAVAKVNEVAKPDIPATSHPIPLTNVW 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R DVV +    + +L  AP  ++  F VPK
Sbjct: 64 REDVVGECLDHDEVLQAAPQPDRGMFGVPK 93


>gi|326929958|ref|XP_003211120.1| PREDICTED: gatC-like protein-like [Meleagris gallopavo]
          Length = 111

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 48/92 (52%), Gaps = 1/92 (1%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M  D V V+ + H  R+++ +      + RL   +   E++ EVN EGVEPM SV+  + 
Sbjct: 1  MAADGVTVEVLDHLERLALVDFRDAEGVERLREAVRFAERLREVNTEGVEPMDSVLEDRC 60

Query: 61 VH-RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          ++ R D V +G     +L NA    + +FV P
Sbjct: 61 LYLREDDVTEGSCTAELLKNAREKVEEYFVAP 92


>gi|221214687|ref|ZP_03587657.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
           subunit [Burkholderia multivorans CGD1]
 gi|221165577|gb|EED98053.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
           subunit [Burkholderia multivorans CGD1]
          Length = 169

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 51/101 (50%), Gaps = 8/101 (7%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M + + DVKRIAH +R+ + + D    L +LN    ++E++  V+  G+ P+    P++ 
Sbjct: 71  MALTLTDVKRIAHLARLEMADADAEHTLGQLNEFFGLVEQMQAVDTAGIAPLAH--PIEQ 128

Query: 61  VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +       R D V +    +     AP V+   ++VPK +E
Sbjct: 129 IQEVAQRLRDDAVTEVVNRDDNQRPAPAVQDGLYLVPKVIE 169


>gi|161526275|ref|YP_001581287.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Burkholderia
           multivorans ATCC 17616]
 gi|160343704|gb|ABX16790.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Burkholderia
           multivorans ATCC 17616]
          Length = 149

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 51/101 (50%), Gaps = 8/101 (7%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M + + DVKRIAH +R+ + + D    L +LN    ++E++  V+  G+ P+    P++ 
Sbjct: 51  MALTLTDVKRIAHLARLEMADADAEHTLGQLNEFFGLVEQMQAVDTAGIAPLAH--PIEQ 108

Query: 61  VH------RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +       R D V +    +     AP V+   ++VPK +E
Sbjct: 109 IQEVAQRLRDDAVTEVVNRDDNQRPAPAVQDGLYLVPKVIE 149


>gi|34763152|ref|ZP_00144120.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium
          nucleatum subsp. vincentii ATCC 49256]
 gi|27887181|gb|EAA24284.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium
          nucleatum subsp. vincentii ATCC 49256]
          Length = 96

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 51/94 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   +V +IA  S++S +E++I  F + LN+ L  ++ ++EV+   VEP+V +     
Sbjct: 1  MALTKEEVLKIAKLSKLSFEEKEIEKFQIELNDILKYIDMLNEVDTSKVEPLVYINEAVN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
            R        K+E +L NAP   +N  VVPK +
Sbjct: 61 NFREKEEKPSLKIEKVLLNAPESAENAIVVPKVI 94


>gi|238855398|ref|ZP_04645709.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          jensenii 269-3]
 gi|260665361|ref|ZP_05866209.1| glutamyl-tRNA(Gln) amidotransferase, C subunit protein
          [Lactobacillus jensenii SJ-7A-US]
 gi|282932091|ref|ZP_06337548.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          jensenii 208-1]
 gi|313473072|ref|ZP_07813556.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          jensenii 1153]
 gi|238831996|gb|EEQ24322.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          jensenii 269-3]
 gi|239528700|gb|EEQ67701.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          jensenii 1153]
 gi|260560865|gb|EEX26841.1| glutamyl-tRNA(Gln) amidotransferase, C subunit protein
          [Lactobacillus jensenii SJ-7A-US]
 gi|281303770|gb|EFA95915.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          jensenii 208-1]
          Length = 100

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 44/91 (48%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   ++K +A  SR+  K+E++  F  +++  + + E++ EV+ EGV     VV    
Sbjct: 1  MEITKEEIKHVAALSRLEFKDEELDQFTSQMDKIIEMAEQLGEVDTEGVPETTQVVDRDT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V+R D        + +L N P     F  VP
Sbjct: 61 VYREDKPEHWQDRKEMLKNVPETTDGFIKVP 91


>gi|302542305|ref|ZP_07294647.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptomyces
          hygroscopicus ATCC 53653]
 gi|302459923|gb|EFL23016.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptomyces
          himastatinicus ATCC 53653]
          Length = 98

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +K E++  F  +L++ +  + ++SEV  + V P    +P+  V RPD 
Sbjct: 8  EVAHLARLARLELKAEELDHFAGQLDDIIGAVARVSEVADQDVPPTSHPLPLTNVMRPDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      +  LS AP  E+  F VP+
Sbjct: 68 VRPSLTPDQALSGAPAQEQQRFKVPQ 93


>gi|194466910|ref|ZP_03072897.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          reuteri 100-23]
 gi|194453946|gb|EDX42843.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          reuteri 100-23]
          Length = 105

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 2/86 (2%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD-- 65
          V+ +A  +++   ++++  F  +L N + + E +  V+ +GVEPM S      V R D  
Sbjct: 10 VEHVAELAKLEFPKDELGKFTTQLGNIIDMFEDLEAVDTDGVEPMTSATDRVNVMREDKA 69

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVP 91
          +    ++ E++L+NAP  +  +  VP
Sbjct: 70 IKSSKEEQEALLNNAPETDGGYIKVP 95


>gi|157826691|ref|YP_001495755.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rickettsia
           bellii OSU 85-389]
 gi|166218178|sp|A8GV47|GATC_RICB8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit C; Short=Asp/Glu-ADT subunit C
 gi|157801995|gb|ABV78718.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rickettsia
           bellii OSU 85-389]
          Length = 100

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 48/95 (50%), Gaps = 6/95 (6%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           +VK+I   +R+  +E+ +  F  RL++ + ++  ++E++   V+P+ SV  M+   RPD 
Sbjct: 6   EVKKITKLARLKFEEDKVEEFSSRLSSIMDMINILNEIDCTDVKPLTSVCDMQARMRPDE 65

Query: 67  VCDGDKVESILSNAPHVEKN------FFVVPKAVE 95
           V   D    +  N     +       +F+ PK VE
Sbjct: 66  VTSKDHSNELFDNVQGASQQLAKEVKYFITPKVVE 100


>gi|227875702|ref|ZP_03993830.1| glutamyl-tRNA amidotransferase subunit C [Mobiluncus mulieris
          ATCC 35243]
 gi|227843644|gb|EEJ53825.1| glutamyl-tRNA amidotransferase subunit C [Mobiluncus mulieris
          ATCC 35243]
          Length = 98

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 44/90 (48%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          ID  +V+R+A  +RI++ E++I      L      + K+SEV    V      +P+  V 
Sbjct: 4  IDAEEVRRVASLARIALTEDEITKIAADLGVISDAVAKVSEVATPDVPATSHPIPLTNVW 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R D+V      +  L+ APH E   F VP+
Sbjct: 64 REDIVGPTLDHDETLAQAPHPEAGMFGVPQ 93


>gi|118602375|ref|YP_903590.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Candidatus Ruthia magnifica str. Cm (Calyptogena
          magnifica)]
 gi|166218181|sp|A1AW12|GATC_RUTMC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|118567314|gb|ABL02119.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Candidatus Ruthia magnifica str. Cm (Calyptogena
          magnifica)]
          Length = 95

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 48/89 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           + +IA+ +R+S+ E  +      LN   S++E+++ +  +G+EPM+  + M    R DV
Sbjct: 7  QINQIAYLARLSLNEVQLKNNTQDLNAIFSLIEQLANIETDGIEPMLHPLHMFQRLRKDV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V + ++     S AP     +++VP  +E
Sbjct: 67 VIEKEQSVLFQSVAPKTRNGYYLVPTVIE 95


>gi|270159584|ref|ZP_06188240.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Legionella longbeachae D-4968]
 gi|289165622|ref|YP_003455760.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Legionella
          longbeachae NSW150]
 gi|269987923|gb|EEZ94178.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Legionella longbeachae D-4968]
 gi|288858795|emb|CBJ12707.1| putative glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Legionella longbeachae NSW150]
          Length = 98

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 50/95 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I V ++++I+  + +    E  P  +  +N  ++ ++++  +N  GVEP+   + +  
Sbjct: 1  MTISVKELEKISKLAYLDTDIEHSPKLIEDINAIMNFVDQLRAINTHGVEPLFHPLALNQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPDVV +   V  + + AP  E   ++VP+ +E
Sbjct: 61 YLRPDVVTEETCVTELAALAPKFENELYLVPQVIE 95


>gi|25027900|ref|NP_737954.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Corynebacterium efficiens YS-314]
 gi|259506294|ref|ZP_05749196.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Corynebacterium
          efficiens YS-314]
 gi|39931580|sp|Q8FPZ1|GATC_COREF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|23493183|dbj|BAC18154.1| putative glutamyl-tRNA(Gln) amidotransferase subunit C
          [Corynebacterium efficiens YS-314]
 gi|259166074|gb|EEW50628.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Corynebacterium
          efficiens YS-314]
          Length = 99

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 44/85 (51%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V  +A  +R+++ EE++  F  ++++ +  +  +  V+ EGVEPM     +    R DVV
Sbjct: 9  VAHLAKLARLALSEEELQQFAGQIDDIVGHVSAVQNVDAEGVEPMSHPHSIMTTMRDDVV 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPK 92
                E  L  AP VE   F+VP+
Sbjct: 69 VKTLTPEQALDQAPAVEDGRFMVPQ 93


>gi|169794872|ref|YP_001712665.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acinetobacter baumannii AYE]
 gi|184159353|ref|YP_001847692.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit [Acinetobacter
           baumannii ACICU]
 gi|213157801|ref|YP_002320599.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acinetobacter
           baumannii AB0057]
 gi|215482420|ref|YP_002324602.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
           subunit [Acinetobacter baumannii AB307-0294]
 gi|239502364|ref|ZP_04661674.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
           subunit [Acinetobacter baumannii AB900]
 gi|260548910|ref|ZP_05823132.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter sp. RUH2624]
 gi|260557238|ref|ZP_05829454.1| glutamyl-tRNA(Gln) amidotransferase, C subunit protein
           [Acinetobacter baumannii ATCC 19606]
 gi|262281196|ref|ZP_06058978.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter calcoaceticus RUH2202]
 gi|293610982|ref|ZP_06693281.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|299768906|ref|YP_003730932.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acinetobacter sp. DR1]
 gi|301344936|ref|ZP_07225677.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acinetobacter baumannii AB056]
 gi|301511194|ref|ZP_07236431.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acinetobacter baumannii AB058]
 gi|301594362|ref|ZP_07239370.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acinetobacter baumannii AB059]
 gi|332853445|ref|ZP_08434764.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
           [Acinetobacter baumannii 6013150]
 gi|332870572|ref|ZP_08439314.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
           [Acinetobacter baumannii 6013113]
 gi|332874206|ref|ZP_08442128.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
           [Acinetobacter baumannii 6014059]
 gi|169147799|emb|CAM85662.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acinetobacter baumannii AYE]
 gi|183210947|gb|ACC58345.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit [Acinetobacter
           baumannii ACICU]
 gi|193078234|gb|ABO13194.2| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acinetobacter baumannii ATCC 17978]
 gi|213056961|gb|ACJ41863.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acinetobacter
           baumannii AB0057]
 gi|213988306|gb|ACJ58605.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
           subunit [Acinetobacter baumannii AB307-0294]
 gi|260408078|gb|EEX01549.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter sp. RUH2624]
 gi|260409344|gb|EEX02646.1| glutamyl-tRNA(Gln) amidotransferase, C subunit protein
           [Acinetobacter baumannii ATCC 19606]
 gi|262257427|gb|EEY76163.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter calcoaceticus RUH2202]
 gi|292826634|gb|EFF85000.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|298698994|gb|ADI89559.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acinetobacter sp. DR1]
 gi|322509265|gb|ADX04719.1| gatC [Acinetobacter baumannii 1656-2]
 gi|323519293|gb|ADX93674.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit [Acinetobacter
           baumannii TCDC-AB0715]
 gi|325123300|gb|ADY82823.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acinetobacter calcoaceticus PHEA-2]
 gi|332728651|gb|EGJ60019.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
           [Acinetobacter baumannii 6013150]
 gi|332732132|gb|EGJ63401.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
           [Acinetobacter baumannii 6013113]
 gi|332737565|gb|EGJ68470.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
           [Acinetobacter baumannii 6014059]
          Length = 104

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 47/93 (50%)

Query: 3   IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
           ++   V  IA+ +R+S+ +     +   LN  L ++E +  ++ EGVEP+ S        
Sbjct: 12  LNAQTVSAIANLARLSLNDTQSAEYAQSLNKILGMMETLKGIDTEGVEPLKSPFDNPQPL 71

Query: 63  RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           R DVV + +  +   + AP  +   ++VP+ +E
Sbjct: 72  RADVVTESNHRDEYQAVAPATQDGLYLVPRVIE 104


>gi|317051993|ref|YP_004113109.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Desulfurispirillum
          indicum S5]
 gi|316947077|gb|ADU66553.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Desulfurispirillum indicum S5]
          Length = 95

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I  V+V  IA  SR+S+ E ++  +   LN+ L  ++ ++ +N + + P    V    
Sbjct: 1  MKIQQVEVLHIARLSRLSLSEAEVEQYGEDLNSILGYMDALNALNTDDIPPTSHAVTNGT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V     +E +++NAP  + + F VP  +E
Sbjct: 61 VMRDDAVLPSLPLELVMANAPDHDMDHFRVPPVIE 95


>gi|332522494|ref|ZP_08398746.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Streptococcus porcinus str. Jelinkova 176]
 gi|332313758|gb|EGJ26743.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Streptococcus porcinus str. Jelinkova 176]
          Length = 100

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 47/95 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  S+++  +++   F   L   + ++E ++EV+ EG+    ++   K 
Sbjct: 1  MKISEEEVRHVATLSKLTFSDQETSAFATSLTKIVDMIELLNEVDTEGIAITTTMADRKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D+   G   + +  N P  E NF  VP  +E
Sbjct: 61 VMRQDIAHAGTDRQLLFKNVPEKENNFIKVPAILE 95


>gi|262067506|ref|ZP_06027118.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Fusobacterium
          periodonticum ATCC 33693]
 gi|291378769|gb|EFE86287.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Fusobacterium
          periodonticum ATCC 33693]
          Length = 96

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 50/88 (56%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V +IA  S++S +EE+I  F + LN+ L  ++ ++EV+   V+P+V +  +    R   
Sbjct: 7  EVLKIAKLSKLSFEEEEIEKFQVELNDILKYIDMLNEVDTSEVQPLVHINDVVNNFREKE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
               ++E +L NAP   +N  VVPK V
Sbjct: 67 EKSSIEIEKVLLNAPESAENAIVVPKVV 94


>gi|146318009|ref|YP_001197721.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          suis 05ZYH33]
 gi|146320192|ref|YP_001199903.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          suis 98HAH33]
 gi|253751220|ref|YP_003024361.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus suis
          SC84]
 gi|253753121|ref|YP_003026261.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus suis
          P1/7]
 gi|253754943|ref|YP_003028083.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus suis
          BM407]
 gi|166218186|sp|A4VZG4|GATC_STRS2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|166218188|sp|A4VT82|GATC_STRSY RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|145688815|gb|ABP89321.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit [Streptococcus
          suis 05ZYH33]
 gi|145690998|gb|ABP91503.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit [Streptococcus
          suis 98HAH33]
 gi|251815509|emb|CAZ51089.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus suis
          SC84]
 gi|251817407|emb|CAZ55145.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus suis
          BM407]
 gi|251819366|emb|CAR44768.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus suis
          P1/7]
 gi|292557785|gb|ADE30786.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Streptococcus suis
          GZ1]
 gi|319757495|gb|ADV69437.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          suis JS14]
          Length = 100

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  S++   +++   F   L+  + ++E ++EV+  GV    ++   K 
Sbjct: 1  MKISEAEVRHVAKLSKLEFSDQETAEFATSLSKIVDMVELLNEVDTTGVAVTTTMADRKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V R D+   G+  E +  N P  + NF  VP
Sbjct: 61 VLRADIAQKGESREELFKNVPESQDNFIKVP 91


>gi|76801378|ref|YP_326386.1| aspartyl-tRNA(Asn) amidotransferase subunit C [Natronomonas
          pharaonis DSM 2160]
 gi|76557243|emb|CAI48818.1| aspartyl-tRNA(Asn) amidotransferase subunit C [Natronomonas
          pharaonis DSM 2160]
          Length = 89

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 5/92 (5%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   V+ +A  +R+ + E+++ LF  +  + L   E +   +V  VEP      +  
Sbjct: 1  MTVDDDAVRHVASLARVDLDEDEVELFAEQFGDILEYFEALD--DVPDVEPETE---LAN 55

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          V RPD V +G   +  L NAP  E  +F  PK
Sbjct: 56 VMRPDEVHEGLTQDEALQNAPETEDGYFKGPK 87


>gi|292655212|ref|YP_003535109.1| aspartyl-tRNA(Asn) amidotransferase subunit C [Haloferax volcanii
          DS2]
 gi|291370316|gb|ADE02543.1| aspartyl-tRNA(Asn) amidotransferase subunit C [Haloferax volcanii
          DS2]
          Length = 92

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 47/91 (51%), Gaps = 7/91 (7%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEV-NVEGVEPMVSVVPMKMV 61
          +D  +V+ +A  +R+ + E+++  F  R  + L   + + EV  V+  + +V+V+     
Sbjct: 6  VDADEVRHVAELARVDLDEDEVEEFAARFADILGYFDALDEVPEVDREDELVNVM----- 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           RPD V DG   E  LSNA   E  FF  P+
Sbjct: 61 -RPDEVRDGLTQEEALSNAAETEDGFFKGPR 90


>gi|302871352|ref|YP_003839988.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Caldicellulosiruptor obsidiansis OB47]
 gi|302574211|gb|ADL42002.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Caldicellulosiruptor obsidiansis OB47]
          Length = 94

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 47/89 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ +A+ +R+++ EE+    +  L   +    K+S+++ EG+EP   V+ +  V R D 
Sbjct: 6  DVEYVANLARLTLTEEETEKMIKELGAIIEFANKLSDLDTEGIEPTAHVLNLFNVFRSDE 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V      E IL NAP  +     VPK VE
Sbjct: 66 VKPSYPREKILQNAPSHDDVCIKVPKIVE 94


>gi|294054940|ref|YP_003548598.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Coraliomargarita
          akajimensis DSM 45221]
 gi|293614273|gb|ADE54428.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Coraliomargarita
          akajimensis DSM 45221]
          Length = 97

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 50/96 (52%), Gaps = 11/96 (11%)

Query: 6  VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD 65
          +D+  +A+ +RI + +++      +L++ L   EK++ V+V GVEPM    P+  V R  
Sbjct: 7  IDIDYVANLARIDLSDDEKAKLGGQLDDILGYFEKLNAVDVSGVEPMAHARPVFNVWR-- 64

Query: 66 VVCDGDKVESILSN------APHVEKNFFVVPKAVE 95
             +GD+  +  S       AP   +N  VVPK VE
Sbjct: 65 ---EGDEAGATYSPEVLQKMAPEFRENQVVVPKVVE 97


>gi|291299867|ref|YP_003511145.1| glutamyl-tRNA(gln) amidotransferase subunit C [Stackebrandtia
          nassauensis DSM 44728]
 gi|290569087|gb|ADD42052.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Stackebrandtia
          nassauensis DSM 44728]
          Length = 99

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 46/86 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +AH +R+ + E+++  F  +L+  L  +++I+EV  E + P    VP+  V+R D 
Sbjct: 8  EVAHLAHLARLDVTEDELDRFAQQLDVILQSVQRINEVAAEDIPPTSHAVPLTNVYRDDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
                    L+ AP  +++ F VP+
Sbjct: 68 PRPSLSRADALAGAPDTDQDRFRVPR 93


>gi|324999190|ref|ZP_08120302.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Pseudonocardia sp.
           P1]
          Length = 107

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 46/86 (53%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           +V  +A  +R+++ EE++ +F  +L+  +  + ++ EV  + + P    VP++ V RPD 
Sbjct: 16  EVAHLARLARLAVTEEELDVFAGQLDVIIGSVARVGEVAADDIPPTSHAVPLENVFRPDE 75

Query: 67  VCDGDKVESILSNAPHVEKNFFVVPK 92
                +    L+ AP  E+  F VP+
Sbjct: 76  RRPSLEQSQALAGAPAAEQGRFRVPR 101


>gi|309389838|gb|ADO77718.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Halanaerobium praevalens DSM 2228]
          Length = 95

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 51/91 (56%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +I+  +V+  A  +++++ ++ I  +  ++   L  ++K+SE++ + V P    VPMK V
Sbjct: 1  MINQKEVEHAAKLAKLNLDQDKIEKYTKQIGAVLDYVDKLSELDTKDVIPTAYTVPMKNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D V +   +E  ++NAP  ++  F  PK
Sbjct: 61 LREDKVEESLSIEKSIANAPDKKEGQFRAPK 91


>gi|320159728|ref|YP_004172952.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Anaerolinea thermophila UNI-1]
 gi|319993581|dbj|BAJ62352.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Anaerolinea thermophila UNI-1]
          Length = 96

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 45/95 (47%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + +V+ IA  + + + EE+   F  +L+  L    ++ EV+   + P       + 
Sbjct: 1  MSLTLAEVEHIARLAHLELTEEEKNRFREQLSAILEYAARLQEVDTRSISPTAWTFNAQA 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DV   G     +LSNAP V+ + F VP  +E
Sbjct: 61 PLREDVPAQGLSTAEVLSNAPQVQNDQFRVPPVLE 95


>gi|262368932|ref|ZP_06062261.1| glutamyl-tRNA(Gln) amidotransferase [Acinetobacter johnsonii SH046]
 gi|262316610|gb|EEY97648.1| glutamyl-tRNA(Gln) amidotransferase [Acinetobacter johnsonii SH046]
          Length = 104

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 46/88 (52%)

Query: 8   VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
           V  IA+ +R+S+ +     +   LN  L ++E +  ++ +GVEP+ S        R DVV
Sbjct: 17  VSAIANLARLSLDDTQSAEYAQSLNKILGMMETLKGIDTDGVEPLKSPFDHPQPLREDVV 76

Query: 68  CDGDKVESILSNAPHVEKNFFVVPKAVE 95
            + +  +   + AP V+   ++VP+ +E
Sbjct: 77  SETNHRDEYQAIAPQVQDGLYLVPRVIE 104


>gi|114053047|ref|NP_001040027.1| gatC-like protein [Bos taurus]
 gi|122136010|sp|Q2KIF1|GATCL_BOVIN RecName: Full=GatC-like protein
 gi|86438410|gb|AAI12662.1| Glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial)
           [Bos taurus]
 gi|296478538|gb|DAA20653.1| glutamyl-tRNA(Gln) amidotransferase, subunit C homolog [Bos taurus]
          Length = 136

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCD 69
           I H  R+S+ +      + RL   ++  +++  VN +GVEPM SV+  + ++ R D V +
Sbjct: 37  IQHLERLSLVDFGSQEAVARLEKAIAFADRLRAVNTDGVEPMESVLEDRCLYLRSDNVVE 96

Query: 70  GDKVESILSNAPHVEKNFFVVP 91
           G   E +L N+  V + +FV P
Sbjct: 97  GSCAEELLQNSHRVVEEYFVAP 118


>gi|257452525|ref|ZP_05617824.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium sp.
          3_1_5R]
 gi|257466392|ref|ZP_05630703.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium
          gonidiaformans ATCC 25563]
 gi|315917548|ref|ZP_07913788.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium
          gonidiaformans ATCC 25563]
 gi|317059066|ref|ZP_07923551.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium sp.
          3_1_5R]
 gi|313684742|gb|EFS21577.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium sp.
          3_1_5R]
 gi|313691423|gb|EFS28258.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium
          gonidiaformans ATCC 25563]
          Length = 97

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 47/88 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V ++A  +++   EE I  F   LN+ L  ++ ++EV+   +EP++ V   +   R D 
Sbjct: 7  EVLKVAKLAKLKFSEEKIEKFQEELNDILGYVDMLNEVDTTEIEPLIYVHEAQNNFREDE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
               +VE +L NAP+ E    +VP+ V
Sbjct: 67 ARASLEVEEVLRNAPNAEDGAIIVPRVV 94


>gi|117927904|ref|YP_872455.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Acidothermus cellulolyticus 11B]
 gi|166198833|sp|A0LSQ9|GATC_ACIC1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|117648367|gb|ABK52469.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Acidothermus cellulolyticus 11B]
          Length = 98

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%)

Query: 6  VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD 65
           DV  +A  SR+++ E ++  F  +L+  L  + K+S V    V P    +P+  V+R D
Sbjct: 7  ADVAHLARLSRLALTEAELDRFAGQLDVILDAVAKVSSVAGSDVRPTSHPLPLTNVYRDD 66

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           V     V  +L+ AP VE   F VP+ +E
Sbjct: 67 EVRPSLPVGEVLAAAPAVEDQRFKVPRILE 96


>gi|116493115|ref|YP_804850.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Pediococcus pentosaceus ATCC 25745]
 gi|116103265|gb|ABJ68408.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Pediococcus pentosaceus ATCC 25745]
          Length = 104

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ +A  +++   +E +  F  ++ + + +++ ++EV+   VEP  +V       R DV
Sbjct: 11 DVEHVATLAKLKFNDEQLEKFTDQIEDIIDLVDTLNEVDTTNVEPTFNVTDQLNRMREDV 70

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
              +  E++L+NAP  E  F  VP
Sbjct: 71 AVRSNDKEALLANAPETENGFIRVP 95


>gi|227501730|ref|ZP_03931779.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Corynebacterium accolens ATCC 49725]
 gi|306835909|ref|ZP_07468902.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Corynebacterium
          accolens ATCC 49726]
 gi|227077755|gb|EEI15718.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Corynebacterium accolens ATCC 49725]
 gi|304568183|gb|EFM43755.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Corynebacterium
          accolens ATCC 49726]
          Length = 98

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ +E++  F  +++  +  +  +  V+ EGVEPM     +    R DV
Sbjct: 8  EVAHLAKLSRLALSDEELAQFASQIDEIVDSVSAVRNVDTEGVEPMSHPHSVDAPMREDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          +      E  L  AP VE   FVVP+
Sbjct: 68 IVRTLTAEQALDQAPAVEDERFVVPQ 93


>gi|159036757|ref|YP_001536010.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Salinispora
          arenicola CNS-205]
 gi|189045174|sp|A8M5E5|GATC_SALAI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|157915592|gb|ABV97019.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Salinispora
          arenicola CNS-205]
          Length = 101

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ EE++     +L+  L  + ++ EV    + P    VP+  V R DV
Sbjct: 8  EVAHLARLSRLAVTEEELGTLAGQLDVILQAVAQVGEVTAADIPPTSHSVPLTNVLRDDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      +  LS AP  E+  F VP+
Sbjct: 68 VAPCLSPQEALSGAPDAEEQRFRVPR 93


>gi|289522354|ref|ZP_06439208.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Anaerobaculum
          hydrogeniformans ATCC BAA-1850]
 gi|289504190|gb|EFD25354.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Anaerobaculum
          hydrogeniformans ATCC BAA-1850]
          Length = 105

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 50/93 (53%), Gaps = 4/93 (4%)

Query: 5  VVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEP--MVSVVPMKMVH 62
          V +++R+A  + + + E++I     +  N L  L+ +SE+N + + P  +  V PM    
Sbjct: 9  VEEIRRVAKLAMLELNEDEIKHIGTQFKNILDQLQTLSELNAKDINPFSLEDVEPMPW-- 66

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          R D V   ++   +LS AP  E+ +F VP+ VE
Sbjct: 67 RKDEVVAWNRYSEVLSQAPVSEEGYFKVPRIVE 99


>gi|158312938|ref|YP_001505446.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Frankia sp.
          EAN1pec]
 gi|158108343|gb|ABW10540.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Frankia sp.
          EAN1pec]
          Length = 98

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A  SR+S+ + ++     +L   L  + ++SEV    + P    VP+  
Sbjct: 1  MAITRDEVANLARLSRMSLSDAELDALAPQLEAILGAVARVSEVAAADIPPTSHAVPLTN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          V R DV      V  +L+ AP  E+  F VP+
Sbjct: 61 VFRADVTRPSLPVADVLAGAPAAEEGRFRVPR 92


>gi|70726052|ref|YP_252966.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          haemolyticus JCSC1435]
 gi|123660613|sp|Q4L7L5|GATC_STAHJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|68446776|dbj|BAE04360.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Staphylococcus
          haemolyticus JCSC1435]
          Length = 100

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 41/85 (48%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ IAH +R+ I EE+       L + L   ++    + EG+EP   V+ ++ V R D 
Sbjct: 8  EVEHIAHLARLQISEEETEEMANTLESILDFAKQNDTADTEGIEPTYHVLDLQNVLRDDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
            +G   E  L NA   E   F VP
Sbjct: 68 AIEGIPQELALKNAKETENGQFKVP 92


>gi|161609257|ref|NP_891064.2| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bordetella
           bronchiseptica RB50]
 gi|39931451|sp|Q7WEV2|GATC_BORBR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit C; Short=Asp/Glu-ADT subunit C
          Length = 102

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 7/102 (6%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVP--- 57
           M ++  DV RIA  +RI +  +        LN  L ++E++  V+ +GVEP+   +    
Sbjct: 1   MALNEQDVARIARLARIELTPDQRGRAQAELNGILHLIERLQAVDTQGVEPLAHPLSAHE 60

Query: 58  -MKMVHRPDVVCDGDKVES---ILSNAPHVEKNFFVVPKAVE 95
            + +  R D V +     S   +L+NAP      F+VPK +E
Sbjct: 61  DITLRLREDAVSEQATEASRAELLANAPESADGLFLVPKVIE 102


>gi|281340833|gb|EFB16417.1| hypothetical protein PANDA_020891 [Ailuropoda melanoleuca]
          Length = 123

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCD 69
           I H  R+++ +      + RL   ++  +++  V+ +GVEPM SV+  + ++ R D V +
Sbjct: 37  IEHLERLALVDFGSQEAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDSVVE 96

Query: 70  GDKVESILSNAPHVEKNFFVVP 91
           G+  E +L NA  V + +FV P
Sbjct: 97  GNCAEELLQNAHRVVEEYFVAP 118


>gi|192360948|ref|YP_001983277.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Cellvibrio japonicus Ueda107]
 gi|190687113|gb|ACE84791.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Cellvibrio japonicus Ueda107]
          Length = 180

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 51/95 (53%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M +D  D+ ++A  +RI I +E        +++ L++++++  VN + V PM   +    
Sbjct: 86  MAVDTSDIAKLATLARIQISDEAAVEAAKSISDVLALVDQLQAVNTDDVLPMAHPLDATQ 145

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
             RPD V + ++ E   S AP ++   ++VP+ +E
Sbjct: 146 RLRPDQVNEPNQRELFQSIAPAIQDGLYLVPQVIE 180


>gi|145219217|ref|YP_001129926.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Prosthecochloris vibrioformis DSM 265]
 gi|189045169|sp|A4SD65|GATC_PROVI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|145205381|gb|ABP36424.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Chlorobium phaeovibrioides DSM 265]
          Length = 95

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 47/92 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + + DV  IA  +R+   +++       LN  L  ++ ++EV+ EGV P+ ++   K 
Sbjct: 1  MSVTIDDVTYIAELARLRFSDDEALKMTDELNTILHYVDTLNEVDTEGVLPLSNIHDQKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          V R D   +     + LSNAP  +  FF VPK
Sbjct: 61 VLRADEEHEPIANAAALSNAPDSQDRFFRVPK 92


>gi|307700325|ref|ZP_07637365.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Mobiluncus
          mulieris FB024-16]
 gi|307614536|gb|EFN93765.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Mobiluncus
          mulieris FB024-16]
          Length = 98

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 44/90 (48%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          ID  +V+R+A  +RI++ E++I      L      + K+SEV    V      +P+  V 
Sbjct: 4  IDAEEVRRVASLARIALTEDEIIKIAADLGVISDAVAKVSEVATPDVPATSHPIPLTNVW 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R DVV      +  L+ APH E   F VP+
Sbjct: 64 REDVVGPTLDHDETLAQAPHPEAGMFGVPQ 93


>gi|87301901|ref|ZP_01084735.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Synechococcus sp.
          WH 5701]
 gi|87283469|gb|EAQ75424.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Synechococcus sp.
          WH 5701]
          Length = 97

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+++A  +R+ + E  I  +  +L   L  +  + +V+ EGV P    V +  V R D 
Sbjct: 8  DVRKVAKLARLDLPEAKIATYTGQLERILEYVAHLEQVDTEGVPPTTRAVEVVNVTRNDD 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E +L  AP  E +FF VP+
Sbjct: 68 VVATPVREELLELAPQREGDFFRVPQ 93


>gi|323691834|ref|ZP_08106090.1| hypothetical protein HMPREF9475_00952 [Clostridium symbiosum
          WAL-14673]
 gi|323504116|gb|EGB19922.1| hypothetical protein HMPREF9475_00952 [Clostridium symbiosum
          WAL-14673]
          Length = 97

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 48/88 (54%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          ++ +   +++++ EE+       ++  L  ++K++E++  G  PM  +  +  V R D +
Sbjct: 10 IEYVGILAKLNLSEEEKKKAGEDMSRMLEYIDKLNELDTRGTVPMSHIFDISNVFREDEI 69

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +GD+   +LSNAP  +   + VP+ VE
Sbjct: 70 TNGDQSGEMLSNAPRQKDKQYQVPRTVE 97


>gi|159026311|emb|CAO88887.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 98

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 47/91 (51%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   V++IAH +R+ I   +   F  +L+  L   E++SE++ E V P    + ++ +
Sbjct: 1  MIDRATVEKIAHLARLEITNAEEEQFAGQLSGILDYFEQLSELDTENVPPTTRAIEIQNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D        E ++  +P  E ++F VP+
Sbjct: 61 TRTDSNRLYPDHEVLVQESPAPEGDYFRVPR 91


>gi|33577628|emb|CAE34893.1| glutamyl-tRNA(GLN) amidotransferase subunit C [Bordetella
           bronchiseptica RB50]
          Length = 121

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 7/102 (6%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVP--- 57
           M ++  DV RIA  +RI +  +        LN  L ++E++  V+ +GVEP+   +    
Sbjct: 20  MALNEQDVARIARLARIELTPDQRGRAQAELNGILHLIERLQAVDTQGVEPLAHPLSAHE 79

Query: 58  -MKMVHRPDVVCDGDKVES---ILSNAPHVEKNFFVVPKAVE 95
            + +  R D V +     S   +L+NAP      F+VPK +E
Sbjct: 80  DITLRLREDAVSEQATEASRAELLANAPESADGLFLVPKVIE 121


>gi|295697352|ref|YP_003590590.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus tusciae
          DSM 2912]
 gi|295412954|gb|ADG07446.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bacillus tusciae
          DSM 2912]
          Length = 96

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I +  V+ +A  +R+++ E +  ++  +L   L+  +++ E++V  V P   V+P+  
Sbjct: 1  MKISLEQVEHVARLARLALTEREAEIYAEQLGAILAFADQLQELDVSDVPPTSHVLPISN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D    G   E+ L+ AP  E   F VP  +E
Sbjct: 61 VLREDEQRPGLSREAALAGAPDQEDGQFRVPAILE 95


>gi|46579222|ref|YP_010030.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Desulfovibrio
          vulgaris str. Hildenborough]
 gi|120603211|ref|YP_967611.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfovibrio
          vulgaris DP4]
 gi|81567065|sp|Q72DX0|GATC_DESVH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|166199147|sp|A1VFG8|GATC_DESVV RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|46448635|gb|AAS95289.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfovibrio
          vulgaris str. Hildenborough]
 gi|120563440|gb|ABM29184.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Desulfovibrio vulgaris DP4]
 gi|311233053|gb|ADP85907.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfovibrio
          vulgaris RCH1]
          Length = 94

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 44/94 (46%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I    V  IA  +R+ + E  +  F  +  + L  ++ +  V+   VEP+ S      
Sbjct: 1  MKISKEQVATIARLARLDLDEARLERFAGQFGDILDYMDMLGAVDTTDVEPLYSPSEHGT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R D V      E +L+NAP  +  FFVVP+ V
Sbjct: 61 VLRADEVHTHCTREELLANAPESDGQFFVVPRIV 94


>gi|33591601|ref|NP_879245.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bordetella
           pertussis Tohama I]
 gi|39931425|sp|Q7VSN1|GATC_BORPE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit C; Short=Asp/Glu-ADT subunit C
 gi|33571244|emb|CAE44705.1| glutamyl-tRNA(GLN) amidotransferase subunit C [Bordetella pertussis
           Tohama I]
 gi|332381001|gb|AEE65848.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bordetella
           pertussis CS]
          Length = 102

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 50/102 (49%), Gaps = 7/102 (6%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVP--- 57
           M ++  DV RIA  +RI +  +        LN  L ++E++  V+ +GVEP+   +    
Sbjct: 1   MALNEQDVARIARLARIELTPDQRGRAQAELNGILHLIERLQAVDTQGVEPLAHPLSAHE 60

Query: 58  -MKMVHRPDVVCDG---DKVESILSNAPHVEKNFFVVPKAVE 95
            + +  R D V +     +   +L+NAP      F+VPK +E
Sbjct: 61  DITLRLREDAVSEQATEARRAELLANAPESADGLFLVPKVIE 102


>gi|167627138|ref|YP_001677638.1| Glu-tRNAGln amidotransferase C subunit [Francisella philomiragia
          subsp. philomiragia ATCC 25017]
 gi|241667700|ref|ZP_04755278.1| Glu-tRNAGln amidotransferase C subunit [Francisella philomiragia
          subsp. philomiragia ATCC 25015]
 gi|254876244|ref|ZP_05248954.1| glu-tRNAGln amidotransferase C subunit [Francisella philomiragia
          subsp. philomiragia ATCC 25015]
 gi|167597139|gb|ABZ87137.1| Glu-tRNAGln amidotransferase C subunit [Francisella philomiragia
          subsp. philomiragia ATCC 25017]
 gi|254842265|gb|EET20679.1| glu-tRNAGln amidotransferase C subunit [Francisella philomiragia
          subsp. philomiragia ATCC 25015]
          Length = 93

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK IA  S   + E+ +  +   L N   +L+ + + +  GV PMVS + +    R D+ 
Sbjct: 6  VKHIAKLSCFDLNEQQLEQYTQDLTNICKILDAVKDFDANGVTPMVSPISVDFKFREDIP 65

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           D D   S    A  V  ++F+VP+ V+
Sbjct: 66 QDQDNRASFDKFACEVVDDYFMVPQVVK 93


>gi|301790880|ref|XP_002930442.1| PREDICTED: gatC-like protein-like [Ailuropoda melanoleuca]
          Length = 136

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCD 69
           I H  R+++ +      + RL   ++  +++  V+ +GVEPM SV+  + ++ R D V +
Sbjct: 37  IEHLERLALVDFGSQEAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDSVVE 96

Query: 70  GDKVESILSNAPHVEKNFFVVP 91
           G+  E +L NA  V + +FV P
Sbjct: 97  GNCAEELLQNAHRVVEEYFVAP 118


>gi|317125498|ref|YP_004099610.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Intrasporangium calvum DSM 43043]
 gi|315589586|gb|ADU48883.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Intrasporangium calvum DSM 43043]
          Length = 98

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV  +A  +RI + + ++   +  L+  L  + K+ +  +  V PM   +P+  V RPDV
Sbjct: 8  DVAHLAGLARIDLSDAELDRMVGELSVILESVAKVQQAPIADVPPMSHPMPLTNVTRPDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V  G   +  LS AP  E   F VP+
Sbjct: 68 VRPGLTPDEALSGAPERELGRFAVPR 93


>gi|313885103|ref|ZP_07818855.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Eremococcus coleocola ACS-139-V-Col8]
 gi|312619794|gb|EFR31231.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Eremococcus coleocola ACS-139-V-Col8]
          Length = 98

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 51/94 (54%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          ++ + + +R+A  ++++I  +    F   +   +S+++++ EV+ EGV+P      ++ +
Sbjct: 1  MLGIDNFERLAKLAKLNIAADRAAAFEADIQEIVSMVQQLQEVDTEGVQPTYFGNALENI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +RPD      K E+ L+N P  +  F  VP  +E
Sbjct: 61 YRPDQAKLSGKREAFLANTPESQDGFIKVPAILE 94


>gi|330718851|ref|ZP_08313451.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Leuconostoc fallax KCTC 3537]
          Length = 101

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +++S  +E +  F  +L++ L++ + ++ VN E VEP  SV     + R DV
Sbjct: 9  EVAHVAGLAKLSFNDEQLDHFTTQLSDILNIFDTLATVNTENVEPTYSVTENVNILREDV 68

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
            +  + + +L NAP        VP
Sbjct: 69 ADNWQQKQELLKNAPLEAAGLIKVP 93


>gi|306826770|ref|ZP_07460072.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
           pyogenes ATCC 10782]
 gi|50903922|gb|AAT87637.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
           pyogenes MGAS10394]
 gi|94542648|gb|ABF32697.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
           pyogenes MGAS9429]
 gi|94546541|gb|ABF36588.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
           pyogenes MGAS2096]
 gi|94548472|gb|ABF38518.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
           pyogenes MGAS10750]
 gi|304431059|gb|EFM34066.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
           pyogenes ATCC 10782]
          Length = 114

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 45/91 (49%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M I   +V+ +A  S++S  E +   F   L+  + ++E ++EV+ EGV    ++   K 
Sbjct: 15  MKISEEEVRHVAKLSKLSFSESETTTFATTLSKIVDMVELLNEVDTEGVAITTTMADKKN 74

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
           V R DV  +G     +  N P  E +F  VP
Sbjct: 75  VMRQDVAEEGTDRALLFKNVPEKENHFIKVP 105


>gi|118474805|ref|YP_892304.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Campylobacter
          fetus subsp. fetus 82-40]
 gi|166198854|sp|A0RQ21|GATC_CAMFF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|118414031|gb|ABK82451.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Campylobacter
          fetus subsp. fetus 82-40]
          Length = 95

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 53/95 (55%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   ++++   S + I +++   F  +L   +  ++ ++E++++G+E  VS +    
Sbjct: 1  MQIDDKMLEKLEKLSALKIPDQNREEFKSQLGKIVDFVDILNELDLDGIEATVSTIGGGT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D+  +G  ++ IL++AP  +  +F VPK +E
Sbjct: 61 PFREDISKEGSVIDGILTHAPKKQNRYFEVPKIIE 95


>gi|251783230|ref|YP_002997535.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          dysgalactiae subsp. equisimilis GGS_124]
 gi|28810483|dbj|BAC63420.1| putative Glu-tRNA Gln amidotransferase subunit C [Streptococcus
          pyogenes SSI-1]
 gi|242391862|dbj|BAH82321.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          dysgalactiae subsp. equisimilis GGS_124]
          Length = 104

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  S++S  E +   F   L+  + ++E ++EV+ EGV    ++   K 
Sbjct: 5  MKISEEEVRHVAKLSKLSFSESETTTFATTLSKIVDMVELLNEVDTEGVAITTTMADKKN 64

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V R DV  +G     +  N P  E +F  VP
Sbjct: 65 VMRQDVAEEGTDRALLFKNVPEKENHFIKVP 95


>gi|227832934|ref|YP_002834641.1| aspartyl/glutamyl-tRNA [Corynebacterium aurimucosum ATCC 700975]
 gi|262182577|ref|ZP_06041998.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Corynebacterium aurimucosum ATCC 700975]
 gi|254790993|sp|C3PFU9|GATC_CORA7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|227453950|gb|ACP32703.1| aspartyl/glutamyl-tRNA [Corynebacterium aurimucosum ATCC 700975]
          Length = 100

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ EE++  F  +++  +  +  + +V  EGVEPM     +    R DV
Sbjct: 8  EVAHLAKLSRLALSEEELKQFAAQIDEIVDSVSAVGKVEAEGVEPMSHPHSVHAPMREDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  L  AP  + + F+VP+
Sbjct: 68 VVRTLTAEQALDQAPAADDDRFMVPQ 93


>gi|15675616|ref|NP_269790.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pyogenes M1 GAS]
 gi|21911077|ref|NP_665345.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pyogenes MGAS315]
 gi|71911321|ref|YP_282871.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pyogenes MGAS5005]
 gi|139473212|ref|YP_001127927.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pyogenes str. Manfredo]
 gi|161486355|ref|NP_801587.2| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pyogenes SSI-1]
 gi|161761303|ref|YP_060820.2| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pyogenes MGAS10394]
 gi|162139076|ref|YP_597241.2| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pyogenes MGAS9429]
 gi|162139125|ref|YP_601132.2| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pyogenes MGAS2096]
 gi|162139177|ref|YP_603062.2| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pyogenes MGAS10750]
 gi|57013841|sp|P68890|GATC_STRP1 RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|57013842|sp|P68891|GATC_STRP3 RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|57015311|sp|Q5XAC6|GATC_STRP6 RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C;
          Short=Glu-ADT subunit C
 gi|166218185|sp|A2RCV6|GATC_STRPG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|13622823|gb|AAK34511.1| putative Glu-tRNA Gln amidotransferase subunit C [Streptococcus
          pyogenes M1 GAS]
 gi|21905286|gb|AAM80148.1| putative glutamyl tRNA-Gln amidotransferase, subunit C
          [Streptococcus pyogenes MGAS315]
 gi|71854103|gb|AAZ52126.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          pyogenes MGAS5005]
 gi|134271458|emb|CAM29679.1| glutamyl-tRNA amidotransferase subunit C [Streptococcus pyogenes
          str. Manfredo]
 gi|322412607|gb|EFY03515.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          dysgalactiae subsp. dysgalactiae ATCC 27957]
 gi|323127955|gb|ADX25252.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          dysgalactiae subsp. equisimilis ATCC 12394]
          Length = 100

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  S++S  E +   F   L+  + ++E ++EV+ EGV    ++   K 
Sbjct: 1  MKISEEEVRHVAKLSKLSFSESETTTFATTLSKIVDMVELLNEVDTEGVAITTTMADKKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V R DV  +G     +  N P  E +F  VP
Sbjct: 61 VMRQDVAEEGTDRALLFKNVPEKENHFIKVP 91


>gi|227548043|ref|ZP_03978092.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Corynebacterium lipophiloflavum DSM 44291]
 gi|227079897|gb|EEI17860.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Corynebacterium lipophiloflavum DSM 44291]
          Length = 99

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V RIA  +RI++ +E++     +L++ +  + K+ +V+ EGV PM     +    R DV
Sbjct: 8  EVSRIARLARIALSDEELDQIAPQLDHIVDAVSKVRQVDTEGVTPMSHPHSIDAGMRKDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
                 +  L  AP VE+  FVVP+
Sbjct: 68 EKRTLTQKQALDQAPAVEEERFVVPQ 93


>gi|21674647|ref|NP_662712.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Chlorobium
          tepidum TLS]
 gi|39931591|sp|Q8KBF4|GATC_CHLTE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|21647850|gb|AAM73054.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Chlorobium tepidum
          TLS]
          Length = 95

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 45/94 (47%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DV  IA  +R+   + +       LN  L  +EK++ ++ EGVEP+ ++     
Sbjct: 1  MSVTTKDVAYIAELARLKFTDAEQEKMASELNMILHYIEKLNGIDTEGVEPLSTIHDQIN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R DV       +  L NAP  +  FF VPK +
Sbjct: 61 VLRADVEHTPLSNDEALKNAPDSQDRFFKVPKVI 94


>gi|300933654|ref|ZP_07148910.1| Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase C subunit
          [Corynebacterium resistens DSM 45100]
          Length = 101

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 46/90 (51%), Gaps = 4/90 (4%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMV----SVVPMKMVH 62
          DV  +A  +R+ + E+++  F  +++  +  +  I EV+ EGVEP+     +V   + V 
Sbjct: 8  DVAHLAKLARLKLSEDELEHFATQIDGIVDHVAAIREVDTEGVEPLSHPTQNVDGTESVM 67

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R DVV      E  L  AP  E   F+VP+
Sbjct: 68 REDVVIPSLTAEQALDQAPAAEDQRFMVPQ 97


>gi|19746724|ref|NP_607860.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pyogenes MGAS8232]
 gi|39931598|sp|Q8NZL9|GATC_STRP8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|19748950|gb|AAL98359.1| putative Glu-tRNA Gln amidotransferase subunit C [Streptococcus
          pyogenes MGAS8232]
          Length = 100

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  S++S  E +   F   L+  + ++E ++EV+ EGV    ++   K 
Sbjct: 1  MKISEEEVRHVAKLSKLSFSESETTAFATTLSKIVDMVELLNEVDTEGVAITTTMADKKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V R DV  +G     +  N P  E +F  VP
Sbjct: 61 VMRQDVAEEGTDRALLFKNVPEKENHFIKVP 91


>gi|306818982|ref|ZP_07452699.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Mobiluncus
          mulieris ATCC 35239]
 gi|304648175|gb|EFM45483.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Mobiluncus
          mulieris ATCC 35239]
          Length = 98

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 44/90 (48%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          ID  +V+R+A  +RI++ E++I      L      + K+SEV    V      +P+  V 
Sbjct: 4  IDAEEVRRVASLARIALTEDEIIKIAADLGVISDAVAKVSEVATPDVPATSHPIPLTNVW 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R D+V      +  L+ APH E   F VP+
Sbjct: 64 REDIVGPTLDHDETLAQAPHPEAGMFGVPQ 93


>gi|145593770|ref|YP_001158067.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Salinispora
          tropica CNB-440]
 gi|189045175|sp|A4X489|GATC_SALTO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|145303107|gb|ABP53689.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Salinispora tropica CNB-440]
          Length = 101

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 42/86 (48%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ EE++     +L+  L  + ++ EV    + P    VP+  V R DV
Sbjct: 8  EVAHLARLSRLAVTEEELDTLAGQLDVILQAVAQVGEVTAADIPPTSHSVPLTNVLRDDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  LS AP   +  F VP+
Sbjct: 68 VASCLTPEEALSGAPDAAEQRFRVPR 93


>gi|78706916|ref|NP_001027263.1| CG33649 [Drosophila melanogaster]
 gi|28380354|gb|AAO41185.1| CG33649 [Drosophila melanogaster]
          Length = 148

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 6   VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RP 64
           +D K I    R+S+ + D    L  L +++   +KI+ +N E V P+ +V+  + +  R 
Sbjct: 54  IDTKTIQLLERLSLVDLDSERALATLKSSIQFADKIAHINTEHVRPLYTVLEHQQLQLRN 113

Query: 65  DVVCDGDKVESILSNAPHVEKNFFVVP 91
           D V +GD    +L NA   ++++FV P
Sbjct: 114 DQVTEGDCRAEVLRNAKVTDEDYFVSP 140


>gi|15895929|ref|NP_349278.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Clostridium
          acetobutylicum ATCC 824]
 gi|15025701|gb|AAK80618.1|AE007764_10 Glu-tRNAGln amidotransferase subunit C [Clostridium
          acetobutylicum ATCC 824]
 gi|325510081|gb|ADZ21717.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Clostridium
          acetobutylicum EA 2018]
          Length = 99

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 52/89 (58%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ +A  +R+S  EE    F+  LN+ L  ++K+SE++ + V+ +V+   ++   R D 
Sbjct: 11 DVEYVAELARLSFSEEQKEGFMEDLNSILGYVDKLSELDTDNVDIIVNPYYIENKFREDE 70

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V +   ++ ++ NAP   + + VVPK ++
Sbjct: 71 VEESMDLKDVIKNAPKNLEEYIVVPKIID 99


>gi|317401315|gb|EFV81953.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Achromobacter xylosoxidans C54]
          Length = 102

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 49/100 (49%), Gaps = 9/100 (9%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVS------ 54
          M ++  DV RIA  +RI +  +        LN  L ++E++  V+ +GVEP+        
Sbjct: 1  MALNDTDVARIARLARIELTPDQRGHAQAELNGILHLIERLQAVDTQGVEPLAHPLSAHE 60

Query: 55 --VVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
            V+ ++     +   +  + E +L+NAP  +   F+VPK
Sbjct: 61 DIVLRLRQDAVTETASEARRAE-LLANAPDAQDGLFLVPK 99


>gi|53717829|ref|YP_106815.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Burkholderia
          pseudomallei K96243]
 gi|52208243|emb|CAH34174.1| glutamyl-tRNA amidotransferase subunit C [Burkholderia
          pseudomallei K96243]
          Length = 97

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 47/95 (49%), Gaps = 4/95 (4%)

Query: 5  VVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMV----SVVPMKM 60
          + DV RIAH +R+ + + D    L +LN    ++E++  V+  G+ P+      ++ +  
Sbjct: 3  LTDVTRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVDTTGIAPLAHPIEQILEVAQ 62

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V +    +     AP V+   ++VPK +E
Sbjct: 63 RLREDAVTEHVNRDDNQRPAPAVQDGLYLVPKVIE 97


>gi|18202284|sp|P58251|GATC1_CLOAB RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C 1;
          Short=Glu-ADT subunit C 1
          Length = 95

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 52/89 (58%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ +A  +R+S  EE    F+  LN+ L  ++K+SE++ + V+ +V+   ++   R D 
Sbjct: 7  DVEYVAELARLSFSEEQKEGFMEDLNSILGYVDKLSELDTDNVDIIVNPYYIENKFREDE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V +   ++ ++ NAP   + + VVPK ++
Sbjct: 67 VEESMDLKDVIKNAPKNLEEYIVVPKIID 95


>gi|309812237|ref|ZP_07705995.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Dermacoccus sp.
          Ellin185]
 gi|308433924|gb|EFP57798.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Dermacoccus sp.
          Ellin185]
          Length = 98

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 45/86 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +RI + ++++  F  +L++ +  +  +SEV  + + PM   +P+  V R D 
Sbjct: 8  EVAHVAGLARIQLSDDELETFAGQLDSIVGFVASVSEVAADDIPPMSHPLPLTNVTRADE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  L+ AP  E+  F VP+
Sbjct: 68 VRASLSAEEALAMAPASEQQRFAVPR 93


>gi|169632547|ref|YP_001706283.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acinetobacter baumannii SDF]
 gi|169151339|emb|CAP00055.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acinetobacter baumannii]
          Length = 104

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 47/93 (50%)

Query: 3   IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
           ++   V  IA+ +R+S+ +     +   LN  L ++E +  ++ EGVEP+ S        
Sbjct: 12  LNAQTVSAIANLARLSLNDTQSAEYAQSLNKILGMMETLKGIDTEGVEPLKSPFDNPQPL 71

Query: 63  RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           R DVV + +  +   + AP  +   ++VP+ +E
Sbjct: 72  RADVVTESNHRDEYQAVAPVTQDGLYLVPRVIE 104


>gi|116628319|ref|YP_820938.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          thermophilus LMD-9]
 gi|161611281|ref|YP_140045.2| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          thermophilus LMG 18311]
 gi|161936364|ref|YP_141972.2| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          thermophilus CNRZ1066]
 gi|228477316|ref|ZP_04061954.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          salivarius SK126]
 gi|296875907|ref|ZP_06899967.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          parasanguinis ATCC 15912]
 gi|312863572|ref|ZP_07723810.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Streptococcus vestibularis F0396]
 gi|312868414|ref|ZP_07728614.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Streptococcus parasanguinis F0405]
 gi|322373559|ref|ZP_08048095.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus sp.
          C150]
 gi|322390134|ref|ZP_08063668.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          parasanguinis ATCC 903]
 gi|322516181|ref|ZP_08069114.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          vestibularis ATCC 49124]
 gi|122267086|sp|Q03J80|GATC_STRTD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|116101596|gb|ABJ66742.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Streptococcus thermophilus LMD-9]
 gi|228251335|gb|EEK10506.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          salivarius SK126]
 gi|296433069|gb|EFH18856.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          parasanguinis ATCC 15912]
 gi|311096159|gb|EFQ54403.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Streptococcus parasanguinis F0405]
 gi|311101108|gb|EFQ59313.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Streptococcus vestibularis F0396]
 gi|312278942|gb|ADQ63599.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Streptococcus thermophilus ND03]
 gi|321143165|gb|EFX38609.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          parasanguinis ATCC 903]
 gi|321278601|gb|EFX55670.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus sp.
          C150]
 gi|322125357|gb|EFX96712.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          vestibularis ATCC 49124]
          Length = 100

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 45/95 (47%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++    E+   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLKFSPEETAEFATTLSKIVDMVELLEEVDTTGVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V RPDV   G   + +  N P  +  +  VP  +E
Sbjct: 61 VLRPDVAEKGTDRDRLFKNVPEKDNYYIKVPAILE 95


>gi|266622512|ref|ZP_06115447.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
           hathewayi DSM 13479]
 gi|288865767|gb|EFC98065.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
           hathewayi DSM 13479]
          Length = 109

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 49/105 (46%), Gaps = 12/105 (11%)

Query: 3   IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
           ID   ++ +   +++ + E +       +   L  ++K++E++ +GVEPM  + P+  V 
Sbjct: 5   IDDATIEYVGILAKLELSESEKEDAKKDMGRMLDYIDKLNELDTDGVEPMTHIFPVTNVF 64

Query: 63  RPDVVCDG------------DKVESILSNAPHVEKNFFVVPKAVE 95
           R D V +             D  E+ L NAP  +   F VPK VE
Sbjct: 65  REDTVREAADSYDTTGEHSSDGRENTLKNAPEQKNGAFKVPKTVE 109


>gi|317132071|ref|YP_004091385.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Ethanoligenens
          harbinense YUAN-3]
 gi|315470050|gb|ADU26654.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Ethanoligenens
          harbinense YUAN-3]
          Length = 96

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 46/89 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          D++RIA  ++I + +E+  +    L   +  ++ +S+++  GVEPM  V+ +  V R D 
Sbjct: 6  DIERIARLAQIELSDEEKAVLEHDLTAVIGYMDVLSKIDTTGVEPMEHVLGLSNVLRTDK 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
                   +L  AP  E  ++ VP AVE
Sbjct: 66 PVPSYDRARLLGCAPKTEDGYYDVPLAVE 94


>gi|288931334|ref|YP_003435394.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Ferroglobus
          placidus DSM 10642]
 gi|288893582|gb|ADC65119.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Ferroglobus
          placidus DSM 10642]
          Length = 93

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 1/94 (1%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          ++D   V  +A  ++I ++E+++  F       L   +K+ E++ + V P   V+P+K V
Sbjct: 1  MVDRSTVLHVAELAKIELREDEVEKFARDFKKILEFFDKLDEIDPD-VPPTYHVLPLKNV 59

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           R D   +    E +L NA H E+ +F  PK VE
Sbjct: 60 FRKDEPKESLPRELVLMNAKHKEEGYFKGPKVVE 93


>gi|302343341|ref|YP_003807870.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfarculus
          baarsii DSM 2075]
 gi|301639954|gb|ADK85276.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfarculus
          baarsii DSM 2075]
          Length = 94

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 45/94 (47%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V ++A  +R+ + E    +   ++N+ L  ++K+ E++  GV      + +  
Sbjct: 1  MKISAEEVAQVAALARLKLDEAMTTMLTEQMNDILGYMDKLGELDTSGVPATNHALTLTG 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
            RPD +      +  L+NAP      FVVP+ +
Sbjct: 61 AMRPDQIAPSLARDEALANAPRGNGESFVVPRVI 94


>gi|73668421|ref|YP_304436.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Methanosarcina
          barkeri str. Fusaro]
 gi|72395583|gb|AAZ69856.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Methanosarcina barkeri str. Fusaro]
          Length = 93

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 42/86 (48%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ I   +RI I E++    + +LN+ L    ++ E+  E V P   V  +  V R DV
Sbjct: 6  DVEHIGWLARIDISEQETVEHMEKLNSVLGYFGQLDELPTEDVAPTYHVAEIHNVFRDDV 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V +    E +L N  H +   F VPK
Sbjct: 66 VEECLPQEVVLENTEHKQDGAFRVPK 91


>gi|332529928|ref|ZP_08405879.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Hylemonella gracilis
           ATCC 19624]
 gi|332040625|gb|EGI77000.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Hylemonella gracilis
           ATCC 19624]
          Length = 110

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 49/110 (44%), Gaps = 15/110 (13%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM-------- 52
           M +   D+ RIA  +R+ +   +      R+N   +++E++  V+  G+EP+        
Sbjct: 1   MSLTSADITRIASLARLELSPAEGERMRERINGFFAIVEQMRAVDTTGIEPLSHPTMAAA 60

Query: 53  -------VSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
                         +  R D   + ++ E+   +AP VE+  F+VPK +E
Sbjct: 61  YQAAGRQAETAQAALRLREDRASEANQREANQRSAPAVERGLFLVPKVIE 110


>gi|326381524|ref|ZP_08203218.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Gordonia
          neofelifaecis NRRL B-59395]
 gi|326199771|gb|EGD56951.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Gordonia
          neofelifaecis NRRL B-59395]
          Length = 103

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ + ++  +  +L   LS + +ISEV  + V P      ++ V R DV
Sbjct: 13 EVAHLARLSRLALDDAELDTYSSQLEKILSHVAQISEVAADDVPPTAHPADLRDVLREDV 72

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V         LS AP VE+  F VP+
Sbjct: 73 VVPSLTAAEALSGAPAVEQERFAVPQ 98


>gi|55737588|gb|AAV61230.1| glutamyl-tRNA Gln amidotransferase subunit C [Streptococcus
           thermophilus LMG 18311]
 gi|55739516|gb|AAV63157.1| glutamyl-tRNA Gln amidotransferase subunit C [Streptococcus
           thermophilus CNRZ1066]
          Length = 111

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 45/95 (47%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M I   +V  +A+ S++    E+   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 12  MKITQEEVTHVANLSKLKFSPEETAEFATTLSKIVDMVELLEEVDTTGVAPTTTMADRKT 71

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           V RPDV   G   + +  N P  +  +  VP  +E
Sbjct: 72  VLRPDVAEKGTDRDRLFKNVPEKDNYYIKVPAILE 106


>gi|108757153|ref|YP_629719.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Myxococcus xanthus
          DK 1622]
 gi|122389895|sp|Q1DCA4|GATC_MYXXD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|108461033|gb|ABF86218.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Myxococcus
          xanthus DK 1622]
          Length = 95

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 45/95 (47%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + +  V+ +A  +R+S+  E+   F  +L+  L  +E++  ++VE VEP         
Sbjct: 1  MALTLEQVRHVATLARLSLTPEEEQRFTTQLSAVLDAVEQLQSLDVEAVEPTSHATLTSS 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DV       E  L+NAP      F VPK +E
Sbjct: 61 RLREDVTRPSLPPEKSLANAPAKSDTSFAVPKIIE 95


>gi|57168537|ref|ZP_00367670.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Campylobacter
          coli RM2228]
 gi|305432954|ref|ZP_07402112.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Campylobacter coli
          JV20]
 gi|57020042|gb|EAL56719.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Campylobacter
          coli RM2228]
 gi|304444108|gb|EFM36763.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Campylobacter coli
          JV20]
          Length = 95

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 52/95 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   + ++   S + I+EE     +  L+  ++ +EK++E+++   E  +S +    
Sbjct: 1  MQIDEKLLSKLEKLSALQIEEEKRSEVICELSEIVNFVEKLNELDLSSSEVTISTIKGGA 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D V   + VE++L++AP    +FF+VPK +E
Sbjct: 61 PFRSDSVNSSNVVETVLNHAPKSNDHFFIVPKIIE 95


>gi|291166518|gb|EFE28564.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Filifactor alocis
          ATCC 35896]
          Length = 95

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 45/94 (47%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M+ID   +  ++H S++ I +E     L  L   L  +  + E + E  E   +V+ ++ 
Sbjct: 1  MVIDKKVLDYMSHLSKLKIDDEKQEEMLESLEKILGYISSLEECDTENTEITYNVLGLEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V R D +      E IL NAP  E   F+VPK +
Sbjct: 61 VMRDDTITPSFDREDILKNAPSKEAGCFIVPKVL 94


>gi|94544593|gb|ABF34641.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          pyogenes MGAS10270]
          Length = 104

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  S++S  E +   F   L+  + ++E ++EV+ EGV    ++   K 
Sbjct: 5  MKISEEEVRHVAKLSKLSFSESETTTFATTLSKIVDMVELLNEVDTEGVAITTTMADKKN 64

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V R D+  +G     +  N P  E +F  VP
Sbjct: 65 VMRQDIAEEGTDRALLFKNVPEKENHFIKVP 95


>gi|257869255|ref|ZP_05648908.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          gallinarum EG2]
 gi|257803419|gb|EEV32241.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          gallinarum EG2]
          Length = 101

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I    VK +A  +++S  ++++  F  +L   + ++E + EV+ EGV    +V     
Sbjct: 1  MAISEEQVKHVAKLAKLSFSDDELHEFTSQLGKIIDMVETLEEVDTEGVPFTSNVAETIN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V R D+  +G   + ++ N P  E  F  VP
Sbjct: 61 VMREDIAAEGWNRQELMRNVPESEDGFIKVP 91


>gi|193213755|ref|YP_001994954.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Chloroherpeton
          thalassium ATCC 35110]
 gi|229487463|sp|B3QSB6|GATC_CHLT3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|193087232|gb|ACF12507.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Chloroherpeton
          thalassium ATCC 35110]
          Length = 95

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 48/94 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DV+ IA  +R+S  E++       LN  L  +EK++E++ E VE + ++     
Sbjct: 1  MSVTKQDVEYIATLARLSFSEDEKEKMTKELNTILHYVEKLNELDTEEVEALNNMNERHN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V RPD +    +    + NAP   + FF VPK +
Sbjct: 61 VLRPDEIVASIENSKAIKNAPDSVERFFKVPKVI 94


>gi|261338707|ref|ZP_05966591.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bifidobacterium
          gallicum DSM 20093]
 gi|270276261|gb|EFA22115.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bifidobacterium
          gallicum DSM 20093]
          Length = 98

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 41/86 (47%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          ++  + + +RI++ E +I      LN     +  + EV  E V+P  + VP++   RPDV
Sbjct: 8  EIMHLGNLARIALTEGEIDRMRGELNVIADSINMVQEVATEDVQPTANPVPLEAYLRPDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
                 E  LS AP  E   FV P+
Sbjct: 68 AAKPLTQEQALSGAPVKEHGMFVAPQ 93


>gi|162139100|ref|YP_599185.2| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pyogenes MGAS10270]
 gi|209559885|ref|YP_002286357.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pyogenes NZ131]
 gi|229487556|sp|B5XI00|GATC_STRPZ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|209541086|gb|ACI61662.1| Aspartyl-tRNA(Asn) amidotransferase subunit C [Streptococcus
          pyogenes NZ131]
          Length = 100

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  S++S  E +   F   L+  + ++E ++EV+ EGV    ++   K 
Sbjct: 1  MKISEEEVRHVAKLSKLSFSESETTTFATTLSKIVDMVELLNEVDTEGVAITTTMADKKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V R D+  +G     +  N P  E +F  VP
Sbjct: 61 VMRQDIAEEGTDRALLFKNVPEKENHFIKVP 91


>gi|157129128|ref|XP_001655301.1| hypothetical protein AaeL_AAEL011360 [Aedes aegypti]
 gi|108872342|gb|EAT36567.1| conserved hypothetical protein [Aedes aegypti]
          Length = 178

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 6   VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVV-PMKMVHRP 64
           VD + +    R+S+ + D       L +++    +I  ++ +GVEP+ +V+   K+  R 
Sbjct: 75  VDDQTVQLLERLSLVDLDSKEAHRTLEDSIEFASRILAIDTDGVEPLYTVLEKQKLALRE 134

Query: 65  DVVCDGDKVESILSNAPHVEKNFFVVP 91
           DVV DG+  E +LSNA   E+ +FV P
Sbjct: 135 DVVSDGNLQEDVLSNARITEEEYFVAP 161


>gi|284928631|ref|YP_003421153.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [cyanobacterium UCYN-A]
 gi|284809090|gb|ADB94795.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [cyanobacterium UCYN-A]
          Length = 97

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 49/91 (53%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +++   +++IAH +R++I  ++   F  +L + +   E ++E++ E V P +  + +K +
Sbjct: 1  MLNNQQIRKIAHLARLNIDPKEEEKFASQLGDVIKHFEMLNELDTEKVIPTIHAIELKNI 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R DV       + +L  AP  E  FF VPK
Sbjct: 61 TRDDVSQTCMNRDLLLEEAPSREGEFFKVPK 91


>gi|57340010|gb|AAW49992.1| hypothetical protein FTT0019 [synthetic construct]
          Length = 128

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 44/88 (50%)

Query: 8   VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
           VK IA  S   + EE +  +   L N   +L+ +   + +GV+PM+S + +    R D+ 
Sbjct: 32  VKHIAKLSCFDLTEEQLEQYTKDLINICKILDTVKNFDAQGVKPMISPISVDFKFREDIP 91

Query: 68  CDGDKVESILSNAPHVEKNFFVVPKAVE 95
            D D   S    A  V  ++F+VP+ V+
Sbjct: 92  QDQDNRTSFDKFACEVVDDYFMVPQVVK 119


>gi|321453219|gb|EFX64477.1| hypothetical protein DAPPUDRAFT_36393 [Daphnia pulex]
          Length = 101

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 45/88 (51%), Gaps = 2/88 (2%)

Query: 6  VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH--R 63
          +D K I H  R+S+ +      + RL   +    +I  V+   V+P+++V+  + +   R
Sbjct: 4  IDSKTIEHLERLSLVDFANREGIRRLEEAIQFANQIHSVDTSAVKPLINVLYEEYIQSLR 63

Query: 64 PDVVCDGDKVESILSNAPHVEKNFFVVP 91
           D V +GD  E ILSNA   E+ +F  P
Sbjct: 64 EDCVTEGDIREEILSNATVTEEEYFFAP 91


>gi|300172818|ref|YP_003771983.1| aspartyl/glutamyl-tRNA(asn/Gln) amidotransferase subunit C
          [Leuconostoc gasicomitatum LMG 18811]
 gi|299887196|emb|CBL91164.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Leuconostoc gasicomitatum LMG 18811]
          Length = 102

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 46/85 (54%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A+ ++++  + ++  F  +L+N L++ + + EVN +GV P  SV       R DV
Sbjct: 10 EVAHVANLAKLAFDDAELVQFTTQLDNILNIFDTLGEVNTDGVAPTYSVTENVNHLREDV 69

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
            +  + +++L NAP    +   VP
Sbjct: 70 ADNWHQKQALLKNAPLEAADLIKVP 94


>gi|183602744|ref|ZP_02964107.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium animalis subsp. lactis HN019]
 gi|241191490|ref|YP_002968884.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium animalis subsp. lactis Bl-04]
 gi|241196895|ref|YP_002970450.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium animalis subsp. lactis DSM 10140]
 gi|183217982|gb|EDT88630.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium animalis subsp. lactis HN019]
 gi|240249882|gb|ACS46822.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium animalis subsp. lactis Bl-04]
 gi|240251449|gb|ACS48388.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium animalis subsp. lactis DSM 10140]
 gi|295794482|gb|ADG34017.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium animalis subsp. lactis V9]
          Length = 87

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 38/82 (46%)

Query: 11 IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
          +   +RI++ +E+I      LN     ++ + EV    VEP  + VP++   RPDV    
Sbjct: 1  MGDLARIALTDEEITRMQSELNVIADAIDSVQEVATADVEPTANPVPLEAYLRPDVPATP 60

Query: 71 DKVESILSNAPHVEKNFFVVPK 92
                LS AP  E   FV P+
Sbjct: 61 LTQAEALSGAPVAEDGMFVAPR 82


>gi|56707199|ref|YP_169095.1| Glu-tRNAGln amidotransferase C subunit [Francisella tularensis
          subsp. tularensis SCHU S4]
 gi|89257103|ref|YP_514465.1| Glu-tRNAGln amidotransferase C subunit [Francisella tularensis
          subsp. holarctica LVS]
 gi|110669669|ref|YP_666226.1| Glu-tRNAGln amidotransferase C subunit [Francisella tularensis
          subsp. tularensis FSC198]
 gi|115315459|ref|YP_764182.1| Glu-tRNAGln amidotransferase C subunit [Francisella tularensis
          subsp. holarctica OSU18]
 gi|134301236|ref|YP_001121204.1| Glu-tRNAGln amidotransferase C subunit [Francisella tularensis
          subsp. tularensis WY96-3418]
 gi|156503316|ref|YP_001429381.1| Glu-tRNAGln amidotransferase subunit C [Francisella tularensis
          subsp. holarctica FTNF002-00]
 gi|167009495|ref|ZP_02274426.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Francisella
          tularensis subsp. holarctica FSC200]
 gi|187930978|ref|YP_001890962.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Francisella
          tularensis subsp. mediasiatica FSC147]
 gi|224456260|ref|ZP_03664733.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Francisella
          tularensis subsp. tularensis MA00-2987]
 gi|254368336|ref|ZP_04984354.1| glu-tRNAgln amidotransferase C subunit [Francisella tularensis
          subsp. holarctica 257]
 gi|254371415|ref|ZP_04987416.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Francisella
          tularensis subsp. tularensis FSC033]
 gi|254874039|ref|ZP_05246749.1| glu-tRNAGln amidotransferase C subunit [Francisella tularensis
          subsp. tularensis MA00-2987]
 gi|290952977|ref|ZP_06557598.1| Glu-tRNAGln amidotransferase C subunit [Francisella tularensis
          subsp. holarctica URFT1]
 gi|295313797|ref|ZP_06804370.1| Glu-tRNAGln amidotransferase C subunit [Francisella tularensis
          subsp. holarctica URFT1]
 gi|56603691|emb|CAG44652.1| Glu-tRNAGln amidotransferase C subunit [Francisella tularensis
          subsp. tularensis SCHU S4]
 gi|89144934|emb|CAJ80282.1| Glu-tRNAGln amidotransferase C subunit [Francisella tularensis
          subsp. holarctica LVS]
 gi|110320002|emb|CAL08035.1| Glu-tRNAGln amidotransferase C subunit [Francisella tularensis
          subsp. tularensis FSC198]
 gi|115130358|gb|ABI83545.1| aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit C
          [Francisella tularensis subsp. holarctica OSU18]
 gi|134049013|gb|ABO46084.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Francisella
          tularensis subsp. tularensis WY96-3418]
 gi|134254144|gb|EBA53238.1| glu-tRNAgln amidotransferase C subunit [Francisella tularensis
          subsp. holarctica 257]
 gi|151569654|gb|EDN35308.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Francisella
          tularensis subsp. tularensis FSC033]
 gi|156253919|gb|ABU62425.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Francisella tularensis subsp. holarctica FTNF002-00]
 gi|187711887|gb|ACD30184.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Francisella
          tularensis subsp. mediasiatica FSC147]
 gi|254840038|gb|EET18474.1| glu-tRNAGln amidotransferase C subunit [Francisella tularensis
          subsp. tularensis MA00-2987]
 gi|282158307|gb|ADA77698.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Francisella
          tularensis subsp. tularensis NE061598]
          Length = 93

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 44/88 (50%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK IA  S   + EE +  +   L N   +L+ +   + +GV+PM+S + +    R D+ 
Sbjct: 6  VKHIAKLSCFDLTEEQLEQYTKDLINICKILDTVKNFDAQGVKPMISPISVDFKFREDIP 65

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           D D   S    A  V  ++F+VP+ V+
Sbjct: 66 QDQDNRTSFDKFACEVVDDYFMVPQVVK 93


>gi|224283601|ref|ZP_03646923.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium bifidum NCIMB 41171]
 gi|310288137|ref|YP_003939396.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bifidobacterium bifidum S17]
 gi|311065010|ref|YP_003971736.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit C GatC
          [Bifidobacterium bifidum PRL2010]
 gi|309252074|gb|ADO53822.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bifidobacterium bifidum S17]
 gi|310867330|gb|ADP36699.1| GatC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bifidobacterium bifidum PRL2010]
          Length = 99

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 41/86 (47%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +++ +   +RI++ +E+I      LN     + K+ EV  + V P  + VP++   RPDV
Sbjct: 8  EIEHLGDLARIALTDEEITRLQGELNVIADSINKVQEVAGDDVPPTANPVPLEAYLRPDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
                 E  L+  P  E   FV P+
Sbjct: 68 AETPLTQEEALAGGPKTEAGMFVAPR 93


>gi|226951649|ref|ZP_03822113.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acinetobacter sp. ATCC 27244]
 gi|294651326|ref|ZP_06728647.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Acinetobacter
           haemolyticus ATCC 19194]
 gi|226837630|gb|EEH70013.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Acinetobacter sp. ATCC 27244]
 gi|292822798|gb|EFF81680.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 116

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 46/93 (49%)

Query: 3   IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
           ++   V +IA+ +R+S+ +     +   LN  L ++E +  +N + VEP+ S        
Sbjct: 24  LNAQTVSQIANLARLSLNDTQSAEYAQSLNKILGMMESLKGINTDDVEPLKSPFDNPQPL 83

Query: 63  RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           R D V + +  +   + AP  E   ++VP+ +E
Sbjct: 84  RTDAVTESNHRDEYQAIAPATEAGLYLVPRVIE 116


>gi|302537080|ref|ZP_07289422.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Streptomyces sp. C]
 gi|302445975|gb|EFL17791.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Streptomyces sp. C]
          Length = 98

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +K E++  F  +L++ +  + ++SEV  + V P    +P+  V R D 
Sbjct: 8  EVAHLARLARLELKSEELDHFAGQLDDIIGAVARVSEVADQDVPPTSHPLPLTNVMRADE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  LS AP  E+  F VP+
Sbjct: 68 VRPSLTPEQALSGAPAQEQQRFKVPQ 93


>gi|237744366|ref|ZP_04574847.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium sp.
          7_1]
 gi|256027785|ref|ZP_05441619.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium sp.
          D11]
 gi|260494081|ref|ZP_05814212.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Fusobacterium sp.
          3_1_33]
 gi|289765738|ref|ZP_06525116.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium sp.
          D11]
 gi|229431595|gb|EEO41807.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium sp.
          7_1]
 gi|260198227|gb|EEW95743.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Fusobacterium sp.
          3_1_33]
 gi|289717293|gb|EFD81305.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium sp.
          D11]
          Length = 96

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 51/94 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   +V +IA  S++S +E++I  F + LN+ L  ++ ++EV+   V+P+V +     
Sbjct: 1  MALTKEEVLKIAKLSKLSFEEKEIEKFQIELNDILKYIDMLNEVDTSEVKPLVYINEAVN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
            R        K+E +L NAP   +N  VVPK +
Sbjct: 61 NFREKEEKPSLKIEKVLLNAPESAENAIVVPKVI 94


>gi|313140752|ref|ZP_07802945.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Bifidobacterium bifidum NCIMB 41171]
 gi|313133262|gb|EFR50879.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Bifidobacterium bifidum NCIMB 41171]
          Length = 109

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 41/86 (47%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           +++ +   +RI++ +E+I      LN     + K+ EV  + V P  + VP++   RPDV
Sbjct: 18  EIEHLGDLARIALTDEEITRLQGELNVIADSINKVQEVAGDDVPPTANPVPLEAYLRPDV 77

Query: 67  VCDGDKVESILSNAPHVEKNFFVVPK 92
                  E  L+  P  E   FV P+
Sbjct: 78  AETPLTQEEALAGGPKTEAGMFVAPR 103


>gi|297243155|ref|ZP_06927093.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Gardnerella
          vaginalis AMD]
 gi|298253224|ref|ZP_06977016.1| aspartyl/glutamyl-tRNA amidotransferase C subunit [Gardnerella
          vaginalis 5-1]
 gi|296889366|gb|EFH28100.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Gardnerella
          vaginalis AMD]
 gi|297532619|gb|EFH71505.1| aspartyl/glutamyl-tRNA amidotransferase C subunit [Gardnerella
          vaginalis 5-1]
          Length = 98

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 42/86 (48%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +++ +   S+I++ +E+I      LN     + K+ EV  E V P  + VP++   RPD 
Sbjct: 8  EIEHLGVLSQIALSDEEISRLQGELNVIAESINKVQEVAGEDVPPTANPVPLEAYLRPDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
                 E  LS+AP  E   FV P+
Sbjct: 68 PATPLTQEEALSDAPRSESGMFVAPR 93


>gi|319778948|ref|YP_004129861.1| Aspartyl-tRNA(Asn),Glutamyl-tRNA(Gln) amidotransferase subunit C
           [Taylorella equigenitalis MCE9]
 gi|317108972|gb|ADU91718.1| Aspartyl-tRNA(Asn),Glutamyl-tRNA(Gln) amidotransferase subunit C
           [Taylorella equigenitalis MCE9]
          Length = 102

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 50/102 (49%), Gaps = 7/102 (6%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMK- 59
           M I+  D+ RIA  +R+ +  E      + LN   S++E +  V  EGVEP+   + +  
Sbjct: 1   MSIESSDITRIARLARLDLDSEAQNQLKVELNKMFSLIETLQSVETEGVEPLSHPLSLNQ 60

Query: 60  ---MVHRPDVVCDG---DKVESILSNAPHVEKNFFVVPKAVE 95
              +  R D + +    ++ E +++NA       F+VPK +E
Sbjct: 61  SITLRLREDEITETASIEQREKLMANASAKSNGLFLVPKVIE 102


>gi|219683156|ref|YP_002469539.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium animalis subsp. lactis AD011]
 gi|254790986|sp|B8DSI4|GATC_BIFA0 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|219620806|gb|ACL28963.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bifidobacterium animalis subsp. lactis AD011]
          Length = 98

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 38/82 (46%)

Query: 11 IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
          +   +RI++ +E+I      LN     ++ + EV    VEP  + VP++   RPDV    
Sbjct: 12 LGDLARIALTDEEITRMQSELNVIADAIDSVQEVATADVEPTANPVPLEAYLRPDVPATP 71

Query: 71 DKVESILSNAPHVEKNFFVVPK 92
                LS AP  E   FV P+
Sbjct: 72 LTQAEALSGAPVAEDGMFVAPR 93


>gi|260892974|ref|YP_003239071.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Ammonifex degensii
          KC4]
 gi|260865115|gb|ACX52221.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Ammonifex
          degensii KC4]
          Length = 93

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 51/88 (57%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ +A  +R+ + EE+  LF  +L   +  +  + E+  + V P+V VVP+K V R D 
Sbjct: 6  EVEHVAALARLELSEEEKELFARQLGKIIEYVNTLQELPTDDVPPLVHVVPLKNVWREDK 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V +  +VE +LS AP  E+ FF V + V
Sbjct: 66 VEEHLEVEKVLSRAPDREERFFRVSRVV 93


>gi|291407044|ref|XP_002719837.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase, subunit C homolog
           [Oryctolagus cuniculus]
          Length = 136

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCD 69
           I H  R+++ +      + RL   ++  +++ +V+ +GVEPM SV+  + ++ R D V +
Sbjct: 37  IEHLERLALVDFGSQEAVARLEKAIAFADRLRQVDTDGVEPMESVLEDRCLYLRSDNVVE 96

Query: 70  GDKVESILSNAPHVEKNFFVVP 91
           G+  E +L N+  V + +FV P
Sbjct: 97  GNCAEELLQNSHRVVEEYFVAP 118


>gi|295426518|ref|ZP_06819168.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Lactobacillus
          amylolyticus DSM 11664]
 gi|295063886|gb|EFG54844.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Lactobacillus
          amylolyticus DSM 11664]
          Length = 102

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV- 66
          VK +A  SR+   +++I  F  ++ + +++  ++ EV+ EGV+  V VV    V R D  
Sbjct: 8  VKHVATLSRLEFGDDEIGKFTEQMGSIINMASQLQEVDTEGVDETVQVVDRDTVFREDKP 67

Query: 67 -VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
              G+  E+++ N P     F  VP  +E
Sbjct: 68 EHWQGEDRETLMKNVPEKANGFIKVPVIIE 97


>gi|195472721|ref|XP_002088648.1| GE11394 [Drosophila yakuba]
 gi|194174749|gb|EDW88360.1| GE11394 [Drosophila yakuba]
          Length = 148

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 46/87 (52%), Gaps = 1/87 (1%)

Query: 6   VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RP 64
           +D K I    R+S+ + D    L  L +++    KI+ +N E V P+ +V+  + +  R 
Sbjct: 54  IDTKTIQLLERLSLVDLDSERALATLKSSIQFANKIAHINTEHVRPLYTVLEQQQLQLRN 113

Query: 65  DVVCDGDKVESILSNAPHVEKNFFVVP 91
           D V +GD    +L NA   +++++V P
Sbjct: 114 DQVTEGDCRAEVLRNAKVTDEDYYVSP 140


>gi|29829288|ref|NP_823922.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptomyces
          avermitilis MA-4680]
 gi|39931487|sp|Q82JK9|GATC_STRAW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|29606395|dbj|BAC70457.1| putative aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit
          C [Streptomyces avermitilis MA-4680]
          Length = 98

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +K E++  F  +L++ +  + ++SEV  + V P    +P+  V R D 
Sbjct: 8  EVAHLARLARLELKAEELDHFAGQLDDIIGAVARVSEVADQDVPPTSHPLPLTNVMRADE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  LS AP  E+  F VP+
Sbjct: 68 VRPSLTPEQALSGAPAQEQQRFKVPQ 93


>gi|283782617|ref|YP_003373371.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Gardnerella
          vaginalis 409-05]
 gi|308234786|ref|ZP_07665523.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Gardnerella
          vaginalis ATCC 14018]
 gi|311113953|ref|YP_003985174.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Gardnerella
          vaginalis ATCC 14019]
 gi|283441495|gb|ADB13961.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Gardnerella
          vaginalis 409-05]
 gi|310945447|gb|ADP38151.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Gardnerella
          vaginalis ATCC 14019]
          Length = 98

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 41/86 (47%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +++ +   S+I++ +E+I      LN     + K+ EV  E V P  + VP++   RPD 
Sbjct: 8  EIEHLGVLSQIALSDEEISRLQGELNVIAESINKVQEVAGEDVPPTANPVPLEAYLRPDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
                 E  LS AP  E   FV P+
Sbjct: 68 PATPLTQEEALSGAPRSESGMFVAPR 93


>gi|152965285|ref|YP_001361069.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Kineococcus
          radiotolerans SRS30216]
 gi|189045166|sp|A6W7L6|GATC_KINRD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|151359802|gb|ABS02805.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Kineococcus
          radiotolerans SRS30216]
          Length = 99

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ +A  +RI + +E++     +L+  L  + +++ V  + V      VP+  V RPDV
Sbjct: 8  EVEHLARLARIDMTDEELDRMAGQLDAVLDAVAQVASVVTDDVPATSHPVPLTNVTRPDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V  G   E  L+ AP  E   F VP+
Sbjct: 68 VRPGLTAEEALAGAPASEDGRFRVPQ 93


>gi|320008424|gb|ADW03274.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptomyces
          flavogriseus ATCC 33331]
          Length = 98

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +K E++  F  +L++ +  + ++SEV  + V P    +P+  V R D 
Sbjct: 8  EVAHLARLARLELKGEELEHFAGQLDDIIGAVARVSEVADQDVPPTSHPLPLTNVMRADE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  LS AP  E+  F VP+
Sbjct: 68 VRPSLTPEQALSGAPAQEQQRFKVPQ 93


>gi|67459520|ref|YP_247144.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Rickettsia felis
           URRWXCal2]
 gi|75536073|sp|Q4UKF2|GATC_RICFE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit C; Short=Asp/Glu-ADT subunit C
 gi|67005053|gb|AAY61979.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Rickettsia felis
           URRWXCal2]
          Length = 100

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 54/95 (56%), Gaps = 6/95 (6%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           + ++IA  +R+  +E+ +  F  +L+  +++++ ++E++ + +EP+ SV  M +  R DV
Sbjct: 6   EAQKIAKLARLKFEEDTVEKFSAQLSTIMNMIDILNEIDCKDIEPLTSVSNMNVRMREDV 65

Query: 67  VCDGD----KVESILSNAPHVEK--NFFVVPKAVE 95
           V   D      +++  N+  + K   +F+ PK +E
Sbjct: 66  VTSSDLSNKLFDNVSGNSAQLAKEVKYFITPKVIE 100


>gi|94263757|ref|ZP_01287564.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [delta
          proteobacterium MLMS-1]
 gi|93455857|gb|EAT06020.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [delta
          proteobacterium MLMS-1]
          Length = 95

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 46/94 (48%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I    ++++   +R+ I +E++     +L   L  +EK++E++   VEP+   + +  
Sbjct: 1  MQISEEQIRQVGRLARLEIGDEELTTLSGQLTTILGYVEKMNELDTSQVEPVSHALAVVN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
            R D V      E  L+NAP      F+VPK V
Sbjct: 61 AFREDEVMPSLPREEALANAPAATDEAFIVPKVV 94


>gi|328885213|emb|CCA58452.1| Aspartyl-tRNA(Asn) amidotransferase subunit C @
          Glutamyl-tRNA(Gln) amidotransferase subunit C
          [Streptomyces venezuelae ATCC 10712]
          Length = 98

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +K E++  F  +L++ +  + ++SEV  + V P    +P+  V R D 
Sbjct: 8  EVAHLARLARLELKGEELDHFAGQLDDIIGAVARVSEVADQDVPPTSHPLPLTNVMRADE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  LS AP  E+  F VP+
Sbjct: 68 VRPSLTPEQALSGAPAQEQQRFKVPQ 93


>gi|319951544|ref|ZP_08025348.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Dietzia
          cinnamea P4]
 gi|319434792|gb|EFV90108.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Dietzia
          cinnamea P4]
          Length = 99

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV  +A  SR+ + + ++  F  +L + L  ++ +SEV  + V  M     +  V+R DV
Sbjct: 8  DVAHLARLSRLELSDAELDSFAQQLTDILDHVQAVSEVAADDVPAMSHPTAITNVYRDDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V  G   E  L  AP  ++  F VP+
Sbjct: 68 VTPGLTPEQALDQAPASDEQRFEVPQ 93


>gi|295397186|ref|ZP_06807289.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Aerococcus viridans
           ATCC 11563]
 gi|294974575|gb|EFG50299.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Aerococcus viridans
           ATCC 11563]
          Length = 107

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 46/95 (48%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M I   +VKRIA  ++  +++ED+  F     N L+++E++ E++   V PM   V  + 
Sbjct: 7   MSISEEEVKRIAKLAKFKVEDEDVVHFTEEFGNILNMIEELQEIDTTDVAPMFWAVDFEN 66

Query: 61  VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           V R D V      + +  NA      F  VP  ++
Sbjct: 67  VMREDKVVKMQTRDELFINAKTTVDGFIEVPSIID 101


>gi|297202537|ref|ZP_06919934.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptomyces
          sviceus ATCC 29083]
 gi|197709935|gb|EDY53969.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptomyces
          sviceus ATCC 29083]
          Length = 98

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +K E++  F  +L++ +  + ++SEV  + V P    +P+  V R D 
Sbjct: 8  EVAHLARLARLELKPEELEHFAGQLDDIIGAVARVSEVADQDVPPTSHPLPLTNVMRADE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  LS AP  E+  F VP+
Sbjct: 68 VRPSLTPEQALSGAPAQEQQRFKVPQ 93


>gi|94264762|ref|ZP_01288541.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [delta
          proteobacterium MLMS-1]
 gi|93454808|gb|EAT05061.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [delta
          proteobacterium MLMS-1]
          Length = 95

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 46/94 (48%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I    ++++   +R+ I +E++     +L   L  +EK++E++   VEP+   + +  
Sbjct: 1  MRISEEQIRQVGRLARLEIGDEELTTLSGQLTTILGYVEKMNELDTSQVEPVSHALAVVN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
            R D V      E  L+NAP      F+VPK V
Sbjct: 61 AFREDEVMPSLPREEALANAPAATDEAFIVPKVV 94


>gi|116873189|ref|YP_849970.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          welshimeri serovar 6b str. SLCC5334]
 gi|123461158|sp|A0AJK9|GATC_LISW6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|116742067|emb|CAK21191.1| glutamyl-tRNA(Gln) amidotransferase; subunit C [Listeria
          welshimeri serovar 6b str. SLCC5334]
          Length = 97

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 47/88 (53%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+++A+ +++ + E++   F  +L   + ++E+++ ++   VEP    + +  V R DV 
Sbjct: 9  VEKVANLAKLEVSEKEATAFAGQLGKIIELVEQLNTLDTNNVEPTSHAIDVSNVLREDVA 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
            G   + +L NAP  +   F VP  +E
Sbjct: 69 TKGLDRKEVLKNAPDEQDGMFKVPTIME 96


>gi|298244962|ref|ZP_06968768.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Ktedonobacter
          racemifer DSM 44963]
 gi|297552443|gb|EFH86308.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Ktedonobacter
          racemifer DSM 44963]
          Length = 96

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 48/94 (51%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   V  +A+ +R+++ EE++ LF  +L+  L  ++ + E +V GV P      +  V
Sbjct: 1  MIDRETVMNVANLARLALSEEEVTLFGSQLSAILEHIQILQEADVSGVSPTAHASRLTNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           R D        E +L+NAP  E+N   V   +E
Sbjct: 61 MRLDAPQPSCSPEELLANAPDQEENSLKVNAVLE 94


>gi|198473285|ref|XP_002133229.1| GA29066 [Drosophila pseudoobscura pseudoobscura]
 gi|198139387|gb|EDY70631.1| GA29066 [Drosophila pseudoobscura pseudoobscura]
          Length = 148

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 6   VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RP 64
           +D K I    R+S+   D    L  LN+++   +KI+ +N E V P+ +V+  + +  R 
Sbjct: 54  IDAKTIQLLERLSLVNLDSEQALATLNSSIQFADKIAHINTENVRPLYTVLENQQLQLRN 113

Query: 65  DVVCDGDKVESILSNAPHVEKNFFVVP 91
           D V +GD    +L NA   +++++V P
Sbjct: 114 DEVKEGDCRVELLRNAKVTDEDYYVSP 140


>gi|297570604|ref|YP_003691948.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfurivibrio
          alkaliphilus AHT2]
 gi|296926519|gb|ADH87329.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfurivibrio
          alkaliphilus AHT2]
          Length = 94

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (47%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I    V  +A  +R+ ++ ++I    + L+  L  + K+ +++  GVEP+   + +  
Sbjct: 1  MQIGSDKVAEMARLARLELESDEIKALTVELSGILEYVAKLQQLDTTGVEPVSHALAVVN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
            R D V      E  L+NAP      FVVPK
Sbjct: 61 AFREDEVAPSLSREEALANAPAATGEAFVVPK 92


>gi|16800934|ref|NP_471202.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          innocua Clip11262]
 gi|20138252|sp|Q92AQ2|GATC_LISIN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|16414369|emb|CAC97098.1| glutamyl-tRNA(Gln) amidotransferase (subunit C) [Listeria innocua
          Clip11262]
 gi|313618394|gb|EFR90420.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Listeria innocua
          FSL S4-378]
 gi|313623348|gb|EFR93575.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Listeria innocua
          FSL J1-023]
          Length = 97

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 46/88 (52%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+++A+ +++ + E +   F  +L   + ++E+++ ++   VEP    + +  V R DV 
Sbjct: 9  VEKVANLAKLEVSETEATAFAGQLGKIIELVEQLNTLDTNNVEPTSHAIDVSNVLREDVA 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
            G   + +L NAP  +   F VP  +E
Sbjct: 69 TKGLDRKEVLKNAPDQQDGMFKVPTIME 96


>gi|172058517|ref|YP_001814977.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Exiguobacterium
          sibiricum 255-15]
 gi|229487471|sp|B1YM02|GATC_EXIS2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|171991038|gb|ACB61960.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Exiguobacterium
          sibiricum 255-15]
          Length = 96

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 38/60 (63%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+ +AH +R+++ +E++  F ++L   L   E+++E++  G+EP   V+ +K V R D V
Sbjct: 9  VRHVAHLARLAVTDEEVQQFTVQLEKILGFAEQLNELDTTGIEPTTHVLDLKNVLRKDEV 68


>gi|33239717|ref|NP_874659.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Prochlorococcus marinus subsp. marinus str. CCMP1375]
 gi|39931410|sp|Q7VDV3|GATC_PROMA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|33237242|gb|AAP99311.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit
          [Prochlorococcus marinus subsp. marinus str. CCMP1375]
          Length = 97

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 46/86 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV++++  +R+ I EE +  +  +L   L  + ++ +++ + + P    V +  V R D+
Sbjct: 8  DVRKVSKLARLEISEEHVETYANQLEEILEYIAQLEKIDTKNIPPTTRAVEVVNVLREDI 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V   +  + IL  AP+ E  F+ VPK
Sbjct: 68 VDKSNVRDKILDLAPNREGQFYRVPK 93


>gi|269123151|ref|YP_003305728.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptobacillus
          moniliformis DSM 12112]
 gi|268314477|gb|ACZ00851.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptobacillus
          moniliformis DSM 12112]
          Length = 98

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 49/88 (55%), Gaps = 6/88 (6%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMK---MVHR 63
          +V ++A  S++S ++ ++  F   LN+    +E ++E+N+E VEP+ +++  +     H 
Sbjct: 6  EVVKLAKLSKLSFEKNELEAFQKDLNDIFKYMESLNELNLENVEPLYNILENEGKIYKHE 65

Query: 64 PDVVCDGDKVESILSNAPHVEKNFFVVP 91
          P +  D    +  L NAP  ++NF  +P
Sbjct: 66 PKIEMDK---KMFLENAPKNDENFISIP 90


>gi|298674975|ref|YP_003726725.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Methanohalobium
          evestigatum Z-7303]
 gi|298287963|gb|ADI73929.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methanohalobium
          evestigatum Z-7303]
          Length = 93

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 42/82 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ +   +RI I E+D   +  +LN+ L+  E++ EV+ E V P   V+ +  V R DV
Sbjct: 6  DVEHVGWLARIEIDEKDADEYASQLNDVLNHFEQLDEVDTENVPPTYHVIDLVNVFREDV 65

Query: 67 VCDGDKVESILSNAPHVEKNFF 88
            +    +  L N    ++ +F
Sbjct: 66 ARESLTQDKALENTSSSKEGYF 87


>gi|119717659|ref|YP_924624.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Nocardioides sp. JS614]
 gi|119538320|gb|ABL82937.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Nocardioides sp. JS614]
          Length = 102

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 43/86 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A+ +RI + + ++     +L+  L  +  IS V    V P    +P+  V R DV
Sbjct: 11 EVAHLANLARIDLSDAELDQLAPQLSVILESVASISGVAGAEVPPTSHALPLTNVFREDV 70

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V  G   E  LS AP VE+  F VP+
Sbjct: 71 VVPGLTPEQALSGAPEVEQQRFSVPR 96


>gi|226226952|ref|YP_002761058.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Gemmatimonas aurantiaca T-27]
 gi|226090143|dbj|BAH38588.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Gemmatimonas aurantiaca T-27]
          Length = 107

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 44/88 (50%), Gaps = 6/88 (6%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGV--EPMVSVVPMKMVHRP 64
          DV+ +A  +R+ + E  IP  +  LN  L+ ++ + +V+V GV   P     P+    RP
Sbjct: 7  DVRHVATLARLGLAEPQIPALVQELNGILAHMDVLQQVDVSGVPLTPPDQAAPL----RP 62

Query: 65 DVVCDGDKVESILSNAPHVEKNFFVVPK 92
          D       V S  S AP +   FF+VP+
Sbjct: 63 DARPADALVRSRESFAPAMRDGFFLVPR 90


>gi|50756673|ref|XP_415269.1| PREDICTED: similar to 15E1.2 (novel protein) [Gallus gallus]
          Length = 151

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 4   DVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH- 62
           D V V+ + H  R+++ +      + RL   +   E++ EVN EG+EP+ SV+  + ++ 
Sbjct: 44  DSVTVEVLDHLERLALVDFRDAEGVERLREAVRFAERLREVNTEGIEPLDSVLEDRCLYL 103

Query: 63  RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
           R D V +G+    +L NA    + +FV P
Sbjct: 104 REDDVTEGNCTAELLKNAREKVEEYFVAP 132


>gi|160893122|ref|ZP_02073910.1| hypothetical protein CLOL250_00668 [Clostridium sp. L2-50]
 gi|156865205|gb|EDO58636.1| hypothetical protein CLOL250_00668 [Clostridium sp. L2-50]
          Length = 95

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 43/82 (52%)

Query: 14 FSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKV 73
           +++ + +E+       +++ L  + K++E++ E VE M        V R D V +GD  
Sbjct: 14 LAKLELSDEEKEQAKKDMSDMLDYVSKLNELDTENVEAMSHTFSYNNVFREDEVTNGDDR 73

Query: 74 ESILSNAPHVEKNFFVVPKAVE 95
          E++LSNAP  +   + VP+  +
Sbjct: 74 ENMLSNAPEQKDGCYKVPRTFD 95


>gi|77408274|ref|ZP_00785017.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          agalactiae COH1]
 gi|77173132|gb|EAO76258.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          agalactiae COH1]
          Length = 100

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 47/95 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +AH S++   +++   F   L+  + ++E ++EV+ EGV    ++   K 
Sbjct: 1  MKISEEEVRHVAHLSKLRFSDQETKEFASSLSKIVDMIELLNEVDTEGVPVTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D+   G   + +  N P  +  +  VP  +E
Sbjct: 61 VMREDIAQPGHNRDDLFKNVPQHQDYYIKVPAILE 95


>gi|78485970|ref|YP_391895.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thiomicrospira
          crunogena XCL-2]
 gi|123555204|sp|Q31F52|GATC_THICR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|78364256|gb|ABB42221.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Thiomicrospira crunogena XCL-2]
          Length = 95

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 49/97 (50%), Gaps = 4/97 (4%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ++  +V  I+  + IS+   ++     +++N L + +++  V+   VEPM    P+  
Sbjct: 1  MSLEKTEVDTISRLAAISVDASEVDQLTAKISNVLDLFQRMEAVDTTNVEPMSH--PLDQ 58

Query: 61 VHR--PDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R   DVV + D  E     AP  EK  ++VP+ ++
Sbjct: 59 VQRLREDVVTETDHHEEYQKLAPAAEKGMYLVPQVID 95


>gi|289435093|ref|YP_003464965.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Listeria
          seeligeri serovar 1/2b str. SLCC3954]
 gi|289171337|emb|CBH27879.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Listeria
          seeligeri serovar 1/2b str. SLCC3954]
 gi|313632853|gb|EFR99804.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Listeria
          seeligeri FSL N1-067]
 gi|313637417|gb|EFS02881.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Listeria
          seeligeri FSL S4-171]
          Length = 97

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 46/88 (52%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+++A+ +++ + E +   F  +L   + ++E+++ ++   VEP    + +  V R DV 
Sbjct: 9  VEKVANLAKLEVSENEATAFAGQLGKIIELVEQLNTLDTSNVEPTSHAIDVSNVLREDVA 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
            G   + +L NAP  +   F VP  +E
Sbjct: 69 TKGLDRKEVLKNAPDEQDGMFKVPTIME 96


>gi|195164758|ref|XP_002023213.1| GL21081 [Drosophila persimilis]
 gi|194105298|gb|EDW27341.1| GL21081 [Drosophila persimilis]
          Length = 173

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 6   VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RP 64
           +D K I    R+S+   D    L  LN+++   +KI+ +N E V P+ +V+  + +  R 
Sbjct: 79  IDAKTIQLLERLSLVNLDSEQALATLNSSIQFADKIAHINTENVRPLYTVLENQQLQLRN 138

Query: 65  DVVCDGDKVESILSNAPHVEKNFFVVP 91
           D V +GD    +L NA   +++++V P
Sbjct: 139 DEVKEGDCRVELLRNAKVTDEDYYVSP 165


>gi|73995309|ref|XP_534705.2| PREDICTED: similar to CG33084-PB, isoform B [Canis familiaris]
          Length = 136

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 6   VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RP 64
           V  + I H  R+++ +      + RL   ++  +++  V+  GVEPM SV+  + ++ R 
Sbjct: 32  VSAQVIEHLERLALVDFGSQEAVARLEKAIAFADRLRAVDTGGVEPMESVLEDRCLYLRS 91

Query: 65  DVVCDGDKVESILSNAPHVEKNFFVVP 91
           D V +G+  E +L NA  V + +FV P
Sbjct: 92  DNVVEGNCAEELLQNAHRVVEEYFVAP 118


>gi|227893043|ref|ZP_04010848.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
           ultunensis DSM 16047]
 gi|227865156|gb|EEJ72577.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Lactobacillus
           ultunensis DSM 16047]
          Length = 113

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 8   VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV- 66
           +K +A  SR++  EE++  F  ++ + +++ +++SEV+ +GV+  V VV    V R D  
Sbjct: 19  IKHVATLSRLAFNEEELDKFTDQMGSIINMADQLSEVDTKGVDETVQVVDRDTVLREDKP 78

Query: 67  -VCDGDKVESILSNAPHVEKNFFVVP 91
               G   +++++N P     +  VP
Sbjct: 79  EHWQGQNRDTLMANVPEKANGYIKVP 104


>gi|315303633|ref|ZP_07874168.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Listeria ivanovii
          FSL F6-596]
 gi|313627996|gb|EFR96594.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Listeria ivanovii
          FSL F6-596]
          Length = 97

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 46/88 (52%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+++A+ +++ + E +   F  +L   + ++E+++ ++   VEP    + +  V R DV 
Sbjct: 9  VEKVANLAKLEVSENEATAFAGQLGKIIELVEQLNTLDTSNVEPTSHAIEVSNVLREDVA 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
            G   + +L NAP  +   F VP  +E
Sbjct: 69 TKGLDRKEVLKNAPDEQDGMFKVPTIME 96


>gi|162139395|ref|YP_280962.2| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          pyogenes MGAS6180]
          Length = 100

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  S++S  E +   F   L+  + ++E ++EV+ EGV    ++   K 
Sbjct: 1  MKISEEEVRHVAKLSKLSFLESETTTFATTLSKIVDMVELLNEVDTEGVAITTTMADKKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V R D+  +G     +  N P  E +F  VP
Sbjct: 61 VMRQDIAEEGTDRALLFKNVPEKENHFIKVP 91


>gi|69246830|ref|ZP_00604139.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium DO]
 gi|227551667|ref|ZP_03981716.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Enterococcus
          faecium TX1330]
 gi|257878461|ref|ZP_05658114.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium 1,230,933]
 gi|257882880|ref|ZP_05662533.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium 1,231,502]
 gi|257884413|ref|ZP_05664066.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium 1,231,501]
 gi|257887197|ref|ZP_05666850.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium 1,141,733]
 gi|257889342|ref|ZP_05668995.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium 1,231,410]
 gi|257894354|ref|ZP_05674007.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium 1,231,408]
 gi|257895733|ref|ZP_05675386.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium Com12]
 gi|257898304|ref|ZP_05677957.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium Com15]
 gi|258616017|ref|ZP_05713787.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Enterococcus
          faecium DO]
 gi|260560048|ref|ZP_05832226.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium C68]
 gi|261207463|ref|ZP_05922149.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium TC 6]
 gi|289565874|ref|ZP_06446315.1| aspartyl-tRNA(Asn) amidotransferase subunit C [Enterococcus
          faecium D344SRF]
 gi|293377658|ref|ZP_06623847.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium PC4.1]
 gi|293557126|ref|ZP_06675680.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium E1039]
 gi|293559998|ref|ZP_06676506.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium E1162]
 gi|293569136|ref|ZP_06680443.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium E1071]
 gi|293571851|ref|ZP_06682867.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium E980]
 gi|294614138|ref|ZP_06694059.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium E1636]
 gi|294618096|ref|ZP_06697693.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Enterococcus
          faecium E1679]
 gi|294621041|ref|ZP_06700233.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium U0317]
 gi|314937826|ref|ZP_07845143.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium TX0133a04]
 gi|314941628|ref|ZP_07848508.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium TX0133C]
 gi|314948875|ref|ZP_07852244.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium TX0082]
 gi|314951007|ref|ZP_07854074.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium TX0133A]
 gi|314993008|ref|ZP_07858404.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium TX0133B]
 gi|314996455|ref|ZP_07861498.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium TX0133a01]
 gi|68195063|gb|EAN09525.1| Glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium DO]
 gi|227179230|gb|EEI60202.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Enterococcus
          faecium TX1330]
 gi|257812689|gb|EEV41447.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium 1,230,933]
 gi|257818538|gb|EEV45866.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium 1,231,502]
 gi|257820251|gb|EEV47399.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium 1,231,501]
 gi|257823251|gb|EEV50183.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium 1,141,733]
 gi|257825702|gb|EEV52328.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium 1,231,410]
 gi|257830733|gb|EEV57340.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium 1,231,408]
 gi|257832298|gb|EEV58719.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium Com12]
 gi|257836216|gb|EEV61290.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium Com15]
 gi|260073883|gb|EEW62207.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium C68]
 gi|260078354|gb|EEW66059.1| glutamyl-tRNA(Gln) amidotransferase C subunit [Enterococcus
          faecium TC 6]
 gi|289162334|gb|EFD10193.1| aspartyl-tRNA(Asn) amidotransferase subunit C [Enterococcus
          faecium D344SRF]
 gi|291588183|gb|EFF20024.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium E1071]
 gi|291592988|gb|EFF24576.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium E1636]
 gi|291595668|gb|EFF26964.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Enterococcus
          faecium E1679]
 gi|291599355|gb|EFF30380.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium U0317]
 gi|291600695|gb|EFF30993.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium E1039]
 gi|291606086|gb|EFF35512.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium E1162]
 gi|291608105|gb|EFF37411.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium E980]
 gi|292643658|gb|EFF61779.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium PC4.1]
 gi|313589437|gb|EFR68282.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium TX0133a01]
 gi|313592531|gb|EFR71376.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium TX0133B]
 gi|313596862|gb|EFR75707.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium TX0133A]
 gi|313599519|gb|EFR78362.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium TX0133C]
 gi|313642857|gb|EFS07437.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium TX0133a04]
 gi|313644665|gb|EFS09245.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enterococcus
          faecium TX0082]
          Length = 101

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 44/91 (48%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I    VK +A  ++++  +E++  F  +L   + ++E + EV+ EGV    +VV    
Sbjct: 1  MAISEEQVKHVAKLAKLAFADEELASFTDQLGKIIDMVEMLEEVDTEGVPFTSNVVETVN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V R D    G   + +L N P  E  F  VP
Sbjct: 61 VMRQDRAQAGWNRDELLKNVPETEDGFIKVP 91


>gi|189485137|ref|YP_001956078.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [uncultured
          Termite group 1 bacterium phylotype Rs-D17]
 gi|170287096|dbj|BAG13617.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [uncultured
          Termite group 1 bacterium phylotype Rs-D17]
          Length = 98

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 48/90 (53%), Gaps = 2/90 (2%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +++  A  +RI IKE++   +L  L+     +E + E ++  +EP   V  ++ V R DV
Sbjct: 5  ELETTAFLARIHIKEDEKEKYLADLSMMFDYIEILHEPDIADLEPTTHVTKIRNVWREDV 64

Query: 67 V--CDGDKVESILSNAPHVEKNFFVVPKAV 94
          V  C  + +E +L +AP  E  F+ + K +
Sbjct: 65 VKPCPKEIIEQMLDSAPAKEGTFYKIKKVI 94


>gi|222479266|ref|YP_002565503.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Halorubrum
           lacusprofundi ATCC 49239]
 gi|222452168|gb|ACM56433.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Halorubrum
           lacusprofundi ATCC 49239]
          Length = 111

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 7/86 (8%)

Query: 8   VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEV-NVEGVEPMVSVVPMKMVHRPDV 66
           V+ +A  +R+ + ++++  F  +  + L   E + EV   +  E +V+V+      RPD 
Sbjct: 30  VRHVADLARVRLDDDEVEAFADQFGDILDYFEALDEVPETDREEELVNVM------RPDE 83

Query: 67  VCDGDKVESILSNAPHVEKNFFVVPK 92
           V +G   E  LSNA   E  FFV PK
Sbjct: 84  VKEGLTQEEALSNAEETEDGFFVGPK 109


>gi|270291086|ref|ZP_06197309.1| aspartyl-tRNA/glutamyl-tRNA amidotransferase subunit C
          [Pediococcus acidilactici 7_4]
 gi|304385363|ref|ZP_07367708.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Pediococcus
          acidilactici DSM 20284]
 gi|270280482|gb|EFA26317.1| aspartyl-tRNA/glutamyl-tRNA amidotransferase subunit C
          [Pediococcus acidilactici 7_4]
 gi|304328570|gb|EFL95791.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Pediococcus
          acidilactici DSM 20284]
          Length = 104

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 2/86 (2%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD- 65
          DV  +A  +++ + +  +  F  +  + + ++E+++EV+   VEP  +V       R D 
Sbjct: 11 DVAHVATLAKLKLDDAQLEKFTNQFEDIIDLVEQLNEVDTTNVEPTFNVTDQLNRMREDQ 70

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVP 91
           V  GDK E++L+NAP  E  F  VP
Sbjct: 71 AVRSGDK-EALLNNAPDTEDGFIRVP 95


>gi|256845053|ref|ZP_05550511.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Fusobacterium sp.
          3_1_36A2]
 gi|256718612|gb|EEU32167.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Fusobacterium sp.
          3_1_36A2]
          Length = 96

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 49/88 (55%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V +IA  S++S +E++I  F + LN+ L  ++ ++EV+   V+P+V +       R   
Sbjct: 7  EVLKIAKLSKLSFEEKEIERFQIELNDILKYIDMLNEVDTSKVQPLVYINEAVNNFREKE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
               ++E +L NAP   +N  VVPK +
Sbjct: 67 KKLSLEIEKVLLNAPESAENAIVVPKVI 94


>gi|71803254|gb|AAX72607.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          pyogenes MGAS6180]
          Length = 104

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  S++S  E +   F   L+  + ++E ++EV+ EGV    ++   K 
Sbjct: 5  MKISEEEVRHVAKLSKLSFLESETTTFATTLSKIVDMVELLNEVDTEGVAITTTMADKKN 64

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V R D+  +G     +  N P  E +F  VP
Sbjct: 65 VMRQDIAEEGTDRALLFKNVPEKENHFIKVP 95


>gi|322391465|ref|ZP_08064934.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          peroris ATCC 700780]
 gi|321145548|gb|EFX40940.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          peroris ATCC 700780]
          Length = 100

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 43/91 (47%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++   E +   F   L+  + ++E + EV+  GV P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLKFTENETAEFATTLSKIVDMVELLEEVDTTGVVPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV   G   + +  N P  +  +  VP
Sbjct: 61 VLRPDVAEKGTDRDRLFKNVPEKDNYYIKVP 91


>gi|317486128|ref|ZP_07944973.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
          [Bilophila wadsworthia 3_1_6]
 gi|316922613|gb|EFV43854.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
          [Bilophila wadsworthia 3_1_6]
          Length = 93

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 47/88 (53%), Gaps = 3/88 (3%)

Query: 10 RIAHFSRISI---KEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          R+AH +R++    +E  +  F  +  + ++ ++ ++EV+   VEP+ S V     +R D 
Sbjct: 6  RMAHLARLARLAPEEGTLAKFGEQCADIIAYMDILAEVDTSAVEPLYSPVEHSTPYRADE 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
              +    +L+NAP  +  FFVVP+ V
Sbjct: 66 PVQKNMHSDVLANAPETDGQFFVVPRIV 93


>gi|254368954|ref|ZP_04984967.1| hypothetical protein FTAG_00783 [Francisella tularensis subsp.
          holarctica FSC022]
 gi|157121875|gb|EDO66045.1| hypothetical protein FTAG_00783 [Francisella tularensis subsp.
          holarctica FSC022]
          Length = 93

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 44/88 (50%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK IA  S   + EE +  +   L N   +L+ +   + +GV+PM+S + +    R D+ 
Sbjct: 6  VKHIAKLSCFDLTEEQLEQYTKDLINICKILDIVKNFDAQGVKPMISPISVDFKFREDIP 65

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           D D   S    A  V  ++F+VP+ V+
Sbjct: 66 QDQDNRTSFDKFACEVVDDYFMVPQVVK 93


>gi|149720533|ref|XP_001489089.1| PREDICTED: similar to glutamyl-tRNA(Gln) amidotransferase, subunit
           C homolog [Equus caballus]
          Length = 136

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCD 69
           I H  R+++ +      + RL   ++  +++  V+ +GVEPM SV+  + ++ R D V +
Sbjct: 37  IEHLERLALVDFGSQEAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDHVIE 96

Query: 70  GDKVESILSNAPHVEKNFFVVP 91
           G+  E +L N+  V + +FV P
Sbjct: 97  GNCAEELLQNSHRVVEEYFVAP 118


>gi|226310280|ref|YP_002770174.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Brevibacillus brevis NBRC 100599]
 gi|226093228|dbj|BAH41670.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Brevibacillus brevis NBRC 100599]
          Length = 96

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ +A+ +R+ + EE+   +   LN  L    K++E++   +EP      +K V R DV
Sbjct: 8  EVEHVANLARLQLTEEEAERYTKDLNAILDFAAKLNELDTSNIEPTSHATDVKNVMREDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
                 E +L NAP  E   F VP   E
Sbjct: 68 NRPSLPREDVLKNAPDHEDGQFKVPAVFE 96


>gi|116620201|ref|YP_822357.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Candidatus Solibacter usitatus Ellin6076]
 gi|122255455|sp|Q02A54|GATC_SOLUE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|116223363|gb|ABJ82072.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Candidatus Solibacter usitatus Ellin6076]
          Length = 99

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVV---P 57
          M I   +V+ +A  + +++ E++I    + L+  L  + +++E++ EGV PM  V+    
Sbjct: 1  MKITEKEVRYVAGLANLNLTEQEIARMQVDLDGILEHMARLNEIDTEGVAPMSQVLFEAE 60

Query: 58 MKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
               RPD        ++ ++NAP     +F VPK +E
Sbjct: 61 ETATLRPDSPIPPLGNQAAMANAPQSGAGYFKVPKVIE 98


>gi|195338301|ref|XP_002035763.1| GM15071 [Drosophila sechellia]
 gi|194129643|gb|EDW51686.1| GM15071 [Drosophila sechellia]
          Length = 148

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 6   VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RP 64
           +D K I    R+S+ + D    L  L +++   +KI+ +N + V P+ +V+  + +  R 
Sbjct: 54  IDTKTIQLLERLSLVDLDSERALATLKSSIQFADKIAHINTDHVRPLYTVLEHQQLQLRN 113

Query: 65  DVVCDGDKVESILSNAPHVEKNFFVVP 91
           D V +GD    +L NA   +++++V P
Sbjct: 114 DQVTEGDCRAEVLQNAKVTDEDYYVSP 140


>gi|115372366|ref|ZP_01459675.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Stigmatella
          aurantiaca DW4/3-1]
 gi|310819538|ref|YP_003951896.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit c
          [Stigmatella aurantiaca DW4/3-1]
 gi|115370579|gb|EAU69505.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Stigmatella
          aurantiaca DW4/3-1]
 gi|309392610|gb|ADO70069.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Stigmatella aurantiaca DW4/3-1]
          Length = 95

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 46/95 (48%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + +  V+ +A  +R+S+  ++   +  +L+  L  + ++ E++V GVEP         
Sbjct: 1  MKLTLEQVRHVASLARLSLSPDEERRYATQLSAVLDAVAQLQELDVSGVEPTSHATLAAS 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          + R DV       E  L+NAP      F VPK +E
Sbjct: 61 LLREDVTLPSLPAEKGLANAPSKVGTRFAVPKIIE 95


>gi|294782466|ref|ZP_06747792.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Fusobacterium sp.
          1_1_41FAA]
 gi|294481107|gb|EFG28882.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Fusobacterium sp.
          1_1_41FAA]
          Length = 96

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 48/88 (54%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V +IA  S++S +E +I  F L LN+ L  ++ ++EV+   ++P+V +  +    R   
Sbjct: 7  EVLKIAKLSKLSFEEAEIEKFQLELNDILKYIDMLNEVDTSEIQPLVHINDVVNNFRERE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
                +E +L NAP   +N  VVPK V
Sbjct: 67 EKASIDIEKVLLNAPESAENAIVVPKVV 94


>gi|16803796|ref|NP_465281.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          monocytogenes EGD-e]
 gi|46907986|ref|YP_014375.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          monocytogenes serotype 4b str. F2365]
 gi|47092909|ref|ZP_00230691.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Listeria
          monocytogenes str. 4b H7858]
 gi|47095682|ref|ZP_00233289.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Listeria
          monocytogenes str. 1/2a F6854]
 gi|217964096|ref|YP_002349774.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Listeria
          monocytogenes HCC23]
 gi|224499525|ref|ZP_03667874.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          monocytogenes Finland 1988]
 gi|224503318|ref|ZP_03671625.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          monocytogenes FSL R2-561]
 gi|226224359|ref|YP_002758466.1| glutamyl-tRNA(Gln) amidotransferase (subunit C) [Listeria
          monocytogenes Clip81459]
 gi|254825999|ref|ZP_05231000.1| glutamyl-tRNA(Gln) amidotransferase [Listeria monocytogenes FSL
          J1-194]
 gi|254829491|ref|ZP_05234178.1| glutamyl-tRNA(Gln) amidotransferase [Listeria monocytogenes FSL
          N3-165]
 gi|254832501|ref|ZP_05237156.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          monocytogenes 10403S]
 gi|254853666|ref|ZP_05243014.1| glutamyl-tRNA(Gln) amidotransferase [Listeria monocytogenes FSL
          R2-503]
 gi|254900739|ref|ZP_05260663.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          monocytogenes J0161]
 gi|254913776|ref|ZP_05263788.1| glutamyl-tRNA(Gln) amidotransferase [Listeria monocytogenes
          J2818]
 gi|254932798|ref|ZP_05266157.1| glutamyl-tRNA(Gln) amidotransferase [Listeria monocytogenes
          HPB2262]
 gi|254938163|ref|ZP_05269860.1| glutamyl-tRNA(Gln) amidotransferase [Listeria monocytogenes
          F6900]
 gi|254992261|ref|ZP_05274451.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          monocytogenes FSL J2-064]
 gi|255026040|ref|ZP_05298026.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          monocytogenes FSL J2-003]
 gi|255030822|ref|ZP_05302773.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          monocytogenes LO28]
 gi|255521023|ref|ZP_05388260.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          monocytogenes FSL J1-175]
 gi|284802200|ref|YP_003414065.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          monocytogenes 08-5578]
 gi|284995342|ref|YP_003417110.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          monocytogenes 08-5923]
 gi|290893412|ref|ZP_06556397.1| glutamyl-tRNA(Gln) amidotransferase [Listeria monocytogenes FSL
          J2-071]
 gi|300765952|ref|ZP_07075924.1| glutamyl-tRNA(Gln) amidotransferase [Listeria monocytogenes FSL
          N1-017]
 gi|20532087|sp|P58817|GATC_LISMO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|67460866|sp|Q71YR2|GATC_LISMF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|254791001|sp|B8DFG7|GATC_LISMH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|259647253|sp|C1KW55|GATC_LISMC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|16411210|emb|CAC99834.1| glutamyl-tRNA(Gln) amidotransferase (subunit C) [Listeria
          monocytogenes EGD-e]
 gi|46881256|gb|AAT04552.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Listeria
          monocytogenes serotype 4b str. F2365]
 gi|47015967|gb|EAL06893.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Listeria
          monocytogenes str. 1/2a F6854]
 gi|47018735|gb|EAL09486.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Listeria
          monocytogenes str. 4b H7858]
 gi|217333366|gb|ACK39160.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Listeria
          monocytogenes HCC23]
 gi|225876821|emb|CAS05530.1| glutamyl-tRNA(Gln) amidotransferase (subunit C) [Listeria
          monocytogenes serotype 4b str. CLIP 80459]
 gi|258601906|gb|EEW15231.1| glutamyl-tRNA(Gln) amidotransferase [Listeria monocytogenes FSL
          N3-165]
 gi|258607045|gb|EEW19653.1| glutamyl-tRNA(Gln) amidotransferase [Listeria monocytogenes FSL
          R2-503]
 gi|258610776|gb|EEW23384.1| glutamyl-tRNA(Gln) amidotransferase [Listeria monocytogenes
          F6900]
 gi|284057762|gb|ADB68703.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          monocytogenes 08-5578]
 gi|284060809|gb|ADB71748.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          monocytogenes 08-5923]
 gi|290557063|gb|EFD90592.1| glutamyl-tRNA(Gln) amidotransferase [Listeria monocytogenes FSL
          J2-071]
 gi|293584351|gb|EFF96383.1| glutamyl-tRNA(Gln) amidotransferase [Listeria monocytogenes
          HPB2262]
 gi|293591792|gb|EFG00127.1| glutamyl-tRNA(Gln) amidotransferase [Listeria monocytogenes
          J2818]
 gi|293595238|gb|EFG02999.1| glutamyl-tRNA(Gln) amidotransferase [Listeria monocytogenes FSL
          J1-194]
 gi|300513338|gb|EFK40413.1| glutamyl-tRNA(Gln) amidotransferase [Listeria monocytogenes FSL
          N1-017]
 gi|307571336|emb|CAR84515.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Listeria
          monocytogenes L99]
 gi|313608265|gb|EFR84269.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Listeria
          monocytogenes FSL F2-208]
 gi|328466508|gb|EGF37651.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          monocytogenes 1816]
 gi|328473898|gb|EGF44720.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Listeria
          monocytogenes 220]
 gi|332312196|gb|EGJ25291.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase [Listeria
          monocytogenes str. Scott A]
          Length = 97

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 46/88 (52%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+++A+ +++ + E +   F  +L   + ++E+++ ++   VEP    + +  V R DV 
Sbjct: 9  VEKVANLAKLEVSETEATAFAGQLGKIIELVEQLNTLDTTNVEPTSHAIDVSNVLREDVA 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
            G   + +L NAP  +   F VP  +E
Sbjct: 69 TKGLDRKEVLKNAPDEQDGMFKVPTIME 96


>gi|312794121|ref|YP_004027044.1| glutamyl-tRNA(Gln) amidotransferase subunit C
          [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312876333|ref|ZP_07736318.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796827|gb|EFR13171.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Caldicellulosiruptor lactoaceticus 6A]
 gi|312181261|gb|ADQ41431.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 94

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 46/89 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ +A+ +R+++ EE+I      L   +    K+S+++ + VEP   V+ +  V R D 
Sbjct: 6  DVEYVANLARLTLTEEEIEKMTKELGAIIEFANKLSDLDTKDVEPTAHVLNLYNVFRSDE 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V      E IL NAP  +     VPK VE
Sbjct: 66 VKPSYPREKILQNAPSHDDVCIKVPKIVE 94


>gi|299535242|ref|ZP_07048566.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Lysinibacillus
          fusiformis ZC1]
 gi|298729363|gb|EFI69914.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Lysinibacillus
          fusiformis ZC1]
          Length = 95

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 43/85 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +VK +A+ +R++I EE+   F  +L       E+++E++   VEP   V+P+  V R DV
Sbjct: 8  EVKHVANLARLAITEEEAEKFAEQLGKITDFAEQLNELDTTNVEPTTHVLPLVNVMREDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
             G   E ++ N    E     VP
Sbjct: 68 AVKGLDREVMMLNVKEQEDGQVKVP 92


>gi|253581559|ref|ZP_04858784.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium
          varium ATCC 27725]
 gi|251836629|gb|EES65164.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium
          varium ATCC 27725]
          Length = 96

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 45/88 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+    E+I  F + LN+ L  ++ + E+N + V+P++ V       R D 
Sbjct: 7  EVLNVAKLARLKFTPEEIEKFQVELNDILGYIDVLDEINTDEVKPLIQVNNTVNNLREDE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V +   VE  LSNAP       +VPK V
Sbjct: 67 VRESLSVEKALSNAPDSGDGAVIVPKVV 94


>gi|237740449|ref|ZP_04570930.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium sp.
          2_1_31]
 gi|229422466|gb|EEO37513.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium sp.
          2_1_31]
          Length = 96

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 49/88 (55%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V +IA  S++S +E +I  F + LN+ L  ++ ++EV+   V+P+V +  +    R   
Sbjct: 7  EVLKIAKLSKLSFEEAEIEKFQVELNDILKYIDMLNEVDTSEVQPLVHINDVVNNFREKE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
               ++E +L NAP   +N  VVPK V
Sbjct: 67 EKASIEIEKVLLNAPESAENAIVVPKVV 94


>gi|126649598|ref|ZP_01721839.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus sp.
          B14905]
 gi|126593923|gb|EAZ87846.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bacillus sp.
          B14905]
          Length = 95

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 43/85 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +VK +A+ +R++I EE+   F  +L       E+++E++   VEP   V+P+  V R DV
Sbjct: 8  EVKHVANLARLAITEEEAEKFAEQLGKITDFAEQLNELDTANVEPTTHVLPLVNVMREDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
             G   E ++ N    E     VP
Sbjct: 68 AVKGLDREVMMLNVKEQEDGQVKVP 92


>gi|291563446|emb|CBL42262.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [butyrate-producing bacterium SS3/4]
          Length = 97

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%)

Query: 31 LNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVV 90
          L   L  ++ +++++   VEP+  + P+K V R DVV +    E +L NAP  +   F+V
Sbjct: 33 LQQMLDYVDMLNQLDTSDVEPLTHIFPIKNVFREDVVLESTPKEELLKNAPKEKDGQFLV 92

Query: 91 PKAV 94
          PK +
Sbjct: 93 PKTI 96


>gi|312868875|ref|ZP_07729061.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Lactobacillus oris PB013-T2-3]
 gi|311095615|gb|EFQ53873.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Lactobacillus oris PB013-T2-3]
          Length = 105

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 46/87 (52%), Gaps = 2/87 (2%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD- 65
          +VK +A  +++   ++++  F  +L + + + E+I+  + +GVEPM +        R D 
Sbjct: 9  EVKHVAELAKLEFPQDELEQFTTQLGSIIDMFEEIANEDTDGVEPMTNATDRVNALREDK 68

Query: 66 -VVCDGDKVESILSNAPHVEKNFFVVP 91
           V    ++ +++L NAP  +  +  VP
Sbjct: 69 AVKASKEETDALLKNAPDADDGYIRVP 95


>gi|302335479|ref|YP_003800686.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Olsenella uli DSM 7084]
 gi|301319319|gb|ADK67806.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Olsenella uli DSM 7084]
          Length = 105

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 4/90 (4%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVS-VVPMKMVHRPD 65
          DV  IA ++RI++  E++      +N  + +LE I + ++EGVEP    +  +  V   D
Sbjct: 7  DVAGIADYARIALAGEELAQMTAYMNEAIELLEPIRQYDLEGVEPTFHPIGELSNVMGAD 66

Query: 66 VVCDGDK---VESILSNAPHVEKNFFVVPK 92
          VV D  +   V   L NA   +  +F VP 
Sbjct: 67 VVDDSVRALPVAVALGNAAATQGRYFRVPS 96


>gi|312133407|ref|YP_004000746.1| gatc [Bifidobacterium longum subsp. longum BBMN68]
 gi|189428504|gb|ACD98652.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit
          [Bifidobacterium longum DJO10A]
 gi|311772634|gb|ADQ02122.1| GatC [Bifidobacterium longum subsp. longum BBMN68]
          Length = 88

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%)

Query: 11 IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
          +   +RI++ +E+I      LN     + K+ EV  + V P  + VP++   RPDV    
Sbjct: 1  MGDLARIALTDEEITRLQGELNVIADSINKVQEVASDDVPPTANPVPLEAYLRPDVAETP 60

Query: 71 DKVESILSNAPHVEKNFFVVPK 92
             E  L+  P  E   FV P+
Sbjct: 61 LTQEEALAGGPKTEAGMFVAPR 82


>gi|182419418|ref|ZP_02950670.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          butyricum 5521]
 gi|237666808|ref|ZP_04526793.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          butyricum E4 str. BoNT E BL5262]
 gi|182376749|gb|EDT74321.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          butyricum 5521]
 gi|237658007|gb|EEP55562.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          butyricum E4 str. BoNT E BL5262]
          Length = 96

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 49/91 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M + V DV+ +A  +R+S  E +       LN  LS +EK+ E++ E  + +V+   ++ 
Sbjct: 1  MSVSVKDVEYVAELARLSFDESEKEGLAEDLNQILSYVEKLGELDTENEDIIVNPYYIEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
           +R DVV     ++ + SNAP   + + +VP
Sbjct: 61 KYREDVVVPSLDLKDVTSNAPDTLEEYVMVP 91


>gi|46190912|ref|ZP_00120875.2| COG0721: Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit
          [Bifidobacterium longum DJO10A]
 gi|239622605|ref|ZP_04665636.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bifidobacterium longum subsp. infantis CCUG 52486]
 gi|317482757|ref|ZP_07941769.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
          [Bifidobacterium sp. 12_1_47BFAA]
 gi|322688402|ref|YP_004208136.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium longum subsp. infantis 157F]
 gi|322690421|ref|YP_004219991.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium longum subsp. longum JCM 1217]
 gi|239514602|gb|EEQ54469.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bifidobacterium longum subsp. infantis CCUG 52486]
 gi|291517540|emb|CBK71156.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bifidobacterium longum subsp. longum F8]
 gi|316915792|gb|EFV37202.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
          [Bifidobacterium sp. 12_1_47BFAA]
 gi|320455277|dbj|BAJ65899.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium longum subsp. longum JCM 1217]
 gi|320457235|dbj|BAJ67856.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium longum subsp. infantis ATCC 15697]
 gi|320459738|dbj|BAJ70358.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium longum subsp. infantis 157F]
          Length = 101

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%)

Query: 11 IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
          +   +RI++ +E+I      LN     + K+ EV  + V P  + VP++   RPDV    
Sbjct: 14 LGDLARIALTDEEITRLQGELNVIADSINKVQEVASDDVPPTANPVPLEAYLRPDVAETP 73

Query: 71 DKVESILSNAPHVEKNFFVVPK 92
             E  L+  P  E   FV P+
Sbjct: 74 LTQEEALAGGPKTEAGMFVAPR 95


>gi|228476293|ref|ZP_04060994.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          hominis SK119]
 gi|314936045|ref|ZP_07843394.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          hominis subsp. hominis C80]
 gi|228269576|gb|EEK11082.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          hominis SK119]
 gi|313655862|gb|EFS19605.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          hominis subsp. hominis C80]
          Length = 100

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 40/85 (47%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ IAH +R+ I  E+       L + L   ++    + EGVEP   V+ ++ V R D 
Sbjct: 8  EVEHIAHLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVLRDDK 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
            +G   E  L NA   E   F VP
Sbjct: 68 AIEGIPQELALKNAKETEDGQFKVP 92


>gi|229112923|ref|YP_001955150.2| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium longum DJO10A]
 gi|229220622|ref|NP_695605.2| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium longum NCC2705]
 gi|39931588|sp|Q8G767|GATC_BIFLO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
          Length = 99

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%)

Query: 11 IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
          +   +RI++ +E+I      LN     + K+ EV  + V P  + VP++   RPDV    
Sbjct: 12 LGDLARIALTDEEITRLQGELNVIADSINKVQEVASDDVPPTANPVPLEAYLRPDVAETP 71

Query: 71 DKVESILSNAPHVEKNFFVVPK 92
             E  L+  P  E   FV P+
Sbjct: 72 LTQEEALAGGPKTEAGMFVAPR 93


>gi|294631534|ref|ZP_06710094.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptomyces sp.
          e14]
 gi|292834867|gb|EFF93216.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptomyces sp.
          e14]
          Length = 98

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +K E++  F  +L++ +  + ++SEV    V P    +P+  V R D 
Sbjct: 8  EVAHLARLARLELKPEELDHFAGQLDDIIGAVARVSEVADRDVPPTSHPLPLTNVMRADE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  LS AP  E+  F VP+
Sbjct: 68 VRPSLTPEQALSGAPAQEQQRFKVPQ 93


>gi|195953746|ref|YP_002122036.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Hydrogenobaculum
          sp. Y04AAS1]
 gi|229487512|sp|B4U5L8|GATC_HYDS0 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|195933358|gb|ACG58058.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Hydrogenobaculum
          sp. Y04AAS1]
          Length = 94

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 51/96 (53%), Gaps = 5/96 (5%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVS-VVPMK 59
          M I   +V +IA  SR+ +KE+++  F  ++ N L  + K++EV  E +E   S   P++
Sbjct: 1  MSISKEEVIKIAKLSRLELKEDEVEFFSAQIKNILEFVNKLNEVKAELLEEEYSDSTPLR 60

Query: 60 MVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
              P+   + DKV   L NAP    N F VPK V+
Sbjct: 61 K-DEPETSLEVDKV---LLNAPAKRLNMFEVPKIVD 92


>gi|78777448|ref|YP_393763.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Sulfurimonas
          denitrificans DSM 1251]
 gi|123550146|sp|Q30R53|GATC_SULDN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|78497988|gb|ABB44528.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Sulfurimonas denitrificans DSM 1251]
          Length = 96

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 1/96 (1%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D V + R+   S + I E+     + +L+  ++ +E +S ++ + V+   ++     
Sbjct: 1  MQVDDVLLSRLEKLSFLKISEDKREEIVSQLSEIVNFVENLSLLDTQNVDEKFAMSNDST 60

Query: 61 VHRPDVV-CDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D   CD    ESIL NAP    NFFVVPK +E
Sbjct: 61 FLREDTAFCDTSINESILKNAPLSSDNFFVVPKIIE 96


>gi|169335250|ref|ZP_02862443.1| hypothetical protein ANASTE_01658 [Anaerofustis stercorihominis
          DSM 17244]
 gi|169257988|gb|EDS71954.1| hypothetical protein ANASTE_01658 [Anaerofustis stercorihominis
          DSM 17244]
          Length = 94

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV   A  ++I I E+D+  +   L   L   + +  V+ E V+P+  V+ ++ V R D 
Sbjct: 7  DVLYTASLAKIDIDEKDVEAYRDTLTKQLEYAKSLDNVDTENVKPLAHVLDLENVVREDE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V +G  ++  L NAP  +     VPK
Sbjct: 67 VKEGLNIKEALQNAPDKDGRCINVPK 92


>gi|307721284|ref|YP_003892424.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Sulfurimonas autotrophica DSM 16294]
 gi|306979377|gb|ADN09412.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Sulfurimonas autotrophica DSM 16294]
          Length = 96

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 1/96 (1%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D   + R+   S + + ++     + +L+  +S ++ +SE+N EGV+   ++     
Sbjct: 1  MQVDDALLTRLEKLSFLHVSDDKRKEIVSQLSEIVSFVDNLSELNTEGVDDTFAMNDKAT 60

Query: 61 VHRPDV-VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D   CD    E IL +AP+   NFF+VPK +E
Sbjct: 61 PLREDTPHCDSSISEEILIHAPNSADNFFIVPKIIE 96


>gi|194043071|ref|XP_001928539.1| PREDICTED: gatC-like protein-like [Sus scrofa]
          Length = 136

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCD 69
           + H  R+++ +      + RL   ++  +++ +V+ +GVEPM SV+  + ++ R D V +
Sbjct: 37  VEHLERLALVDFGNQEAVARLEKAIAFADRLRDVDTDGVEPMDSVLEDRCLYLRSDNVVE 96

Query: 70  GDKVESILSNAPHVEKNFFVVP 91
           G+  E +L N+  V + +FV P
Sbjct: 97  GNCAEELLQNSHRVVEEYFVAP 118


>gi|32475327|ref|NP_868321.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Rhodopirellula
          baltica SH 1]
 gi|32445868|emb|CAD78599.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Rhodopirellula
          baltica SH 1]
          Length = 91

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%)

Query: 11 IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
          +A  +R+ + E++   F  ++ + L  +E++SE++  GVEPM S + ++   R DV    
Sbjct: 1  MARLARLQLTEQEQTDFGPQITDILGFVEQLSELDTSGVEPMTSALDVENRFRDDVPDQS 60

Query: 71 DKVESILSNAPHVEKNFFVVP 91
             E     AP  +   F+VP
Sbjct: 61 LSAEVATRTAPASQDGTFLVP 81


>gi|260833610|ref|XP_002611805.1| hypothetical protein BRAFLDRAFT_270748 [Branchiostoma floridae]
 gi|229297177|gb|EEN67814.1| hypothetical protein BRAFLDRAFT_270748 [Branchiostoma floridae]
          Length = 149

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 6   VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RP 64
           +D   IAH  R+++ +      + RL   +   +++  V+  GVEPM SV+  + ++ R 
Sbjct: 49  IDQDTIAHLERLALVDFANKEGIRRLEAAIRFADQMFLVDTTGVEPMDSVLEDRELYLRD 108

Query: 65  DVVCDGDKVESILSNAPHVEKNFFVVP 91
           DVV +G+  + IL NA  V +++FV P
Sbjct: 109 DVVTEGNCKDDILRNAGKVVEDYFVAP 135


>gi|195579086|ref|XP_002079393.1| GD22036 [Drosophila simulans]
 gi|194191402|gb|EDX04978.1| GD22036 [Drosophila simulans]
          Length = 148

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 6   VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RP 64
           +D K I    R+S+ + D    L  L +++   +KI+ +N + V P+ +V+  + +  R 
Sbjct: 54  IDTKTIQLLERLSLVDLDSERALATLKSSIQFADKIAHINTDHVRPLYTVLEHQQLQLRN 113

Query: 65  DVVCDGDKVESILSNAPHVEKNFFVVP 91
           D V +GD    +L NA   +++++V P
Sbjct: 114 DQVTEGDCRAEVLRNAKVTDEDYYVSP 140


>gi|315282734|ref|ZP_07871074.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Listeria marthii
          FSL S4-120]
 gi|313613621|gb|EFR87425.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Listeria marthii
          FSL S4-120]
          Length = 97

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 45/88 (51%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+++A+ +++ + E +   F  +L   + ++E+++ ++   VEP    + +  V R DV 
Sbjct: 9  VEKVANLAKLEVSETEATAFAGQLGKIIELVEQLNTLDTTNVEPTSHAIEVSNVLREDVA 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
            G     +L NAP  +   F VP  +E
Sbjct: 69 TKGLDRREVLKNAPDEQDGMFKVPTIME 96


>gi|226355385|ref|YP_002785125.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Deinococcus
          deserti VCD115]
 gi|259647247|sp|C1D0J7|GATC_DEIDV RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|226317375|gb|ACO45371.1| putative glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Deinococcus deserti VCD115]
          Length = 96

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 46/94 (48%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   +  +A  +R+ +K E+       LN+ L   E++ EVN +GVE M   V +  V
Sbjct: 1  MIDAAQLDHLAQLARLHLKPEEREAMTADLNSILGYFEQLREVNTDGVEEMQRPVNLVNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           R DV  +    E + + AP +      VP+ VE
Sbjct: 61 LRDDVPGEVFAPEVVEALAPEMHGGQIRVPRTVE 94


>gi|224370236|ref|YP_002604400.1| GatC [Desulfobacterium autotrophicum HRM2]
 gi|259647248|sp|C0QKZ6|GATC_DESAH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|223692953|gb|ACN16236.1| GatC [Desulfobacterium autotrophicum HRM2]
          Length = 95

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 50/95 (52%), Gaps = 2/95 (2%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   DV+ +AH +R+++    +     +++N L  ++ + EV+V+GV P+ S   +  
Sbjct: 1  MKISKQDVEHLAHLARLAVDGSQVESLTAQVSNILDYMDVLKEVDVDGV-PLASGAALGT 59

Query: 61 -VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
           V R D V         L+NAP  + +F+ VP+ V
Sbjct: 60 NVFRQDQVKPSPGPCVTLANAPERDDDFYTVPRIV 94


>gi|291455970|ref|ZP_06595360.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Bifidobacterium breve DSM 20213]
 gi|291382379|gb|EFE89897.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Bifidobacterium breve DSM 20213]
          Length = 152

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
           +   +RI++ +E+I      LN     + K+ EV  + V P  + VP++   RPDV    
Sbjct: 65  LGDLARIALTDEEITRLQGELNVIADSINKVQEVASDDVPPTANPVPLEAYLRPDVAETP 124

Query: 71  DKVESILSNAPHVEKNFFVVPK 92
              E  L+  P  E   FV P+
Sbjct: 125 LTQEEALAGGPKTEAGMFVAPR 146


>gi|169825831|ref|YP_001695989.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Lysinibacillus
          sphaericus C3-41]
 gi|229487516|sp|B1HTW8|GATC_LYSSC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|168990319|gb|ACA37859.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Lysinibacillus
          sphaericus C3-41]
          Length = 95

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 43/85 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +VK +A+ +R++I EE+   F  +L       E+++E++   VEP   V+P+  V R DV
Sbjct: 8  EVKHVANLARLAITEEEAEKFAEQLGKITDFAEQLNELDTANVEPTTHVLPLVNVMREDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
             G   E ++ N    E     VP
Sbjct: 68 AVKGLDREVMMLNVREQEDGQVKVP 92


>gi|257469263|ref|ZP_05633357.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium
          ulcerans ATCC 49185]
 gi|317063510|ref|ZP_07927995.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium
          ulcerans ATCC 49185]
 gi|313689186|gb|EFS26021.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium
          ulcerans ATCC 49185]
          Length = 96

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 45/88 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+    E+I  F + LN+ L  ++ + E+N + V+P++ +       R D 
Sbjct: 7  EVLNVAKLARLKFAPEEIEKFQVELNDILGYIDMLDEINTDEVKPLIQLNNTVNNLREDK 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V +   VE  LSNAP       +VPK V
Sbjct: 67 VRESLSVEKALSNAPDSGDGAVIVPKVV 94


>gi|312622943|ref|YP_004024556.1| glutamyl-tRNA(Gln) amidotransferase subunit C
          [Caldicellulosiruptor kronotskyensis 2002]
 gi|312203410|gb|ADQ46737.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Caldicellulosiruptor kronotskyensis 2002]
          Length = 94

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 46/89 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ +A+ +R+++ EE+I      L   +    K+S+++ + VEP   V+ +  V R D 
Sbjct: 6  DVEYVANLARLTLTEEEIEKMTKELGAIIEFANKLSDLDTKDVEPTAHVLNLYNVFREDE 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V      E IL NAP  +     VPK VE
Sbjct: 66 VKPSYPREEILKNAPSHDDVCIKVPKIVE 94


>gi|213691178|ref|YP_002321764.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bifidobacterium
           longum subsp. infantis ATCC 15697]
 gi|296453422|ref|YP_003660565.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Bifidobacterium
           longum subsp. longum JDM301]
 gi|213522639|gb|ACJ51386.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bifidobacterium
           longum subsp. infantis ATCC 15697]
 gi|296182853|gb|ADG99734.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bifidobacterium
           longum subsp. longum JDM301]
          Length = 116

 Score = 44.3 bits (103), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
           +   +RI++ +E+I      LN     + K+ EV  + V P  + VP++   RPDV    
Sbjct: 29  LGDLARIALTDEEITRLQGELNVIADSINKVQEVASDDVPPTANPVPLEAYLRPDVAETP 88

Query: 71  DKVESILSNAPHVEKNFFVVPK 92
              E  L+  P  E   FV P+
Sbjct: 89  LTQEEALAGGPKTEAGMFVAPR 110


>gi|254303779|ref|ZP_04971137.1| glutaminyl-tRNA synthase (glutamine-hydrolyzing) [Fusobacterium
          nucleatum subsp. polymorphum ATCC 10953]
 gi|148323971|gb|EDK89221.1| glutaminyl-tRNA synthase (glutamine-hydrolyzing) [Fusobacterium
          nucleatum subsp. polymorphum ATCC 10953]
          Length = 96

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 51/94 (54%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   +V +IA  S++S ++++I  F + LN+ L  ++ ++EV+   VEP+V +     
Sbjct: 1  MALTKEEVLKIAKLSKLSFEDKEIEKFQVELNDILKYIDMLNEVDTSKVEPLVYINESVN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
            R        ++E +L NAP   +N  VVPK +
Sbjct: 61 NFREKEEKPSLEIEKVLFNAPESAENAIVVPKVI 94


>gi|19704090|ref|NP_603652.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium
          nucleatum subsp. nucleatum ATCC 25586]
 gi|296328701|ref|ZP_06871218.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium
          nucleatum subsp. nucleatum ATCC 23726]
 gi|39931600|sp|Q8R678|GATC_FUSNN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|19714292|gb|AAL94951.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium
          nucleatum subsp. nucleatum ATCC 25586]
 gi|296154300|gb|EFG95101.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium
          nucleatum subsp. nucleatum ATCC 23726]
          Length = 96

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 49/88 (55%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V +IA  S++S ++++I  F + LN+ L  ++ ++EV+   VEP+V +       R   
Sbjct: 7  EVLKIAKLSKLSFEDKEIEKFQVELNDILKYIDMLNEVDTSKVEPLVYINESVNNFREKE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
               ++E +L NAP   +N  VVPK +
Sbjct: 67 EKPSLEIEKVLFNAPESAENAIVVPKVI 94


>gi|23325603|gb|AAN24241.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Bifidobacterium
           longum NCC2705]
          Length = 116

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
           +   +RI++ +E+I      LN     + K+ EV  + V P  + VP++   RPDV    
Sbjct: 29  LGDLARIALTDEEITRLQGELNVIADSINKVQEVASDDVPPTANPVPLEAYLRPDVAETP 88

Query: 71  DKVESILSNAPHVEKNFFVVPK 92
              E  L+  P  E   FV P+
Sbjct: 89  LTQEEALAGGPKTEAGMFVAPR 110


>gi|256380028|ref|YP_003103688.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Actinosynnema
          mirum DSM 43827]
 gi|255924331|gb|ACU39842.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Actinosynnema
          mirum DSM 43827]
          Length = 99

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+++ ++++ LF  +L+  L  +  + ++    + P    VP+  V R DV
Sbjct: 8  EVAHLARLARLAVTDDELDLFAGQLDVILQSVATVGDIATADIPPTSHAVPLTNVFREDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      +  L+ AP  E+  F VP+
Sbjct: 68 VRPSLGQQQALAGAPAAEEGRFRVPR 93


>gi|256830658|ref|YP_003159386.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Desulfomicrobium
          baculatum DSM 4028]
 gi|256579834|gb|ACU90970.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfomicrobium
          baculatum DSM 4028]
          Length = 94

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 42/84 (50%)

Query: 11 IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
          IA  +R+ +  E       ++++ L  ++K++E++   VEPM + V      R D V   
Sbjct: 11 IATLARLEVSPELAASLGAQMDDILGYMDKLNELDTASVEPMYTTVEQPGFLREDEVAKE 70

Query: 71 DKVESILSNAPHVEKNFFVVPKAV 94
               IL NAP  +  +F+VP+ V
Sbjct: 71 FGRAQILLNAPESDGEYFIVPRIV 94


>gi|332285648|ref|YP_004417559.1| glutamyl-tRNA(GLN) amidotransferase subunit C [Pusillimonas sp.
           T7-7]
 gi|330429601|gb|AEC20935.1| glutamyl-tRNA(GLN) amidotransferase subunit C [Pusillimonas sp.
           T7-7]
          Length = 102

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 7/102 (6%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
           M I   DV RIA  +RI +  +D       LN  + ++E++  V+  G+EPM   +    
Sbjct: 1   MSITEQDVARIARLARIELSPDDTTRAQHELNGIMGLIEQLQAVDTTGIEPMAHPLAAHQ 60

Query: 61  -------VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
                    +P      ++ ++++ NAP  +   F+VP  +E
Sbjct: 61  DIQLRLRDDKPASTHTLEQRQALMVNAPANDNGLFLVPTVIE 102


>gi|152990918|ref|YP_001356640.1| glutamyl-tRNA amidotransferase subunit C [Nitratiruptor sp.
           SB155-2]
 gi|151422779|dbj|BAF70283.1| glutamyl-tRNA amidotransferase subunit C [Nitratiruptor sp.
           SB155-2]
          Length = 111

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 1/94 (1%)

Query: 3   IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
           ID   +KR+ + S + + E      L  LN  L  ++ + E++  GVE   S +      
Sbjct: 18  IDHQLLKRLQNLSMVEVDEAKKDQILEELNKFLEFVDILDELDYSGVEATFSPIEASAPL 77

Query: 63  RPDVVCDGDKV-ESILSNAPHVEKNFFVVPKAVE 95
           R D      +V + IL NAP  E NFF+VPK +E
Sbjct: 78  RKDEPSPHPEVGQKILQNAPKSEDNFFIVPKIIE 111


>gi|227432079|ref|ZP_03914092.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Leuconostoc mesenteroides subsp. cremoris ATCC 19254]
 gi|227352161|gb|EEJ42374.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Leuconostoc mesenteroides subsp. cremoris ATCC 19254]
          Length = 109

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (52%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           +V  +A  ++++  + D+  F  +L + L++ + +SEVN + V P  SV       R DV
Sbjct: 17  EVAHVAGLAKLAFNDADLDQFTTQLGDILNIFDTLSEVNTDDVIPTYSVTENVNHLREDV 76

Query: 67  VCDGDKVESILSNAPHVEKNFFVVP 91
             + ++ + +L+NAP    +   VP
Sbjct: 77  ANNWNQKQELLNNAPLEAADLIKVP 101


>gi|149063567|gb|EDM13890.1| similar to Putative protein 15E1.2 (predicted), isoform CRA_c
           [Rattus norvegicus]
          Length = 167

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 1/90 (1%)

Query: 3   IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
            D V    + H  R+++        + RL   ++  +++  V+ +GVEP+ SV+  + ++
Sbjct: 47  TDRVSAAVVEHLERLALVNFSSREAVDRLEKAVAFADQLHAVDTDGVEPLESVLEDRCLY 106

Query: 63  -RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
            R D V +G   E +L N+ HV + +FV P
Sbjct: 107 LRSDKVAEGGCAEELLQNSNHVVEEYFVAP 136


>gi|296274376|ref|YP_003657007.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Arcobacter
          nitrofigilis DSM 7299]
 gi|296098550|gb|ADG94500.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Arcobacter
          nitrofigilis DSM 7299]
          Length = 96

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 48/96 (50%), Gaps = 1/96 (1%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   + ++A  S + I E         L + ++ +E ++E++V  ++   + V    
Sbjct: 1  MTIDDTTIDKLAKLSSLEIDENKRESLKNELGDIINFVENLNEIDVSHIDATFTTVEGGT 60

Query: 61 VHRPDVVC-DGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D+   D D  + ILS+AP  E  +F+VPK +E
Sbjct: 61 PLREDIANQDLDMSKHILSHAPKSENGYFIVPKIIE 96


>gi|320104447|ref|YP_004180038.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Isosphaera pallida ATCC 43644]
 gi|319751729|gb|ADV63489.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Isosphaera pallida ATCC 43644]
          Length = 97

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 45/84 (53%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+ +A  +R+ + E ++  F  +L   L  +++++ ++ EGVEP+   + +  V R D V
Sbjct: 8  VRDVALLARLRLSETELERFTTQLGAILDYIDQLATLDTEGVEPLAHGIEVVNVFREDRV 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVP 91
              K +  L+NAP      F+VP
Sbjct: 68 EPPLKRDDALANAPKRNAEAFLVP 91


>gi|313126971|ref|YP_004037241.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit c
          [Halogeometricum borinquense DSM 11551]
 gi|312293336|gb|ADQ67796.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Halogeometricum borinquense DSM 11551]
          Length = 92

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 7/91 (7%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVP-MKMV 61
          +D  +V+ +A  +R+++ E+++  F  +  + L   + + EV      P V   P +  V
Sbjct: 6  VDAEEVRHVAELARVNLDEDEVEEFAGQFADILDYFDALDEV------PEVEAEPDLVNV 59

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
           R D V DG   +  L NAP  E  FF  P+
Sbjct: 60 MRTDEVRDGLDQDEALQNAPEAEDGFFKGPR 90


>gi|258544097|ref|ZP_05704331.1| glutamyl/tRNA (Gln) amidotransferase, C subunit [Cardiobacterium
           hominis ATCC 15826]
 gi|258520650|gb|EEV89509.1| glutamyl/tRNA (Gln) amidotransferase, C subunit [Cardiobacterium
           hominis ATCC 15826]
          Length = 117

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 40/93 (43%)

Query: 3   IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
           +D   + + AH +++ I+  ++      L    ++   I+   +    P+   +      
Sbjct: 25  LDPATIAKTAHLAQLEIEGAELTRLAAELEQIFALFSAINTAEISATPPLSHPLGDTQRL 84

Query: 63  RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           RPD+    D + SI  NAP  E  F  VPK +E
Sbjct: 85  RPDIAIARDMMPSIEKNAPRAEDRFITVPKVIE 117


>gi|282853925|ref|ZP_06263262.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Propionibacterium
          acnes J139]
 gi|282583378|gb|EFB88758.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Propionibacterium
          acnes J139]
          Length = 99

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV R+A  +RI + +++I     +L+  L  +  +S V  + V P    +P+  V R DV
Sbjct: 7  DVVRLAGLARIDLTDDEIAYLAPQLDAILDAVAAVSGVPTDDVPPTSHALPLSNVFREDV 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          + +       L+ AP  E   F VP+
Sbjct: 67 IKESMSSHDALAMAPRSENQRFRVPR 92


>gi|284032785|ref|YP_003382716.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Kribbella flavida
          DSM 17836]
 gi|283812078|gb|ADB33917.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Kribbella flavida
          DSM 17836]
          Length = 99

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +RI + ++++     +L+  + ++ ++SEV  + + P    +P+  V RPD 
Sbjct: 8  EVAHLARLARIELSDDELDHLAPQLDQIIGLVGQVSEVAADDIPPTSHALPISNVMRPDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
                 E  LS AP  E+  F VP+
Sbjct: 68 NVPCLTPEQALSGAPAAEQQRFRVPR 93


>gi|254459139|ref|ZP_05072561.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Campylobacterales
          bacterium GD 1]
 gi|207084032|gb|EDZ61322.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Campylobacterales
          bacterium GD 1]
          Length = 96

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 50/96 (52%), Gaps = 1/96 (1%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +D V + ++   S + + E+     + +L+  +S ++ +S +N +GV+   ++     
Sbjct: 1  MQVDDVLLTKLEKLSFLKVSEDKREEIIGQLSEIVSFVDNLSSLNTDGVDDNFAMSDNGT 60

Query: 61 VHRPDV-VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D   CD    ++IL NAP    +FF+VPK +E
Sbjct: 61 FTREDTPFCDASVNDNILKNAPLSGDHFFIVPKIIE 96


>gi|296111686|ref|YP_003622068.1| glutamyl-tRNA amidotransferase, subunit C [Leuconostoc kimchii
          IMSNU 11154]
 gi|295833218|gb|ADG41099.1| glutamyl-tRNA amidotransferase, subunit C [Leuconostoc kimchii
          IMSNU 11154]
          Length = 102

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 47/89 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  ++++  + ++  F  +L++ L++ + + EV+ E VEP  SV       R DV
Sbjct: 10 EVAHVASLAKLAFNDTELEQFTTQLDSILTIFDTLGEVDTEQVEPTYSVTENVNHLRQDV 69

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            +  + +++L NAP    +   VP  +E
Sbjct: 70 ADNWHQKQALLKNAPLEAADLIKVPAILE 98


>gi|116618675|ref|YP_819046.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293]
 gi|116097522|gb|ABJ62673.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293]
          Length = 108

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (52%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           +V  +A  ++++  + D+  F  +L + L++ + +SEVN + V P  SV       R DV
Sbjct: 16  EVAHVAGLAKLAFNDADLDQFTTQLGDILNIFDTLSEVNTDDVIPTYSVTENVNHLREDV 75

Query: 67  VCDGDKVESILSNAPHVEKNFFVVP 91
             + ++ + +L+NAP    +   VP
Sbjct: 76  ANNWNQKQELLNNAPLEAADLIKVP 100


>gi|314923320|gb|EFS87151.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Propionibacterium
           acnes HL001PA1]
 gi|314966668|gb|EFT10767.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Propionibacterium
           acnes HL082PA2]
 gi|314981397|gb|EFT25491.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Propionibacterium
           acnes HL110PA3]
 gi|315092063|gb|EFT64039.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Propionibacterium
           acnes HL110PA4]
 gi|315092810|gb|EFT64786.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Propionibacterium
           acnes HL060PA1]
 gi|315103669|gb|EFT75645.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Propionibacterium
           acnes HL050PA2]
 gi|327327493|gb|EGE69269.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Propionibacterium
           acnes HL103PA1]
          Length = 107

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           DV R+A  +RI + +++I     +L+  L  +  +S V  + V P    +P+  V R DV
Sbjct: 15  DVVRLAGLARIDLTDDEIAYLAPQLDAILDAVAAVSGVPTDDVPPTSHALPLSNVFREDV 74

Query: 67  VCDGDKVESILSNAPHVEKNFFVVPK 92
           + +       L+ AP  E   F VP+
Sbjct: 75  IKESMSSHDALAMAPRSENQRFRVPR 100


>gi|297191906|ref|ZP_06909304.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Streptomyces pristinaespiralis ATCC 25486]
 gi|197721115|gb|EDY65023.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Streptomyces pristinaespiralis ATCC 25486]
          Length = 98

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +  E++  F  +L++ +  + ++SEV  + V P    +P+  V R D 
Sbjct: 8  EVAHLARLARLELSGEELEHFAGQLDDIIGAVARVSEVADQDVPPTSHPLPLTNVMRADE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  LS AP  E+  F VP+
Sbjct: 68 VRPSLTPEQALSGAPAQEQQRFKVPQ 93


>gi|218887922|ref|YP_002437243.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Desulfovibrio
          vulgaris str. 'Miyazaki F']
 gi|254790996|sp|B8DRD8|GATC_DESVM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|218758876|gb|ACL09775.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Desulfovibrio
          vulgaris str. 'Miyazaki F']
          Length = 95

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 35/74 (47%)

Query: 21 EEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNA 80
          E  +  F  +  + L  +E ++ ++  GVEP+ S V      R D        E +L NA
Sbjct: 22 EAQLATFARQFGDILGYMEMLNGLDTTGVEPLYSPVQHATALRSDETAPRCTREDVLRNA 81

Query: 81 PHVEKNFFVVPKAV 94
          P  +  FF+VP+ V
Sbjct: 82 PEADSEFFIVPRIV 95


>gi|257454018|ref|ZP_05619292.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enhydrobacter
           aerosaccus SK60]
 gi|257448496|gb|EEV23465.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Enhydrobacter
           aerosaccus SK60]
          Length = 100

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 5/93 (5%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           ++  IA  +R+ +  E    +   L+  LS+++ ++EVN + + P+ +V  M    R DV
Sbjct: 9   EIMNIAKLARLGVTAEQADSYANDLSKILSMMDILAEVNTDNIAPLTNVHDMTQPLREDV 68

Query: 67  VCDGDKVES----ILSNAPHVEKNFFVVPKAVE 95
           +  GD VE       S AP V    ++VP+ +E
Sbjct: 69  IG-GDGVEVNRELYQSIAPSVADGLYLVPQVIE 100


>gi|225022719|ref|ZP_03711911.1| hypothetical protein CORMATOL_02764 [Corynebacterium matruchotii
          ATCC 33806]
 gi|224944627|gb|EEG25836.1| hypothetical protein CORMATOL_02764 [Corynebacterium matruchotii
          ATCC 33806]
          Length = 97

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 44/85 (51%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V  +A  SR+++ +E++  F  ++++ ++ +  + +V   GVEPM     +    R DVV
Sbjct: 9  VAHLAKLSRLALTDEELDRFAAQIDDIVTNVSAVQQVAAAGVEPMSHPHSIHTTMREDVV 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPK 92
                E  L  AP V +  FVVP+
Sbjct: 69 KPLLTPEQALDQAPEVAEQRFVVPQ 93


>gi|313123179|ref|YP_004033438.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit c
          [Lactobacillus delbrueckii subsp. bulgaricus ND02]
 gi|312279742|gb|ADQ60461.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Lactobacillus delbrueckii subsp. bulgaricus ND02]
 gi|325684646|gb|EGD26801.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Lactobacillus
          delbrueckii subsp. lactis DSM 20072]
          Length = 101

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          +K +A  +++   EE++  F  ++   L + E++  V+  GVE  V VV    V R DV 
Sbjct: 9  IKHVAALAQLEFSEEELAKFTSQMGKILEMAEELQAVDTTGVEETVQVVDRDTVFREDVP 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVP 91
                E ++ N P     F  VP
Sbjct: 69 EKWQTREEMMKNVPDKSNGFVKVP 92


>gi|302522066|ref|ZP_07274408.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptomyces sp.
          SPB78]
 gi|318059492|ref|ZP_07978215.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptomyces
          sp. SA3_actG]
 gi|318076489|ref|ZP_07983821.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptomyces
          sp. SA3_actF]
 gi|333024267|ref|ZP_08452331.1| putative aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Streptomyces sp. Tu6071]
 gi|302430961|gb|EFL02777.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptomyces sp.
          SPB78]
 gi|332744119|gb|EGJ74560.1| putative aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Streptomyces sp. Tu6071]
          Length = 98

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +  E++  F  +L++ L  + ++SE+  + V P    +P+  V R D 
Sbjct: 8  EVAHLARLARLELSAEELEHFAGQLDDILGAVARVSEIADQDVPPTSHPLPLTNVMRADE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      +  LS AP  E+  F VP+
Sbjct: 68 VRPSLTPQQALSGAPAQEQQRFKVPQ 93


>gi|237736762|ref|ZP_04567243.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium
          mortiferum ATCC 9817]
 gi|229420624|gb|EEO35671.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium
          mortiferum ATCC 9817]
          Length = 96

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 44/88 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V +IA  +R+  + E+I  F + LN+ L  ++ ++EV  E V  +  V       R D 
Sbjct: 7  EVLKIAKLARLKFQPEEIEKFQVELNDILGYIDMLNEVETEEVSALSQVNSHVNNLRDDS 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
          V +   VE  L NAP  E    +VPK V
Sbjct: 67 VRESLTVEEALKNAPDGEDGAIIVPKVV 94


>gi|169835565|ref|ZP_02868753.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [candidate
          division TM7 single-cell isolate TM7a]
          Length = 97

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 35/60 (58%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK++A    I I E++   F L +  TL+ ++++ E++ + +EP   V  +K V R DV+
Sbjct: 9  VKKMAQLGNIEITEDEANSFALDIERTLAYVDQLKELDTDSIEPTYQVTGLKNVWRKDVI 68


>gi|256425836|ref|YP_003126489.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Chitinophaga
          pinensis DSM 2588]
 gi|256040744|gb|ACU64288.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Chitinophaga
          pinensis DSM 2588]
          Length = 96

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 46/88 (52%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+++A  +R+   E++       L   ++ +EK++E++   V+P++ +   + V R DVV
Sbjct: 8  VQQLADLARLEFSEQEKTEIKGDLQRMITFVEKLNELDTTNVKPLLHMTADRNVLREDVV 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
                E  L NAP     +F VPK ++
Sbjct: 68 VPSITREEGLQNAPAANDQYFKVPKVIK 95


>gi|148652231|ref|YP_001279324.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Psychrobacter sp.
           PRwf-1]
 gi|148571315|gb|ABQ93374.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Psychrobacter sp. PRwf-1]
          Length = 112

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 46/91 (50%)

Query: 5   VVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRP 64
             D+  +A  SR+++ EE    F   ++  L+++  +S V+ EG+ P+ +V       R 
Sbjct: 22  TADILEVAKLSRLAVDEETAQNFAEDIDKILAMMHTLSSVDTEGLTPLANVHEAAQELRA 81

Query: 65  DVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           D+       E   S AP VE+  ++VP+ +E
Sbjct: 82  DIPNPDIDRELNQSIAPAVEQGLYLVPQVIE 112


>gi|282861259|ref|ZP_06270324.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptomyces sp.
          ACTE]
 gi|282563917|gb|EFB69454.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptomyces sp.
          ACTE]
          Length = 98

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +K E++  F  +L++ +  + ++SEV  + V P    +P+  V R D 
Sbjct: 8  EVAHLARLARLELKGEELEHFAGQLDDIIGAVARVSEVADQDVPPTSHPLPLTNVMRADE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V         LS AP  E+  F VP+
Sbjct: 68 VRPSLTPAQALSGAPAQEQQRFKVPQ 93


>gi|301605017|ref|XP_002932124.1| PREDICTED: gatC-like protein-like [Xenopus (Silurana) tropicalis]
          Length = 151

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 47/88 (53%), Gaps = 1/88 (1%)

Query: 5   VVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-R 63
           ++ +  I H  R+++ +      + RL   +   +++  VN EGVEP+ SV+  + ++ R
Sbjct: 43  LISLDTIDHLERLALVDFGNVEGVQRLEKAIQFADQLHNVNTEGVEPLSSVLEDRTLYIR 102

Query: 64  PDVVCDGDKVESILSNAPHVEKNFFVVP 91
            D V  G+  E +L NA  V + +FV P
Sbjct: 103 NDAVAAGNCTELLLENARTVVEEYFVAP 130


>gi|294786703|ref|ZP_06751957.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Parascardovia
          denticolens F0305]
 gi|315226318|ref|ZP_07868106.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Parascardovia
          denticolens DSM 10105]
 gi|294485536|gb|EFG33170.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Parascardovia
          denticolens F0305]
 gi|315120450|gb|EFT83582.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Parascardovia
          denticolens DSM 10105]
          Length = 100

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (47%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +++ +A  SRI++ +++       LN     + K+ EV  E V P  + VP++   RPD 
Sbjct: 11 EIEHLADLSRIALSDKEAERLQGELNVISDSIAKVQEVASEDVPPTANPVPLEAYLRPDE 70

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
                 +  LS AP  E   FV P+
Sbjct: 71 PAKPLTQDQALSGAPAKEDGMFVAPQ 96


>gi|182435812|ref|YP_001823531.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptomyces
          griseus subsp. griseus NBRC 13350]
 gi|239944479|ref|ZP_04696416.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptomyces
          roseosporus NRRL 15998]
 gi|239990938|ref|ZP_04711602.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptomyces
          roseosporus NRRL 11379]
 gi|291447945|ref|ZP_06587335.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Streptomyces roseosporus NRRL 15998]
 gi|326776437|ref|ZP_08235702.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Streptomyces cf. griseus XylebKG-1]
 gi|229487539|sp|B1VZV9|GATC_STRGG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|178464328|dbj|BAG18848.1| putative glutamyl-tRNA amidotransferase subunit C [Streptomyces
          griseus subsp. griseus NBRC 13350]
 gi|291350892|gb|EFE77796.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Streptomyces roseosporus NRRL 15998]
 gi|326656770|gb|EGE41616.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Streptomyces cf. griseus XylebKG-1]
          Length = 98

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +K E++  F  +L++ +  + ++SEV  + V P    +P+  V R D 
Sbjct: 8  EVAHLARLARLELKGEELDHFAGQLDDIIGAVARVSEVADQDVPPTSHPLPLTNVMRADE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V         LS AP  E+  F VP+
Sbjct: 68 VRPSLTPAQALSGAPAQEQQRFKVPQ 93


>gi|332262548|ref|XP_003280324.1| PREDICTED: gatC-like protein-like [Nomascus leucogenys]
          Length = 136

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCD 69
           I H  R+++ +      + RL   ++  +++  V+ +GVEPM SV+  + ++ R D V +
Sbjct: 37  IEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVE 96

Query: 70  GDKVESILSNAPHVEKNFFVVP 91
           G+  + +L N+  V + +FV P
Sbjct: 97  GNCADELLQNSHRVMEEYFVAP 118


>gi|320094063|ref|ZP_08025881.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Actinomyces sp.
          oral taxon 178 str. F0338]
 gi|319979004|gb|EFW10529.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Actinomyces sp.
          oral taxon 178 str. F0338]
          Length = 98

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 43/90 (47%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          I   +V R+A  + I++ EE+I  F   L+     + K+SEV    V      +P+  V 
Sbjct: 4  ISTDEVARVAGLAHIALTEEEIARFAGELDVIADAVSKVSEVATPDVPATSHPIPLTNVW 63

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R D        + +L+ AP  E+  F+VP+
Sbjct: 64 REDEAGPTVDRDEVLAQAPASEEGMFLVPQ 93


>gi|312381748|gb|EFR27422.1| hypothetical protein AND_05877 [Anopheles darlingi]
          Length = 166

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 1/88 (1%)

Query: 5   VVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPM-KMVHR 63
            +D   +    R+S+ + +    L  L +++    +I  +  EGVEP+ +V+   ++  R
Sbjct: 62  AIDRHTVQLLERLSLVDLETNDALETLEDSIGFASRILTIGTEGVEPLYTVLERERLSLR 121

Query: 64  PDVVCDGDKVESILSNAPHVEKNFFVVP 91
            DVV DGD    +L NA   E+ +FV P
Sbjct: 122 EDVVNDGDLQTDVLRNAAVTEEEYFVAP 149


>gi|300813126|ref|ZP_07093503.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          delbrueckii subsp. bulgaricus PB2003/044-T3-4]
 gi|300495880|gb|EFK31025.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          delbrueckii subsp. bulgaricus PB2003/044-T3-4]
          Length = 101

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          +K +A  +++   EE++  F  ++   L + E++  V+  GVE  V VV    V R DV 
Sbjct: 9  IKHVAALAKLEFSEEELAKFTPQMGKILEMAEELQAVDTTGVEETVQVVDRDTVFREDVP 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVP 91
                E ++ N P     F  VP
Sbjct: 69 EKWQTREEMMKNVPDKSNGFVKVP 92


>gi|325110141|ref|YP_004271209.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Planctomyces brasiliensis DSM 5305]
 gi|324970409|gb|ADY61187.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Planctomyces brasiliensis DSM 5305]
          Length = 99

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (52%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+++A  +++   EE++      L + L  +E +++V  + VEP+   + ++ V R D 
Sbjct: 8  DVRKVADLAQLEFGEEELTQMGDHLRSILDYVEILNQVETDNVEPLAHPIEVQNVFRDDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
                 E  L NAP+ +  +F+VP
Sbjct: 68 PTPMLSREDALKNAPNTDGKYFLVP 92


>gi|171780318|ref|ZP_02921222.1| hypothetical protein STRINF_02106 [Streptococcus infantarius
          subsp. infantarius ATCC BAA-102]
 gi|171281666|gb|EDT47101.1| hypothetical protein STRINF_02106 [Streptococcus infantarius
          subsp. infantarius ATCC BAA-102]
          Length = 100

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 49/95 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A+ S++S  EE+   F   L+  + ++E ++EV+ EGV    ++   K 
Sbjct: 1  MKISEEEVRHVANLSKLSFSEEETTEFATTLSKIVDMVELLNEVDTEGVPVTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R DV   GD  + +  N P  E  +  VP  +E
Sbjct: 61 VMREDVAVAGDDRDELFKNVPQSENYYIKVPAILE 95


>gi|25011753|ref|NP_736148.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          agalactiae NEM316]
 gi|77414363|ref|ZP_00790519.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          agalactiae 515]
 gi|39931560|sp|Q8E3P3|GATC_STRA3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|24413293|emb|CAD47372.1| Unknown [Streptococcus agalactiae NEM316]
 gi|77159598|gb|EAO70753.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          agalactiae 515]
 gi|319745581|gb|EFV97882.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          agalactiae ATCC 13813]
          Length = 100

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 48/95 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A+ S++   +++   F   L+  + ++E ++EV+ EGV    ++   K 
Sbjct: 1  MKISEEEVRHVANLSKLRFSDQETKEFASSLSKIVDMIELLNEVDTEGVPVTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D+   G+  + +  N P  +  +  VP  +E
Sbjct: 61 VMREDIAQPGNNRDDLFKNVPQHQDYYIKVPAILE 95


>gi|170017691|ref|YP_001728610.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Leuconostoc
          citreum KM20]
 gi|229487515|sp|B1N064|GATC_LEUCK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|169804548|gb|ACA83166.1| Glutamyl-tRNA(Gln) amidotransferase, C subunit [Leuconostoc
          citreum KM20]
          Length = 102

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 42/89 (47%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +++S  + ++  F  +L + L++   + EV+   VEP  SV       R DV
Sbjct: 10 EVAHVAKLAKLSFDDSELTQFTTQLGDILNIFNTLGEVDTAAVEPTYSVTENVNHLRDDV 69

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            +  + + +L NAP        VP  +E
Sbjct: 70 AHNWHQKQGLLENAPLASAGLIKVPAILE 98


>gi|268679221|ref|YP_003303652.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Sulfurospirillum
          deleyianum DSM 6946]
 gi|268617252|gb|ACZ11617.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Sulfurospirillum
          deleyianum DSM 6946]
          Length = 96

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 52/96 (54%), Gaps = 1/96 (1%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I+   + ++   S + I +E     + +L+  ++ +E ++E++++G E   + +    
Sbjct: 1  MKINNTLLTKLEKLSSLRISDEKREGVIQQLSEIVNFVENLNELDLQGEEATFTTLQGGT 60

Query: 61 VHRPDV-VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DV   + + V++IL +AP  E  FFVVPK +E
Sbjct: 61 PFREDVPALNSNIVKTILQHAPQSENGFFVVPKIIE 96


>gi|154174548|ref|YP_001407785.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Campylobacter
          curvus 525.92]
 gi|166198853|sp|A7GX43|GATC_CAMC5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|112802514|gb|EAT99858.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Campylobacter
          curvus 525.92]
          Length = 95

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 51/95 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   + ++   S + I ++       +L+  +S ++ ++E++++G E +VS +    
Sbjct: 1  MQIDDALLSKLEKLSSLKINDDKREEIKRQLSEIVSFVDVLNELDLKGSEAVVSSIKGGT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          + R D     D ++ IL NAP  E +FF VPK +E
Sbjct: 61 LLREDSPIASDVIDIILKNAPSQEGHFFSVPKIIE 95


>gi|305682135|ref|ZP_07404939.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Corynebacterium
          matruchotii ATCC 14266]
 gi|305658608|gb|EFM48111.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Corynebacterium
          matruchotii ATCC 14266]
          Length = 97

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V  +A  SR+++ +E++  F  ++++ ++ +  + +V   GVEPM     +    R D+V
Sbjct: 9  VAHLAKLSRLALTDEELDRFAAQIDDIVTNVSAVQQVAAAGVEPMSHPHSIHTTMREDIV 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPK 92
                E  L  AP V +  FVVP+
Sbjct: 69 KPLLTPEQALDQAPEVAEQRFVVPQ 93


>gi|157820535|ref|NP_001101809.1| gatC-like protein [Rattus norvegicus]
 gi|149063565|gb|EDM13888.1| similar to Putative protein 15E1.2 (predicted), isoform CRA_a
           [Rattus norvegicus]
          Length = 155

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 1/90 (1%)

Query: 3   IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
            D V    + H  R+++        + RL   ++  +++  V+ +GVEP+ SV+  + ++
Sbjct: 47  TDRVSAAVVEHLERLALVNFSSREAVDRLEKAVAFADQLHAVDTDGVEPLESVLEDRCLY 106

Query: 63  -RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
            R D V +G   E +L N+ HV + +FV P
Sbjct: 107 LRSDKVAEGGCAEELLQNSNHVVEEYFVAP 136


>gi|237741725|ref|ZP_04572206.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium sp.
          4_1_13]
 gi|294785661|ref|ZP_06750949.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Fusobacterium sp.
          3_1_27]
 gi|229429373|gb|EEO39585.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Fusobacterium sp.
          4_1_13]
 gi|294487375|gb|EFG34737.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Fusobacterium sp.
          3_1_27]
          Length = 96

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 50/94 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   +V +IA  S++S +E++I  F + LN+ L  ++ ++EV+   +EP+V +     
Sbjct: 1  MALTKEEVLKIAKLSKLSFEEKEIEKFQIELNDILKYIDMLNEVDTSKIEPLVYINEAVN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
            R        ++  +L NAP   +N  VVPK +
Sbjct: 61 NFREKEEKPSLEIGKVLLNAPESAENAIVVPKVI 94


>gi|328950764|ref|YP_004368099.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Marinithermus hydrothermalis DSM 14884]
 gi|328451088|gb|AEB11989.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Marinithermus hydrothermalis DSM 14884]
          Length = 95

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 40/88 (45%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          ++ +   SRI +  E+       L   L   EKIS ++ +G+E M   VP++   R D  
Sbjct: 8  IRHLERLSRIQLTPEEEARMQEDLGRILGYFEKISALDTDGLEEMARPVPLENRMRADEA 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +       LS A   E  FF VP+ +E
Sbjct: 68 RESLAQAEALSVAVEAEDGFFKVPRVIE 95


>gi|212715380|ref|ZP_03323508.1| hypothetical protein BIFCAT_00275 [Bifidobacterium catenulatum
          DSM 16992]
 gi|225352566|ref|ZP_03743589.1| hypothetical protein BIFPSEUDO_04190 [Bifidobacterium
          pseudocatenulatum DSM 20438]
 gi|212661686|gb|EEB22261.1| hypothetical protein BIFCAT_00275 [Bifidobacterium catenulatum
          DSM 16992]
 gi|225156760|gb|EEG70154.1| hypothetical protein BIFPSEUDO_04190 [Bifidobacterium
          pseudocatenulatum DSM 20438]
          Length = 98

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%)

Query: 11 IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
          +   +RI++ +E+I      LN     + K+ EV  + VEP  + +P++   RPDV    
Sbjct: 12 LGDLARIALTDEEITRLQGDLNVIAESINKVQEVATDDVEPTANPIPLEAYLRPDVPETP 71

Query: 71 DKVESILSNAPHVEKNFFVVPK 92
             E   + AP  E   FV P+
Sbjct: 72 LTQEEATAGAPVSEAGMFVAPR 93


>gi|319946381|ref|ZP_08020619.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          australis ATCC 700641]
 gi|319747534|gb|EFV99789.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          australis ATCC 700641]
          Length = 100

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 44/95 (46%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A+ S++    E+   F   L+  + ++E + EV+   V P  ++   K 
Sbjct: 1  MKITQEEVTHVANLSKLKFSPEETAEFATTLSKIVDMVELLEEVDTTDVAPTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V RPDV   G   + +  N P  +  +  VP  +E
Sbjct: 61 VLRPDVAEKGTDRDRLFKNVPEKDNYYIKVPAILE 95


>gi|315606214|ref|ZP_07881241.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Actinomyces sp.
          oral taxon 180 str. F0310]
 gi|315312102|gb|EFU60192.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Actinomyces sp.
          oral taxon 180 str. F0310]
          Length = 98

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V R+A  + I++ +E+I  F   L+     + K+SEV    V      +P+  V R D 
Sbjct: 8  EVTRVAGLAHIALTDEEITRFAGELDAIADAVSKVSEVATPDVPATSHPIPLTNVWREDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      + +L+ AP  +   F+VP+
Sbjct: 68 VGPTVDRDEVLAQAPAAQDGMFLVPQ 93


>gi|194761118|ref|XP_001962779.1| GF19721 [Drosophila ananassae]
 gi|190616476|gb|EDV32000.1| GF19721 [Drosophila ananassae]
          Length = 148

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 6   VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RP 64
           +D K I    R+++ + D    L  L +++   +KI+ +  + V P+ +V+  + +  R 
Sbjct: 54  LDPKSIQLLERLALVDLDSERALETLKSSIQFADKITHIQTDNVRPLYTVLEQQQLQLRN 113

Query: 65  DVVCDGDKVESILSNAPHVEKNFFVVP 91
           D+V +GD    +LSNA   ++++FV P
Sbjct: 114 DLVTEGDCRGKVLSNAKVTDEDYFVSP 140


>gi|154507529|ref|ZP_02043171.1| hypothetical protein ACTODO_00008 [Actinomyces odontolyticus ATCC
          17982]
 gi|293188967|ref|ZP_06607701.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Actinomyces
          odontolyticus F0309]
 gi|153799318|gb|EDN81738.1| hypothetical protein ACTODO_00008 [Actinomyces odontolyticus ATCC
          17982]
 gi|292822102|gb|EFF81027.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Actinomyces
          odontolyticus F0309]
          Length = 98

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V R+A  + I++ +E+I  F   L+     + K+SEV    V      +P+  V R D 
Sbjct: 8  EVARVAGLAHIALTDEEITRFAGELDAIADAVSKVSEVATPEVPATSHPIPLTNVWREDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          +      + +L+ AP  +   F+VP+
Sbjct: 68 IGQTVDRDEVLAQAPAAQDGMFLVPQ 93


>gi|237752995|ref|ZP_04583475.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Helicobacter winghamensis ATCC BAA-430]
 gi|229375262|gb|EEO25353.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Helicobacter winghamensis ATCC BAA-430]
          Length = 96

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 52/96 (54%), Gaps = 1/96 (1%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   + ++     I++++E + +    L+  ++ +E I+ + ++ +    + +  K+
Sbjct: 1  MTIDTALLNKLTRLGGITLEDEKLEITKNHLSEIVNFVENINALELDAIPASFNPLDSKL 60

Query: 61 VHRPDVV-CDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R D+V    +  +S+L NAP  E NFF+VPK +E
Sbjct: 61 PMREDIVEFKPEIAKSVLDNAPSTEDNFFIVPKIIE 96


>gi|104773605|ref|YP_618585.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Lactobacillus
          delbrueckii subsp. bulgaricus ATCC 11842]
 gi|116513596|ref|YP_812502.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit [Lactobacillus
          delbrueckii subsp. bulgaricus ATCC BAA-365]
 gi|122275634|sp|Q04BV8|GATC_LACDB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|123378506|sp|Q1GBF5|GATC_LACDA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|103422686|emb|CAI97299.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Lactobacillus
          delbrueckii subsp. bulgaricus ATCC 11842]
 gi|116092911|gb|ABJ58064.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Lactobacillus delbrueckii subsp. bulgaricus ATCC
          BAA-365]
 gi|325125241|gb|ADY84571.1| Glu-tRNA(Gln) amidotransferase subunit C [Lactobacillus
          delbrueckii subsp. bulgaricus 2038]
          Length = 101

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          +K +A  +++   EE++  F  ++   L + E++  V+  GVE  V VV    V R DV 
Sbjct: 9  IKHVAALAQLEFSEEELAKFTPQMGKILEMAEELQAVDTTGVEETVQVVDRDTVFREDVP 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVP 91
                E ++ N P     F  VP
Sbjct: 69 EKWQTREEMMKNVPDKSNGFVKVP 92


>gi|294496613|ref|YP_003543106.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Methanohalophilus mahii DSM 5219]
 gi|292667612|gb|ADE37461.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Methanohalophilus mahii DSM 5219]
          Length = 93

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+ I   +R++I EED   F   L+  L    ++ EV+   V+P   V  +  V R D  
Sbjct: 7  VEHIGWLARVNIDEEDAFEFASELSTVLDYFGQLDEVDTSDVKPTYHVADVINVFREDKP 66

Query: 68 CDGDKVESILSNAPHVEKNFFVVPK 92
              K   +L+NA  V++ +   PK
Sbjct: 67 TGSLKQNDVLANAEEVQEGYIKTPK 91


>gi|148687917|gb|EDL19864.1| RIKEN cDNA 2010003O18 [Mus musculus]
          Length = 159

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCD 69
           I H  R+++        + RL   ++  +++  V+ +GVEP+ SV+  + ++ R D V +
Sbjct: 59  IEHLERLALVNFGSREAVDRLEKAIAFADQLHAVDTDGVEPLESVLEDRCLYLRSDNVAE 118

Query: 70  GDKVESILSNAPHVEKNFFVVP 91
           G   E +L N+ HV + +FV P
Sbjct: 119 GSCAEELLQNSNHVVEEYFVAP 140


>gi|309790510|ref|ZP_07685068.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Oscillochloris
          trichoides DG6]
 gi|308227426|gb|EFO81096.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Oscillochloris
          trichoides DG6]
          Length = 89

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%)

Query: 11 IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
          +A  +R+ +  E++     +L++ L  +  + EV+V GV     V  +  V RPD V   
Sbjct: 4  VARLARLRLSPEELEEMRGQLSDILDYIAMLQEVDVTGVPITAQVTGLTSVLRPDQVVGK 63

Query: 71 DKVESILSNAPHVEKNFFVV 90
            +E +L+NAP  ++  F V
Sbjct: 64 LSLEQVLANAPDAQEGMFRV 83


>gi|311898481|dbj|BAJ30889.1| putative aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit
          C [Kitasatospora setae KM-6054]
          Length = 98

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+ ++ E++  F  +L+  +  + ++SEV  + V P    +P+  V R D 
Sbjct: 8  EVAHLARLSRLELQAEELDHFAEQLDVIIGAVARVSEVAGQDVPPTSHPLPLTNVMRADE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  LS AP  E   F VP+
Sbjct: 68 VRPSLTPEQALSGAPASEDQRFRVPQ 93


>gi|312866376|ref|ZP_07726594.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Streptococcus downei F0415]
 gi|311098070|gb|EFQ56296.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Streptococcus downei F0415]
          Length = 100

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A  S+++  +++   F   L   + ++E ++EV+  GV    ++   + 
Sbjct: 1  MKISEEEVRHVATLSKLAFSDQETTEFATTLTKIVDMVELLNEVDTTGVAITTTMADRRT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          V RPDV  +G   + +  N P  +  +  VP
Sbjct: 61 VLRPDVAEEGTDRDQLFKNVPESKDYYIKVP 91


>gi|171912452|ref|ZP_02927922.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Verrucomicrobium
          spinosum DSM 4136]
          Length = 94

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 2/91 (2%)

Query: 6  VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD 65
          +D++  A  +R+ + +++   +  +L   L  +E +   ++ GVE      P+  V R D
Sbjct: 5  IDIQHTAKLARLKLTDQEAVKYEAQLAKVLDYMETLEGHDLSGVELTAHATPIYDVWRED 64

Query: 66 VVCDG-DKVESILSNAPHVEKNFFVVPKAVE 95
          V  +G D+ E+ L+NAP      F++ + VE
Sbjct: 65 VPVEGLDRAEA-LANAPRKTAGQFLISRVVE 94


>gi|227545720|ref|ZP_03975769.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium longum subsp. infantis ATCC 55813]
 gi|227213836|gb|EEI81675.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium longum subsp. infantis ATCC 55813]
          Length = 101

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 37/82 (45%)

Query: 11 IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
          +   +RI + +E+I      LN     + K+ EV  + V P  + VP++   RPDV    
Sbjct: 14 LGDLARIVLTDEEITRLQGELNVIADSINKVQEVASDDVPPTANPVPLEAYLRPDVAETP 73

Query: 71 DKVESILSNAPHVEKNFFVVPK 92
             E  L+  P  E   FV P+
Sbjct: 74 LTQEEALAGGPKTEAGMFVAPR 95


>gi|296125476|ref|YP_003632728.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Brachyspira
          murdochii DSM 12563]
 gi|296017292|gb|ADG70529.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Brachyspira
          murdochii DSM 12563]
          Length = 106

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 47/91 (51%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M  D  +++ + + +R+ I+E      L RLN  L  +E++ EVNV+G++P+  V+ +  
Sbjct: 1  MTTDREELEALLYQTRLRIEENQKDEVLDRLNKDLKFIEELFEVNVDGIDPLYHVIDLPE 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
            R DV       E I++     E  + VVP
Sbjct: 61 YLREDVAGKTLDNEVIMNLCRSGEYGYIVVP 91


>gi|94967530|ref|YP_589578.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Candidatus Koribacter versatilis Ellin345]
 gi|94549580|gb|ABF39504.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
           [Candidatus Koribacter versatilis Ellin345]
          Length = 108

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 47/107 (43%), Gaps = 12/107 (11%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVP--- 57
           M +   DVK +A  + + + E +   FL  LN+ L  ++ ++E++   VEPM  V     
Sbjct: 1   MKVTEKDVKYVADLANLELTEAESKRFLKDLNSILEYIDNLNELDTTNVEPMAQVAARYG 60

Query: 58  ---------MKMVHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
                         RPD +      +  + NAP  +  +F VPK +E
Sbjct: 61  GEGKSEAERYGYALRPDELRPSLPHDVAMKNAPDTDGTYFKVPKVIE 107


>gi|47059159|ref|NP_083921.1| gatC-like protein [Mus musculus]
 gi|81899766|sp|Q8CBY0|GATCL_MOUSE RecName: Full=GatC-like protein
 gi|26329873|dbj|BAC28675.1| unnamed protein product [Mus musculus]
          Length = 155

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCD 69
           I H  R+++        + RL   ++  +++  V+ +GVEP+ SV+  + ++ R D V +
Sbjct: 55  IEHLERLALVNFGSREAVDRLEKAIAFADQLHAVDTDGVEPLESVLEDRCLYLRSDNVAE 114

Query: 70  GDKVESILSNAPHVEKNFFVVP 91
           G   E +L N+ HV + +FV P
Sbjct: 115 GSCAEELLQNSNHVVEEYFVAP 136


>gi|297693180|ref|XP_002823913.1| PREDICTED: gatC-like protein-like isoform 2 [Pongo abelii]
          Length = 136

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCD 69
           I H  R+++ +      + RL   ++  +++  V+ +GVEPM SV+  + ++ R D V +
Sbjct: 37  IEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRRLYLRSDNVVE 96

Query: 70  GDKVESILSNAPHVEKNFFVVP 91
           G+  + +L N+  V + +FV P
Sbjct: 97  GNCADELLQNSHRVVEEYFVAP 118


>gi|254295727|ref|ZP_04963184.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei 406e]
 gi|157805861|gb|EDO83031.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C
          subunit [Burkholderia pseudomallei 406e]
          Length = 92

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 4/92 (4%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMV----SVVPMKMVHR 63
          + RIAH +R+ + + D    L +LN    ++E++  V+  G+ P+      ++ +    R
Sbjct: 1  MTRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVDTTGIAPLAHPIEQILEVAQRLR 60

Query: 64 PDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           D V +    +     AP V+   ++VPK +E
Sbjct: 61 EDAVTEHVNRDDNQRPAPAVQDGLYLVPKVIE 92


>gi|120403106|ref|YP_952935.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Mycobacterium
          vanbaalenii PYR-1]
 gi|166199380|sp|A1T6X9|GATC_MYCVP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|119955924|gb|ABM12929.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Mycobacterium vanbaalenii PYR-1]
          Length = 99

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 48/88 (54%), Gaps = 4/88 (4%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH--RP 64
          +V  +A  +R+++ + ++  F  +L+  L  + +I  V+V GVE   +  P+K V+  RP
Sbjct: 8  EVAHLARLARLALTDSELDSFAGQLDAILGHVGQIQTVDVTGVEATGN--PLKDVNVFRP 65

Query: 65 DVVCDGDKVESILSNAPHVEKNFFVVPK 92
          DV       E  L+ AP+ ++  F VP+
Sbjct: 66 DVEAPSLTQEQALAAAPNTDEGRFAVPR 93


>gi|161610375|ref|NP_886201.2| aspartyl/glutamyl-tRNA amidotransferase subunit C [Bordetella
           parapertussis 12822]
 gi|39931439|sp|Q7W3H8|GATC_BORPA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit C; Short=Asp/Glu-ADT subunit C
          Length = 102

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 49/102 (48%), Gaps = 7/102 (6%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVP--- 57
           M ++  DV RIA  + I +  +        LN  L ++E++  V+ +GVEP+   +    
Sbjct: 1   MALNEQDVARIARLALIELPPDQRGRAQAELNGILHLIERLQAVDTQGVEPLAHPLSAHE 60

Query: 58  -MKMVHRPDVVCDG---DKVESILSNAPHVEKNFFVVPKAVE 95
            + +  R D V +     +   +L+NAP      F+VPK +E
Sbjct: 61  DITLRLREDAVSEQATEARRAELLANAPESADGLFLVPKVIE 102


>gi|187934663|ref|YP_001884645.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Clostridium
          botulinum B str. Eklund 17B]
 gi|188589621|ref|YP_001919830.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Clostridium
          botulinum E3 str. Alaska E43]
 gi|251778843|ref|ZP_04821763.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum E1 str. 'BoNT E Beluga']
 gi|229487464|sp|B2UZ25|GATC_CLOBA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|229487465|sp|B2TIZ8|GATC_CLOBB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|187722816|gb|ACD24037.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum B str. Eklund 17B]
 gi|188499902|gb|ACD53038.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum E3 str. Alaska E43]
 gi|243083158|gb|EES49048.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Clostridium
          botulinum E1 str. 'BoNT E Beluga']
          Length = 97

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 46/85 (54%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ +A  +R+S  E++       LN  L+ +EK+ E++ E  + +V+   ++   R D 
Sbjct: 7  DVEYVAELARLSFNEDEKESLASDLNQILNYVEKLQELDTEKEDIIVNPYYIENKFREDE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
          +    K+E +L NAP   + + +VP
Sbjct: 67 ITPSIKLEEVLENAPKTLEEYVLVP 91


>gi|314934066|ref|ZP_07841429.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          caprae C87]
 gi|313653177|gb|EFS16936.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          caprae C87]
          Length = 100

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ IA+ +R+ I  E+       L + L   ++    + EGVEP   V+ ++ V R D 
Sbjct: 8  EVEHIANLARLQISSEETEEMANTLESILDFAKQNDSTDTEGVEPTYHVLDLQNVLRDDK 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
            +G   E  L NA   E   F VP
Sbjct: 68 AIEGIPQELALKNAKETEDGQFKVP 92


>gi|108798858|ref|YP_639055.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Mycobacterium
          sp. MCS]
 gi|119867973|ref|YP_937925.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Mycobacterium
          sp. KMS]
 gi|126434458|ref|YP_001070149.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Mycobacterium
          sp. JLS]
 gi|108769277|gb|ABG07999.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Mycobacterium sp. MCS]
 gi|119694062|gb|ABL91135.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Mycobacterium sp. KMS]
 gi|126234258|gb|ABN97658.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Mycobacterium sp. JLS]
          Length = 101

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+++ ++++  F  +L+  L  +  I  V+V GV P  + +    V RPD 
Sbjct: 10 EVAHLARLARLALSDDELDSFAGQLDAILGHVSTIQSVDVTGVRPTGNPLTDVNVMRPDA 69

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V  G   +  L  AP      F VP+
Sbjct: 70 VVPGLSQDQALDAAPKAVDGRFAVPR 95


>gi|224071988|ref|XP_002199619.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase, subunit C homolog
           (bacterial) [Taeniopygia guttata]
          Length = 164

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 30  RLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCDGDKVESILSNAPHVEKNFF 88
           RL   +   +++ EVN +GVEPM SV+  + ++ R D V +G+  + +L NA    + +F
Sbjct: 82  RLQKAIQFADQLHEVNTDGVEPMDSVLEDRCLYLREDDVTEGNCTKELLENAREKVEEYF 141

Query: 89  VVP 91
           V P
Sbjct: 142 VAP 144


>gi|161870225|ref|YP_001599395.1| Glu-tRNA(Gln) amidotransferase subunit C [Neisseria meningitidis
           053442]
 gi|161595778|gb|ABX73438.1| Glu-tRNA(Gln) amidotransferase subunit C [Neisseria meningitidis
           053442]
          Length = 133

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 36/68 (52%)

Query: 28  LLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNF 87
           L  LN+  +++E++  +N +G+EPM       +  R D V + D+     + AP V    
Sbjct: 65  LQELNDIFTMVEQMQTINTDGIEPMAHPHEAALRLREDEVTETDRAAEYQAVAPEVRNRL 124

Query: 88  FVVPKAVE 95
           ++VP+ +E
Sbjct: 125 YIVPQVIE 132


>gi|229817085|ref|ZP_04447367.1| hypothetical protein BIFANG_02341 [Bifidobacterium angulatum DSM
          20098]
 gi|229784874|gb|EEP20988.1| hypothetical protein BIFANG_02341 [Bifidobacterium angulatum DSM
          20098]
          Length = 99

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%)

Query: 11 IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
          +   +RI++ +E+I      LN     ++ + EV  + VEP  + +P++   RPDV    
Sbjct: 12 LGDLARIALSDEEITRLQGELNVIADSIDMVQEVATDDVEPTANPIPLEAYLRPDVPETP 71

Query: 71 DKVESILSNAPHVEKNFFVVPK 92
                L+  P  E   FV P+
Sbjct: 72 LTQAEALAGGPKTEAGMFVAPR 93


>gi|50978624|ref|NP_789788.1| gatC-like protein [Homo sapiens]
 gi|6224980|sp|O43716|GATCL_HUMAN RecName: Full=GatC-like protein; AltName: Full=Protein 15E1.2
 gi|2826893|emb|CAA16496.1| novel protein [Homo sapiens]
 gi|76828061|gb|AAI07146.1| Glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial)
           [Homo sapiens]
 gi|119618599|gb|EAW98193.1| hypothetical protein LOC283459 [Homo sapiens]
 gi|193787653|dbj|BAG52859.1| unnamed protein product [Homo sapiens]
          Length = 136

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCD 69
           I H  R+++ +      + RL   ++  +++  V+ +GVEPM SV+  + ++ R D V +
Sbjct: 37  IEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVE 96

Query: 70  GDKVESILSNAPHVEKNFFVVP 91
           G+  + +L N+  V + +FV P
Sbjct: 97  GNCADELLQNSHRVVEEYFVAP 118


>gi|114647284|ref|XP_001160510.1| PREDICTED: gatC-like protein-like isoform 3 [Pan troglodytes]
          Length = 135

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCD 69
           I H  R+++ +      + RL   ++  +++  V+ +GVEPM SV+  + ++ R D V +
Sbjct: 36  IEHLERLALVDFGSREAVTRLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVE 95

Query: 70  GDKVESILSNAPHVEKNFFVVP 91
           G+  + +L N+  V + +FV P
Sbjct: 96  GNCADELLQNSHRVVEEYFVAP 117


>gi|223044005|ref|ZP_03614045.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          capitis SK14]
 gi|222442548|gb|EEE48653.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          capitis SK14]
          Length = 100

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ IA+ +R+ I  E+       L + L   ++    + EGVEP   V+ ++ V R D 
Sbjct: 8  EVEHIANLARLQISSEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVLRDDK 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
            +G   E  L NA   E   F VP
Sbjct: 68 AIEGIPQELALKNAKETEDGQFKVP 92


>gi|78070632|gb|AAI07147.1| GATC protein [Homo sapiens]
          Length = 133

 Score = 42.4 bits (98), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCD 69
           I H  R+++ +      + RL   ++  +++  V+ +GVEPM SV+  + ++ R D V +
Sbjct: 34  IEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVE 93

Query: 70  GDKVESILSNAPHVEKNFFVVP 91
           G+  + +L N+  V + +FV P
Sbjct: 94  GNCADELLQNSHRVVEEYFVAP 115


>gi|33574687|emb|CAE39340.1| glutamyl-tRNA(GLN) amidotransferase subunit C [Bordetella
           parapertussis]
          Length = 121

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 49/102 (48%), Gaps = 7/102 (6%)

Query: 1   MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVP--- 57
           M ++  DV RIA  + I +  +        LN  L ++E++  V+ +GVEP+   +    
Sbjct: 20  MALNEQDVARIARLALIELPPDQRGRAQAELNGILHLIERLQAVDTQGVEPLAHPLSAHE 79

Query: 58  -MKMVHRPDVVCDG---DKVESILSNAPHVEKNFFVVPKAVE 95
            + +  R D V +     +   +L+NAP      F+VPK +E
Sbjct: 80  DITLRLREDAVSEQATEARRAELLANAPESADGLFLVPKVIE 121


>gi|22537809|ref|NP_688660.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          agalactiae 2603V/R]
 gi|76787528|ref|YP_330283.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          agalactiae A909]
 gi|76799140|ref|ZP_00781325.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          agalactiae 18RS21]
 gi|77406577|ref|ZP_00783625.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          agalactiae H36B]
 gi|77411902|ref|ZP_00788234.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          agalactiae CJB111]
 gi|39931558|sp|Q8DY24|GATC_STRA5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|123601361|sp|Q3JZM0|GATC_STRA1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|22534702|gb|AAN00533.1|AE014267_16 glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          agalactiae 2603V/R]
 gi|76562585|gb|ABA45169.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          agalactiae A909]
 gi|76585511|gb|EAO62084.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          agalactiae 18RS21]
 gi|77162062|gb|EAO73041.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          agalactiae CJB111]
 gi|77174802|gb|EAO77623.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          agalactiae H36B]
          Length = 100

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 47/95 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V+ +A+ S++   +++   F   L+  + ++E ++EV+ EGV    ++   K 
Sbjct: 1  MKISEEEVRHVANLSKLRFSDQETKEFASSLSKIVDMIELLNEVDTEGVPVTTTMADRKT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D+   G   + +  N P  +  +  VP  +E
Sbjct: 61 VMREDIAQPGHNRDDLFKNVPQHQDYYIKVPAILE 95


>gi|90022835|ref|YP_528662.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Saccharophagus degradans 2-40]
 gi|89952435|gb|ABD82450.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Saccharophagus degradans 2-40]
          Length = 93

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 45/89 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          D++++A  +R+ I +E +      +   L++++++   +  GV PM   +    + R D 
Sbjct: 5  DIEKLAKLARLEINDETLGEVANSITEVLALVDQLQAADTNGVAPMAHPLDAVQILRADE 64

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V + +  E   + AP  E   ++VPK +E
Sbjct: 65 VTEPNVREEFQAIAPATENGLYLVPKVIE 93


>gi|242371790|ref|ZP_04817364.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          epidermidis M23864:W1]
 gi|242350491|gb|EES42092.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          epidermidis M23864:W1]
          Length = 100

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ IA+ +R+ I  E+       L + L   ++    + EGVEP   V+ ++ V R D 
Sbjct: 8  EVEHIANLARLQITSEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVLRDDK 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
            +G   E  L NA   E   F VP
Sbjct: 68 AIEGIPQELALKNAKETEDGQFKVP 92


>gi|12842040|dbj|BAB25446.1| unnamed protein product [Mus musculus]
          Length = 155

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCD 69
           I H  R+++        + RL   ++  +++  V+ +GVEP+ SV+  + ++ R D V  
Sbjct: 55  IEHLERLALVNFGSREAVDRLEKAIAFADQLHAVDTDGVEPLKSVLEDRCLYLRSDNVAK 114

Query: 70  GDKVESILSNAPHVEKNFFVVP 91
           G   E +L N+ HV + +FV P
Sbjct: 115 GSCAEKLLQNSNHVVEEYFVAP 136


>gi|329936844|ref|ZP_08286523.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptomyces
          griseoaurantiacus M045]
 gi|329303769|gb|EGG47653.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptomyces
          griseoaurantiacus M045]
          Length = 98

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +K E++  F  +L++ +  + +++EV  + V P    +P+  V R D 
Sbjct: 8  EVAHLARLARLELKPEELDHFAGQLDDIIGAVARVAEVADQDVPPTSHPLPLTNVMRADE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V         LS AP  E+  F VP+
Sbjct: 68 VRPSLTPAQALSGAPAQEQQRFKVPQ 93


>gi|242241739|ref|ZP_04796184.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          epidermidis W23144]
 gi|242234829|gb|EES37140.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          epidermidis W23144]
          Length = 100

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ IA+ +R+ I  E+       L + L   ++    + EG+EP   V+ ++ V R D 
Sbjct: 8  EVEHIANLARLQISSEETEEMTNTLESILDFAKQNDSADTEGIEPTYHVLDLQNVLRDDK 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
            +G   E  L NA   E   F VP
Sbjct: 68 AIEGIPQELALKNAKETEDGQFKVP 92


>gi|24215208|ref|NP_712689.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Leptospira
          interrogans serovar Lai str. 56601]
 gi|45657335|ref|YP_001421.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Leptospira
          interrogans serovar Copenhageni str. Fiocruz L1-130]
 gi|39931569|sp|Q8F3A0|GATC_LEPIN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|59797805|sp|Q72SC4|GATC_LEPIC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|24196288|gb|AAN49707.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Leptospira
          interrogans serovar Lai str. 56601]
 gi|45600573|gb|AAS70058.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Leptospira
          interrogans serovar Copenhageni str. Fiocruz L1-130]
          Length = 96

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 47/95 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I+   +++IA  SR+ I+ E+    L   N  L  +++I  ++V  ++     +  + 
Sbjct: 1  MNINEDSLQKIAELSRLKIRSEEKEATLQDFNKILEYVDQIKGLDVSSIKDDEIYLHHEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD+       E I S AP  +  +FVVPK +E
Sbjct: 61 AIRPDLAGKHLSREEIESFAPSFQNGYFVVPKVIE 95


>gi|251809895|ref|ZP_04824368.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          epidermidis BCM-HMP0060]
 gi|282874549|ref|ZP_06283434.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          epidermidis SK135]
 gi|251806560|gb|EES59217.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          epidermidis BCM-HMP0060]
 gi|281296688|gb|EFA89197.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          epidermidis SK135]
 gi|319399866|gb|EFV88113.1| glutamyl-tRNA [Staphylococcus epidermidis FRI909]
 gi|329734828|gb|EGG71133.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Staphylococcus epidermidis VCU028]
          Length = 100

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ IA+ +R+ I  E+       L + L   ++    + EG+EP   V+ ++ V R D 
Sbjct: 8  EVEHIANLARLQISSEETEEMANTLESILDFAKQNDSADTEGIEPTYHVLDLQNVLRDDK 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
            +G   E  L NA   E   F VP
Sbjct: 68 AIEGIPQELALKNAKETEDGQFKVP 92


>gi|297693176|ref|XP_002823912.1| PREDICTED: gatC-like protein-like isoform 1 [Pongo abelii]
          Length = 191

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCD 69
           I H  R+++ +      + RL   ++  +++  V+ +GVEPM SV+  + ++ R D V +
Sbjct: 92  IEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRRLYLRSDNVVE 151

Query: 70  GDKVESILSNAPHVEKNFFVVP 91
           G+  + +L N+  V + +FV P
Sbjct: 152 GNCADELLQNSHRVVEEYFVAP 173


>gi|33860794|ref|NP_892355.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
 gi|39931396|sp|Q7V354|GATC_PROMP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|33633736|emb|CAE18694.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Prochlorococcus
          marinus subsp. pastoris str. CCMP1986]
          Length = 97

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 44/88 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +VK++A  +R+ + E +I     +L   L  ++++ ++N E +      + +  V R D 
Sbjct: 8  EVKKVAQLARLELNESEINQHAEQLEKILEYIKQLEKINTEDIPCTTRAIEVVNVLRKDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
            + +  E IL  AP  E  FF VPK +
Sbjct: 68 KKNYENSEEILDLAPSRENKFFKVPKII 95


>gi|312131486|ref|YP_003998826.1| glutamyl-tRNA(gln) amidotransferase, c subunit [Leadbetterella
          byssophila DSM 17132]
 gi|311908032|gb|ADQ18473.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Leadbetterella
          byssophila DSM 17132]
          Length = 94

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 45/92 (48%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   +K+IA+ +R+ +  E+        +  L+ ++++ EV+  GV PM  +     
Sbjct: 1  MPIDKETIKKIANLARLELSPEEELQLAQDADQILNWIQQLEEVDTSGVIPMTHIHANVN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
            R D+  +G   E  L NAP  +  +F V K
Sbjct: 61 DFRSDIAHNGLSREEGLKNAPSHDGEYFKVNK 92


>gi|256824832|ref|YP_003148792.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Kytococcus sedentarius DSM 20547]
 gi|256688225|gb|ACV06027.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Kytococcus sedentarius DSM 20547]
          Length = 98

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV  +A+ +RI ++ +++     +L+  +  + +IS+   + V  M   +PM  V RPD 
Sbjct: 8  DVAHVANLARIHLEPDELDRLAGQLDQIVEWVAQISDGASDDVPAMSHPIPMTNVMRPDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V  G   +  LS AP   +  F VP+
Sbjct: 68 VRPGLTQDQALSGAPLAVEGRFGVPR 93


>gi|123965502|ref|YP_001010583.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Prochlorococcus marinus str. MIT 9515]
 gi|166199388|sp|A2BUL5|GATC_PROM5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|123199868|gb|ABM71476.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Prochlorococcus
          marinus str. MIT 9515]
          Length = 97

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 44/88 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +VK++A  +R+ + E +I     +L   L  ++++ ++N E +      + +  V R D 
Sbjct: 8  EVKKVAELARLELNENEIHQHAEQLEKILEYIKQLEKINTENIACTTRAIEVVNVLRKDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAV 94
            D +  + +L  AP  E  FF VPK +
Sbjct: 68 RRDYENSDELLDLAPSRENKFFKVPKII 95


>gi|302337563|ref|YP_003802769.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Spirochaeta
          smaragdinae DSM 11293]
 gi|301634748|gb|ADK80175.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Spirochaeta
          smaragdinae DSM 11293]
          Length = 92

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 48/90 (53%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          ++  ++   A  +R+S+ EE+  +    +   L  + ++ EV++EG+EP    +  + + 
Sbjct: 1  METRELYETASLARLSLGEEEAAVLAEEVGRLLEYVSRMQEVDIEGLEPTTHALSEEPIL 60

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          R D V   +  +S+L NAP +E  F V+P 
Sbjct: 61 RNDEVHGENLSDSLLDNAPELEDRFIVIPN 90


>gi|91773614|ref|YP_566306.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Methanococcoides burtonii DSM 6242]
 gi|121686707|sp|Q12VH0|GATC_METBU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|91712629|gb|ABE52556.1| Aspartyl/Glutamyl-tRNA (Asn/Gln) amidotransferase subunit C
          [Methanococcoides burtonii DSM 6242]
          Length = 93

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 42/86 (48%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ +   +RI I   +   + ++L++ L    ++ EV+ EGVEP   V  +  V R DV
Sbjct: 6  EVEHVGWLARIEIGAAEAEDYAVKLSSVLDYFGQLDEVDTEGVEPTYHVADIMNVFREDV 65

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      + +L+N    +  +   P+
Sbjct: 66 VKPSLDQKDVLANTAEEKDGYIKAPR 91


>gi|296213102|ref|XP_002753132.1| PREDICTED: gatC-like protein-like [Callithrix jacchus]
          Length = 136

 Score = 41.6 bits (96), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 46/84 (54%), Gaps = 1/84 (1%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCD 69
           I H  R+++ +      + RL   ++  +++  V+ +GVEPM SV+  + ++ R D V +
Sbjct: 37  IEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVE 96

Query: 70  GDKVESILSNAPHVEKNFFVVPKA 93
           G+  + +L N+  V + +FV P  
Sbjct: 97  GNCADELLQNSHRVVEEYFVAPPG 120


>gi|294790558|ref|ZP_06755716.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Scardovia
          inopinata F0304]
 gi|294458455|gb|EFG26808.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Scardovia
          inopinata F0304]
          Length = 97

 Score = 41.6 bits (96), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +++ +   SRI++ +++I      LN     ++K+ EV  + V P  + VP++   R D 
Sbjct: 8  EIEHLGDLSRIALTDQEIERLQGELNVITDSIDKVQEVAKDHVPPTANPVPLEAYMREDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
                 E  LS AP  E+  FV P+
Sbjct: 68 PIAPLTQEEALSGAPRQEEGMFVAPQ 93


>gi|297170498|gb|ADI21528.1| Asp-tRNAAsn/glu-tRNAGln amidotransferase C subunit [uncultured
          verrucomicrobium HF0070_15G23]
          Length = 69

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 34/66 (51%)

Query: 30 RLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFV 89
          +L+  L  ++K+ E+NV+ VEP     P+  V R D +      +  L NAP      F+
Sbjct: 4  QLSEVLGFVDKLKELNVDDVEPTAHASPLNNVLRKDELDASLCRDDALRNAPECSNGLFI 63

Query: 90 VPKAVE 95
          VPK VE
Sbjct: 64 VPKIVE 69


>gi|269217156|ref|ZP_06161010.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Slackia exigua ATCC
           700122]
 gi|269129293|gb|EEZ60378.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Slackia exigua ATCC
           700122]
          Length = 154

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 2/87 (2%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVS-VVPMKMVHRPD 65
           DV+ IA ++R+ + + +     + LN+ +  L+ I   +++GVEP    +  +  V R D
Sbjct: 60  DVRSIATYARVGLDDAEAAQMTVDLNSIIDTLQPIRGFDLDGVEPTFHPIGSLSNVMRED 119

Query: 66  VVCDGD-KVESILSNAPHVEKNFFVVP 91
           V        E  L+NAP  +   F++P
Sbjct: 120 VESGASFTQEEALANAPKQQDGCFLIP 146


>gi|114647280|ref|XP_001160403.1| PREDICTED: similar to 15E1.2 (novel protein) isoform 1 [Pan
           troglodytes]
          Length = 191

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCD 69
           I H  R+++ +      + RL   ++  +++  V+ +GVEPM SV+  + ++ R D V +
Sbjct: 92  IEHLERLALVDFGSREAVTRLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVE 151

Query: 70  GDKVESILSNAPHVEKNFFVVP 91
           G+  + +L N+  V + +FV P
Sbjct: 152 GNCADELLQNSHRVVEEYFVAP 173


>gi|170069481|ref|XP_001869240.1| 15E1.2 protein [Culex quinquefasciatus]
 gi|167865431|gb|EDS28814.1| 15E1.2 protein [Culex quinquefasciatus]
          Length = 173

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 6   VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPM-KMVHRP 64
           VD + +    R+S+ + D       L + +    +I  V+ EGVEP+ +V+   ++  R 
Sbjct: 75  VDAQTVQLLERLSLVDLDSAEAHRTLEDAIEFASQILSVDTEGVEPLYTVLERERLTLRE 134

Query: 65  DVVCDGDKVESILSNAPHVEKNFFVVP 91
           D V DG+  + +L NA   E+ +FV P
Sbjct: 135 DRVTDGNIQQDVLRNARVTEEEYFVAP 161


>gi|239638042|ref|ZP_04679001.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          warneri L37603]
 gi|239596325|gb|EEQ78863.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          warneri L37603]
 gi|330685615|gb|EGG97261.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Staphylococcus epidermidis VCU121]
          Length = 100

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ IA+ +R+ I  E+       L + L   ++    + EGVEP   V+ ++ V R D 
Sbjct: 8  EVEHIANLARLQISPEETDEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVLREDK 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
            +G   E  L NA   E   F VP
Sbjct: 68 AIEGIPQELALKNAKETENGQFKVP 92


>gi|257790826|ref|YP_003181432.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Eggerthella lenta
          DSM 2243]
 gi|257474723|gb|ACV55043.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Eggerthella lenta
          DSM 2243]
          Length = 103

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVS-VVPMKMVHRPD 65
          DV+ IA ++RI +  +++    + LN  +  L+ I+E +++GVEP    +  +  V R D
Sbjct: 9  DVRSIAEYARIGLDADEVVQMTVDLNAIIDSLKPITEYDLDGVEPTFHPIGGLSNVMRED 68

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVPK 92
                     L NAP  +   F++P 
Sbjct: 69 EESSSFTQGEALENAPKQQDGCFLIPS 95


>gi|271969277|ref|YP_003343473.1| glutamyl-tRNA(gln) amidotransferase subunit C [Streptosporangium
          roseum DSM 43021]
 gi|270512452|gb|ACZ90730.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptosporangium
          roseum DSM 43021]
          Length = 99

 Score = 41.6 bits (96), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 47/86 (54%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ +E++  F  +L+  +  + +++EV  + + P    +P+  V+RPD 
Sbjct: 8  EVAHLARLSRLALADEELDHFAAQLDVIIGAVARVAEVAADDIPPSSHALPLTNVYRPDE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      +  LS AP VE   F VP+
Sbjct: 68 VRPSLTPDQALSGAPAVEDGRFRVPR 93


>gi|259502573|ref|ZP_05745475.1| glutamyl-tRNA(Gln) amidotransferase [Lactobacillus antri DSM 16041]
 gi|259169463|gb|EEW53958.1| glutamyl-tRNA(Gln) amidotransferase [Lactobacillus antri DSM 16041]
          Length = 116

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 43/87 (49%), Gaps = 2/87 (2%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD- 65
           +VK +A  +++   + ++  F  +L + + + E+I+  + +GVEPM +        R D 
Sbjct: 20  EVKHVAELAKLEFPQAELEQFTTQLGSIIDMFEEIANEDTDGVEPMTNATDRVNAMREDK 79

Query: 66  -VVCDGDKVESILSNAPHVEKNFFVVP 91
            V    ++  ++L NAP     +  VP
Sbjct: 80  AVKASPEETAALLKNAPDAADGYIRVP 106


>gi|325186159|emb|CCA20662.1| conserved hypothetical protein [Albugo laibachii Nc14]
          Length = 160

 Score = 41.6 bits (96), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 12/91 (13%)

Query: 11  IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPM------VSVVPMKMVHRP 64
           +A  S ISI  + +P    R+ + L  ++ + E NV+G           +V P+    R 
Sbjct: 75  LAKLSHISIHSDQLPEVSTRIESVLRCMQTVQESNVDGYTTKEVASHDFAVTPL----RD 130

Query: 65  DVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           DVV +  K++SIL NA      +F VPK  E
Sbjct: 131 DVVTERTKIDSILRNAESTP--YFRVPKVFE 159


>gi|153956069|ref|YP_001396834.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Clostridium
          kluyveri DSM 555]
 gi|219856404|ref|YP_002473526.1| hypothetical protein CKR_3061 [Clostridium kluyveri NBRC 12016]
 gi|146348927|gb|EDK35463.1| GatC [Clostridium kluyveri DSM 555]
 gi|219570128|dbj|BAH08112.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 95

 Score = 41.2 bits (95), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 50/94 (53%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I + DV+ +++ +R+  +E++    +  LN  L  +EK+ E+  E    +V+   M+ 
Sbjct: 1  MTITIKDVEYVSNLARLEFEEKEKVKLVKDLNKILEYMEKLDELYTEEENIIVNPYYMEN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAV 94
            R D++     ++ +L N+P   + + VVPK V
Sbjct: 61 KFREDILESSLDIQWVLDNSPGNFQEYIVVPKVV 94


>gi|314988024|gb|EFT32115.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Propionibacterium
           acnes HL005PA2]
          Length = 137

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 41/86 (47%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           DV R+A  +RI + +++ P    +L+  L  +  +S V  + V P    + +  V R DV
Sbjct: 45  DVVRLAGLARIDLTDDETPYLAPQLDAILDAVAAVSGVATDDVPPTSHALLLSNVFREDV 104

Query: 67  VCDGDKVESILSNAPHVEKNFFVVPK 92
           + +       L+ AP  E   F VP+
Sbjct: 105 IKESMSSHDALAMAPRSENQRFRVPR 130


>gi|83816053|ref|YP_445406.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Salinibacter
          ruber DSM 13855]
 gi|294507287|ref|YP_003571345.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Salinibacter ruber
          M8]
 gi|123528942|sp|Q2S325|GATC_SALRD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|83757447|gb|ABC45560.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Salinibacter
          ruber DSM 13855]
 gi|294343615|emb|CBH24393.1| Glutamyl-tRNA(Gln) amidotransferase subunit C [Salinibacter ruber
          M8]
          Length = 95

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 44/89 (49%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          DV+ +A  +R+   EE+       L+  L  +EK+ E++  GV PM  V+ +  V R D 
Sbjct: 7  DVRHVAQLARLDFSEEEEARMAEELSEILGYVEKLDELDTAGVPPMSHVLDVTNVFRSDE 66

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          + +       L  AP  +   F+VP+ VE
Sbjct: 67 IEERIDRGQALEPAPDADNEHFLVPQVVE 95


>gi|268637852|ref|XP_638703.2| glutamyl-tRNA amidotransferase C subunit [Dictyostelium
          discoideum AX4]
 gi|284018090|sp|Q54PU2|GATCL_DICDI RecName: Full=GatC-like protein
 gi|256012915|gb|EAL65334.2| glutamyl-tRNA amidotransferase C subunit [Dictyostelium
          discoideum AX4]
          Length = 116

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 47/89 (52%), Gaps = 3/89 (3%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVV--PMKMVHRPD 65
          +K++++ + +SI E+ +  +   L   L+ +E I  VN E V P+ S++      +H   
Sbjct: 10 LKKLSNLAMLSIPEDKVEQYCDDLGGFLNSVESIQSVNTENVRPLHSILEDTQLTLHFEQ 69

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVPKAV 94
             + D  E IL ++ +V+  FF VPK +
Sbjct: 70 TTVNQDH-EHILDHSNNVQGGFFTVPKQI 97


>gi|326793291|ref|YP_004311112.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Clostridium lentocellum DSM 5427]
 gi|326544055|gb|ADZ85914.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Clostridium lentocellum DSM 5427]
          Length = 94

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 53/95 (55%), Gaps = 2/95 (2%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVS-VVPMKM 60
          ++D   +  +A  S+I I E +    +  ++  + +++ ++EV +EG E +    V +K 
Sbjct: 1  MLDTDLITYLAKLSKIEIDETEKERLVSEMSAIVELMDTMNEVTMEGDENLNGEGVSLKD 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          +   ++V   D+ E +L+NA H +  FFVVPK +E
Sbjct: 61 LRADEIVSSYDR-EVVLNNASHKKDGFFVVPKIME 94


>gi|157149759|ref|YP_001449751.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          gordonii str. Challis substr. CH1]
 gi|262282066|ref|ZP_06059835.1| glutamyl-tRNA(Gln) amidotransferase [Streptococcus sp. 2_1_36FAA]
 gi|322386763|ref|ZP_08060387.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          cristatus ATCC 51100]
 gi|189045179|sp|A8AVE1|GATC_STRGC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|157074553|gb|ABV09236.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptococcus
          gordonii str. Challis substr. CH1]
 gi|262262520|gb|EEY81217.1| glutamyl-tRNA(Gln) amidotransferase [Streptococcus sp. 2_1_36FAA]
 gi|321269045|gb|EFX51981.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          cristatus ATCC 51100]
          Length = 100

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A  S+++   E+   F   L+  + ++E ++EV+ EGV P  S V   +
Sbjct: 1  MKITQEEVSHVAKLSKLAFSPEETAEFATTLSKIVDMVELLNEVDTEGV-PFTSNVAANI 59

Query: 61 VH-RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
           + R DV   G   E +  N P  E+ +  VP
Sbjct: 60 NYMREDVAQPGWNREELFQNVPEKERGYIKVP 91


>gi|260904915|ref|ZP_05913237.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Brevibacterium
          linens BL2]
          Length = 101

 Score = 41.2 bits (95), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 46/85 (54%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V+ +A  SRI++ E+++      L+  LS + +++EV  + V      + +  V RPDVV
Sbjct: 12 VEHLASLSRIAMGEDELKSLAGDLSTILSNVARVNEVAGDDVPATSHPIALSNVLRPDVV 71

Query: 68 CDGDKVESILSNAPHVEKNFFVVPK 92
           +    E  L++AP    + F+VP+
Sbjct: 72 GETLTSEQALASAPASADDKFLVPQ 96


>gi|289550381|ref|YP_003471285.1| Aspartyl-tRNA(Asn) amidotransferase subunit C/Glutamyl-tRNA(Gln)
          amidotransferase subunit C [Staphylococcus lugdunensis
          HKU09-01]
 gi|289179913|gb|ADC87158.1| Aspartyl-tRNA(Asn) amidotransferase subunit C/Glutamyl-tRNA(Gln)
          amidotransferase subunit C [Staphylococcus lugdunensis
          HKU09-01]
          Length = 100

 Score = 41.2 bits (95), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ IA+ +R+ I  E+       L + L   ++      EGVEP   V+ ++ V R D 
Sbjct: 8  EVEHIANLARLQISPEETEEMATTLESILDFAKQNDSAATEGVEPTYHVLDLQNVLREDK 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
            +G   E  L NA   E   F VP
Sbjct: 68 AQEGIPQELALKNAKETEDGQFKVP 92


>gi|326437069|gb|EGD82639.1| hypothetical protein PTSG_03296 [Salpingoeca sp. ATCC 50818]
          Length = 308

 Score = 41.2 bits (95), Expect = 0.049,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 35/62 (56%)

Query: 31  LNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFVV 90
           ++ TL+ +E++  V+  GVEP+VS+      H  +     D    +L+NAP   ++FFV 
Sbjct: 81  ISRTLAFIEQVQLVDTTGVEPLVSLSEFSHDHLREDAPTKDSAVDVLANAPEKFQDFFVA 140

Query: 91  PK 92
           P+
Sbjct: 141 PR 142


>gi|34556977|ref|NP_906792.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Wolinella
          succinogenes DSM 1740]
 gi|39931330|sp|Q7MSD5|GATC_WOLSU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|34482692|emb|CAE09692.1| hypothetical protein WS0558 [Wolinella succinogenes]
          Length = 96

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 49/96 (51%), Gaps = 1/96 (1%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   + R+   + I + EE        L   ++ +E ++ + VEG+E   + +  K 
Sbjct: 1  MQIDDKLLARLESLAMIEVPEEKKESIKAELGEIVNFVENLNSLEVEGLEATFTTLEGKT 60

Query: 61 VHRPDVVCDGDKVES-ILSNAPHVEKNFFVVPKAVE 95
            R D   + +++ + IL +AP   +N+F+VPK +E
Sbjct: 61 PMREDTPMNDEEIPALILKHAPQSAENYFIVPKIIE 96


>gi|297620975|ref|YP_003709112.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Waddlia
          chondrophila WSU 86-1044]
 gi|297376276|gb|ADI38106.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Waddlia
          chondrophila WSU 86-1044]
          Length = 99

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVP-MKMVHRPDV 66
          ++ ++  SRI + EE+    L  L   L+ ++ ++EV+ EGVEP   V+  M+ V R D 
Sbjct: 9  IEYLSDLSRIDLSEEEQQSLLEDLEKILAYIDLLNEVDTEGVEPCNHVLADMRNVMREDE 68

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
          V +    E+ L+NAP        VP
Sbjct: 69 VGETMPREAFLNNAPAQIGGMIRVP 93


>gi|315924261|ref|ZP_07920485.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Pseudoramibacter
          alactolyticus ATCC 23263]
 gi|315622422|gb|EFV02379.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Pseudoramibacter
          alactolyticus ATCC 23263]
          Length = 95

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 46/95 (48%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   DV  +A+ +R+          +  L++ L  +  ++EV+   V     ++P+K 
Sbjct: 1  MSISKEDVTYVANLARLRFDGAATEKMVKELDSVLDYVNTLNEVDTTDVAATEHILPVKN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V+R D + +    E  L+NAP  E   F VP+ +E
Sbjct: 61 VYRKDEIGESLPNEVALANAPDSENGCFKVPRVLE 95


>gi|190570676|ref|YP_001975034.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|213019076|ref|ZP_03334883.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|190356948|emb|CAQ54334.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|212995185|gb|EEB55826.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 117

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 2/86 (2%)

Query: 10  RIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVC 68
           + A   RI + +++I  +   L     + + + +VN EGV PM      K +H R D++ 
Sbjct: 31  KTAQLVRIKLSDDEIQYYSKELTMLDWIHDTLLKVNTEGVSPMRYGTIDKDIHVRDDIIN 90

Query: 69  DGDKVESILSNAPHVEKNFFVVPKAV 94
             +  E ILSN    E  +FVVPK +
Sbjct: 91  SQNIKEEILSNTKS-EHGYFVVPKVI 115


>gi|189219703|ref|YP_001940344.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit
           [Methylacidiphilum infernorum V4]
 gi|189186561|gb|ACD83746.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit
           [Methylacidiphilum infernorum V4]
          Length = 107

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 46/90 (51%)

Query: 6   VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPD 65
           +D++ +A  +RIS+  ++  +F  + ++ L  +EK+ EV ++ V         +   R D
Sbjct: 18  MDIEYVADLARISLSPDEKKIFGEQFSSILDYIEKLKEVKIDDVVLKGEEEGFENNLRED 77

Query: 66  VVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +      VE  L NAP    N F+VPK +E
Sbjct: 78  IPLKSFTVEEALRNAPSEFNNLFIVPKIIE 107


>gi|154488133|ref|ZP_02029250.1| hypothetical protein BIFADO_01704 [Bifidobacterium adolescentis
          L2-32]
 gi|154083606|gb|EDN82651.1| hypothetical protein BIFADO_01704 [Bifidobacterium adolescentis
          L2-32]
          Length = 98

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%)

Query: 11 IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
          +   +RI++ +E+I      LN     + K+ EV  + VEP  + VP++   RPDV    
Sbjct: 12 LGDLARIALTDEEITRLQGDLNVIAESINKVQEVATDDVEPTANPVPLEAYLRPDVPETP 71

Query: 71 DKVESILSNAPHVEKNFFVVPK 92
                 + AP  E   FV P+
Sbjct: 72 LTQAEATAGAPVSETGMFVAPR 93


>gi|315660153|ref|ZP_07913010.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Staphylococcus
           lugdunensis M23590]
 gi|315494834|gb|EFU83172.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Staphylococcus
           lugdunensis M23590]
          Length = 109

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           +V+ IA+ +R+ I  E+       L + L   ++      EGVEP   V+ ++ V R D 
Sbjct: 17  EVEHIANLARLQISPEETEEMATTLESILDFAKQNDSAATEGVEPTYHVLDLQNVLREDK 76

Query: 67  VCDGDKVESILSNAPHVEKNFFVVP 91
             +G   E  L NA   E   F VP
Sbjct: 77  AQEGIPQELALKNAKETEDGQFKVP 101


>gi|125717429|ref|YP_001034562.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptococcus
          sanguinis SK36]
 gi|323353266|ref|ZP_08087799.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis VMC66]
 gi|166218187|sp|A3CLF7|GATC_STRSV RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|125497346|gb|ABN44012.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C,
          putative [Streptococcus sanguinis SK36]
 gi|322121212|gb|EFX92975.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis VMC66]
 gi|324990752|gb|EGC22688.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis SK353]
 gi|324993493|gb|EGC25413.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis SK405]
 gi|324995197|gb|EGC27109.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis SK678]
 gi|325690284|gb|EGD32288.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis SK115]
 gi|325693545|gb|EGD35464.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis SK150]
 gi|325696981|gb|EGD38868.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis SK160]
 gi|327458857|gb|EGF05205.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis SK1057]
 gi|327461764|gb|EGF08095.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis SK1]
 gi|327473501|gb|EGF18921.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis SK408]
 gi|327489049|gb|EGF20844.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis SK1058]
 gi|328945670|gb|EGG39821.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis SK1087]
 gi|332360522|gb|EGJ38332.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis SK1056]
 gi|332363920|gb|EGJ41699.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis SK355]
          Length = 100

 Score = 41.2 bits (95), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A  S+++   E+   F   L   + ++E ++EV+ EGV P  S V   +
Sbjct: 1  MKITQEEVSHVAKLSKLAFSPEETAEFATTLTKIVDMVELLNEVDTEGV-PFTSNVAANI 59

Query: 61 VH-RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
           + R DV   G   E +  N P  E+ +  VP
Sbjct: 60 NYMREDVAQPGWNREELFQNVPEKERGYIKVP 91


>gi|119026477|ref|YP_910322.1| aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Bifidobacterium adolescentis ATCC 15703]
 gi|166198841|sp|A1A3F7|GATC_BIFAA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|118766061|dbj|BAF40240.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bifidobacterium adolescentis ATCC 15703]
          Length = 98

 Score = 41.2 bits (95), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%)

Query: 11 IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
          +   +RI++ +E+I      LN     + K+ EV  + VEP  + VP++   RPDV    
Sbjct: 12 LGDLARIALTDEEITRLQGDLNVIAESINKVQEVATDDVEPTANPVPLEAYLRPDVPETP 71

Query: 71 DKVESILSNAPHVEKNFFVVPK 92
                 + AP  E   FV P+
Sbjct: 72 LTQAEATAGAPVSEAGMFVAPR 93


>gi|254390814|ref|ZP_05006026.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Streptomyces clavuligerus ATCC 27064]
 gi|294815252|ref|ZP_06773895.1| Aspartyl/glutamyl-tRNA Asn/Gln amidotransferase subunit C
          [Streptomyces clavuligerus ATCC 27064]
 gi|326443607|ref|ZP_08218341.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Streptomyces
          clavuligerus ATCC 27064]
 gi|197704513|gb|EDY50325.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Streptomyces clavuligerus ATCC 27064]
 gi|294327851|gb|EFG09494.1| Aspartyl/glutamyl-tRNA Asn/Gln amidotransferase subunit C
          [Streptomyces clavuligerus ATCC 27064]
          Length = 98

 Score = 41.2 bits (95), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +  +++  F  +L++ +  + +++EV  + V P    +P+  V R D 
Sbjct: 8  EVAHLARLARLELSGDELDHFAGQLDDIIGAVARVAEVADQDVPPTSHPLPLTNVMRADE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  LS AP  E+  F VP+
Sbjct: 68 VRPSLTPEQALSGAPAQEQQRFKVPQ 93


>gi|310826560|ref|YP_003958917.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Eubacterium
          limosum KIST612]
 gi|308738294|gb|ADO35954.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Eubacterium
          limosum KIST612]
          Length = 95

 Score = 41.2 bits (95), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 45/95 (47%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A  +R+   E +       L   L     +++++   V+P   ++P++ 
Sbjct: 1  MSITREEVTYVADLARLEFTETETDRLADELGAVLDYAATLNKLDTSDVKPTEHILPVQN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
          V R D V     +E +L+NAP  E   F VP+ +E
Sbjct: 61 VFRKDEVKPSLPIEKVLANAPESEAGCFKVPRVLE 95


>gi|225619714|ref|YP_002720971.1| putative Glu-tRNA(Gln) amidotransferase, C subunit [Brachyspira
          hyodysenteriae WA1]
 gi|225214533|gb|ACN83267.1| putative Glu-tRNA(Gln) amidotransferase, C subunit [Brachyspira
          hyodysenteriae WA1]
          Length = 107

 Score = 41.2 bits (95), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 45/91 (49%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M  D  +++ + + +R+ I+E      L RLN  L  +E + EVNV+G++P+  V+ +  
Sbjct: 1  MTTDREELEALLYQTRLRIEENQKDEMLDRLNKDLEFIEGLFEVNVDGIDPLYHVIDLPE 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
            R DV       E I+      E  + VVP
Sbjct: 61 YLREDVQGPTLDNEVIMDLCRSGEYGYIVVP 91


>gi|299139422|ref|ZP_07032597.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acidobacterium sp.
           MP5ACTX8]
 gi|298598691|gb|EFI54854.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acidobacterium sp.
           MP5ACTX8]
          Length = 113

 Score = 40.8 bits (94), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 8/97 (8%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV----- 61
           +V+ +A  + + +  E++P     LN  L  + +++E++   V PM  V  M        
Sbjct: 16  EVRHVADLANLELTAEELPRMARDLNAILGHIAELNELDTHDVPPMAQVAEMLGALPAMN 75

Query: 62  ---HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
               RPDVV        +++ AP  +  FF VPK +E
Sbjct: 76  GESLRPDVVKPSIDRALVMAEAPETDGRFFKVPKVIE 112


>gi|27468504|ref|NP_765141.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          epidermidis ATCC 12228]
 gi|57867373|ref|YP_189008.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          epidermidis RP62A]
 gi|293367785|ref|ZP_06614434.1| glutamyl-tRNA(Gln) amidotransferase [Staphylococcus epidermidis
          M23864:W2(grey)]
 gi|38372359|sp|Q8CRU2|GATC_STAES RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|71152067|sp|Q5HN33|GATC_STAEQ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|27316051|gb|AAO05185.1|AE016749_131 glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          epidermidis ATCC 12228]
 gi|57638031|gb|AAW54819.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          epidermidis RP62A]
 gi|291318124|gb|EFE58521.1| glutamyl-tRNA(Gln) amidotransferase [Staphylococcus epidermidis
          M23864:W2(grey)]
 gi|329726896|gb|EGG63354.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Staphylococcus epidermidis VCU144]
 gi|329734753|gb|EGG71059.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Staphylococcus epidermidis VCU045]
          Length = 100

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ IA+ +R+ I  E+       L + L   ++    + EG+EP   V+ ++ V R D 
Sbjct: 8  EVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGIEPTYHVLDLQNVLRDDK 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
            +G   E  L NA   E   F VP
Sbjct: 68 AIEGIPQELALKNAKETEDGQFKVP 92


>gi|300871505|ref|YP_003786378.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Brachyspira
          pilosicoli 95/1000]
 gi|300689206|gb|ADK31877.1| aspartyl/glutamyl-tRNA amidotransferase, subunit C [Brachyspira
          pilosicoli 95/1000]
          Length = 108

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 48/91 (52%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M  +  +++ + + +R+ I++      L RLN  L+ +E++ +VNV+ ++P+  V+ +  
Sbjct: 1  MTTNREELEALLYQTRLKIEDNQKDEMLNRLNKDLAFIEELFDVNVDNIDPLYHVIDLPE 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
            R DV  D  K E I+      E  + VVP
Sbjct: 61 YLREDVAGDTLKNEVIMDLCRSGEYGYIVVP 91


>gi|94985039|ref|YP_604403.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Deinococcus
          geothermalis DSM 11300]
 gi|166198863|sp|Q1IZV0|GATC_DEIGD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|94555320|gb|ABF45234.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Deinococcus
          geothermalis DSM 11300]
          Length = 96

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 45/94 (47%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          +ID   V  +A  +R+ +  E+       LN+ L   E++  V+ +GVE M     +  V
Sbjct: 1  MIDAAQVDHLARLARLELTPEERQSMQADLNSILGYFEQLRAVDTDGVEEMQRPEDLVNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           R DV  +    E + + AP ++  F  VP+ VE
Sbjct: 61 LRDDVPGEVFPPEVVAALAPEMQGGFVRVPRTVE 94


>gi|322433928|ref|YP_004216140.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acidobacterium sp.
           MP5ACTX9]
 gi|321161655|gb|ADW67360.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Acidobacterium sp.
           MP5ACTX9]
          Length = 107

 Score = 40.8 bits (94), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 50/97 (51%), Gaps = 8/97 (8%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPM-KMVH--- 62
           +V+R+A  + + +  E+ PL    LN  L  + ++++++  GV  M  V  + +M+    
Sbjct: 10  EVRRVAELANLELTPEEEPLMQRDLNAILGHVAELNQLDTTGVPAMAQVGELIQMIEDAA 69

Query: 63  ----RPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
               RPD +      +++++ AP  +  FF VPK +E
Sbjct: 70  GATLRPDQIRPSIDRKAVMACAPESDGRFFKVPKVIE 106


>gi|229823250|ref|ZP_04449319.1| hypothetical protein GCWU000282_00548 [Catonella morbi ATCC
          51271]
 gi|229787416|gb|EEP23530.1| hypothetical protein GCWU000282_00548 [Catonella morbi ATCC
          51271]
          Length = 98

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 44/94 (46%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
          ++   D+K +A  +++S  +  I  F    N  +  +E++ +V+ +GV P      +  V
Sbjct: 1  MVQPADIKHVAKLAKLSFDDSKIDAFTEEFNAIIDFVEQLEQVDTQGVAPTYHGNQLLNV 60

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
           R D    G + E +L+N    +  F  VP  +E
Sbjct: 61 FREDKAQAGVERELLLANVKTSKDGFIQVPAIME 94


>gi|296140574|ref|YP_003647817.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Tsukamurella
          paurometabola DSM 20162]
 gi|296028708|gb|ADG79478.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Tsukamurella
          paurometabola DSM 20162]
          Length = 98

 Score = 40.8 bits (94), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 46/86 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ +E++ +F  +L++ L  ++ +++V    V P+   V    V+R D 
Sbjct: 8  EVAHLARLSRLAVTDEELDVFATQLDSILEHVQVVTDVADADVAPLTLPVGTVNVNRADS 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
             G      L+ AP+ E + F VP+
Sbjct: 68 PVGGLTPAEALAGAPNREGDRFAVPR 93


>gi|317488466|ref|ZP_07947017.1| hypothetical protein HMPREF1023_00715 [Eggerthella sp. 1_3_56FAA]
 gi|325831990|ref|ZP_08165087.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Eggerthella sp. HGA1]
 gi|316912398|gb|EFV33956.1| hypothetical protein HMPREF1023_00715 [Eggerthella sp. 1_3_56FAA]
 gi|325486311|gb|EGC88763.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Eggerthella sp. HGA1]
          Length = 103

 Score = 40.8 bits (94), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVS-VVPMKMVHRPD 65
          DV+ IA ++RI +  +++    + LN  +  L+ I+E +++GVEP    +  +  V R D
Sbjct: 9  DVRSIAEYARIGLDADEVVQMTVDLNAIIDSLKPITEYDLDGVEPTFHPIGGLSNVMRED 68

Query: 66 VVCDGDKVESILSNAPHVEKNFFVVPK 92
                     L NAP  +   F++P 
Sbjct: 69 EESPSFTQGEALENAPKQQDGCFLIPS 95


>gi|330506574|ref|YP_004383002.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Methanosaeta
          concilii GP-6]
 gi|328927382|gb|AEB67184.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Methanosaeta
          concilii GP-6]
          Length = 93

 Score = 40.4 bits (93), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%)

Query: 30 RLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESILSNAPHVEKNFFV 89
          + N+ L    ++  V+ EGVEP   VV +  + R D+       +  L NAP  E  +F 
Sbjct: 29 QFNSILEYFHQLDLVDTEGVEPTYRVVDLANIFREDIARGSLTQDEALFNAPRRENGYFK 88

Query: 90 VPKAV 94
           P+ V
Sbjct: 89 SPRIV 93


>gi|326692436|ref|ZP_08229441.1| glutamyl-tRNA amidotransferase, subunit C [Leuconostoc argentinum
          KCTC 3773]
          Length = 102

 Score = 40.4 bits (93), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 43/85 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A+ ++++  + ++  F  +L + L++ + + EV+   VEP  SV       R DV
Sbjct: 10 EVAHVANLAKLAFDDAELEQFTTQLGDILNIFDTLGEVDTTDVEPTYSVTENVNHLRQDV 69

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
            +  + ++++ NAP        VP
Sbjct: 70 ADNWHQKQALVDNAPESAAGLIKVP 94


>gi|283456823|ref|YP_003361387.1| aspartyl/glutamyl-tRNA(asn/Gln) amidotransferase subunit C
          [Bifidobacterium dentium Bd1]
 gi|283103457|gb|ADB10563.1| GatC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Bifidobacterium dentium Bd1]
          Length = 89

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%)

Query: 11 IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
          +   +RI++ +E+I      LN     + K+ E+  + V P  + +P++   RPDV    
Sbjct: 3  LGDLARIALTDEEITRLQGDLNVIAESINKVQEIATDDVPPTANPIPLEAYLRPDVPQTP 62

Query: 71 DKVESILSNAPHVEKNFFVVPK 92
             E   + AP  E   FV P+
Sbjct: 63 LTQEEATAGAPVSEAGMFVAPR 84


>gi|254496606|ref|ZP_05109473.1| glutamyl/tRNA (Gln) amidotransferase, C subunit [Legionella
          drancourtii LLAP12]
 gi|254354174|gb|EET12842.1| glutamyl/tRNA (Gln) amidotransferase, C subunit [Legionella
          drancourtii LLAP12]
          Length = 91

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 18/88 (20%), Positives = 47/88 (53%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          +++IAH + + I+ +  P  +  ++  +  ++++  V+   V P+   + +    RPD +
Sbjct: 1  MEKIAHLAYLDIEVDHSPKLMQEISEIMDFVDQLRSVDTTEVAPLFHPLALHQRLRPDAI 60

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           + D +  + + AP  E N ++VP+ ++
Sbjct: 61 TEEDCLAELEALAPLFEDNLYLVPQVID 88


>gi|237756299|ref|ZP_04584854.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691547|gb|EEP60600.1| glutamyl-tRNA(Gln) amidotransferase, C subunit
          [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 86

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          ++++A  S + +KEE+I LF  +  + LS ++K++EV+V+   P   +   +   R D+ 
Sbjct: 10 IEKVAKLSNLKLKEEEIELFSNQFKDILSFIDKLNEVDVKDTLPFYELQIEEKSEREDIP 69

Query: 68 CDGDKVESILSNAPHVE 84
                E  L NA   E
Sbjct: 70 TGSITNEEALKNATQAE 86


>gi|160872515|ref|ZP_02062647.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rickettsiella
          grylli]
 gi|159121314|gb|EDP46652.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rickettsiella
          grylli]
          Length = 95

 Score = 40.4 bits (93), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 43/95 (45%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   DV ++A  ++I I  E++  +L  L N L +  ++ +V+   ++P+     +  
Sbjct: 1  MTITREDVNKMADLAKIQINAEEVTHYLTSLQNILKLARQMDDVDTMSIQPVAHPFGITQ 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            RPD + +    +       H E   + VP  +E
Sbjct: 61 RLRPDKITETVDRKDFQQLTAHTEAGLYCVPLVLE 95


>gi|23098219|ref|NP_691685.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Oceanobacillus
          iheyensis HTE831]
 gi|39931567|sp|Q8ES79|GATC_OCEIH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|22776444|dbj|BAC12720.1| glutamyl-tRNA (Gln) amidotransferase subunit C [Oceanobacillus
          iheyensis HTE831]
          Length = 96

 Score = 40.4 bits (93), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK +AH +R+ + +E +      L+  +   E+++E++ + VEP   V+ +K V R D  
Sbjct: 9  VKHVAHLARLELDDEAVEKMSDELSAIIDFAEQLNELDTDSVEPTTHVLNLKNVMRKDEP 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
                E  L NAP  +     VP  +E
Sbjct: 69 KKWISQEDALRNAPDHKDGQIRVPSILE 96


>gi|151222051|ref|YP_001332873.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus str. Newman]
 gi|172048961|sp|A6QIC9|GATC_STAAE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|150374851|dbj|BAF68111.1| glutamyl-tRNA amidotransferase subunit C [Staphylococcus aureus
          subsp. aureus str. Newman]
          Length = 100

 Score = 40.4 bits (93), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ IA+ +R+ I  E+       L + L   ++    + EGVEP   V+ ++ V R D 
Sbjct: 8  EVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVLREDK 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
             G   E  L NA   E   F VP
Sbjct: 68 AIKGIPQELALKNAKETEDGQFKVP 92


>gi|15924891|ref|NP_372425.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus Mu50]
 gi|15927475|ref|NP_375008.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus N315]
 gi|21283571|ref|NP_646659.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus MW2]
 gi|49484142|ref|YP_041366.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus MRSA252]
 gi|49486720|ref|YP_043941.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus MSSA476]
 gi|57652122|ref|YP_186786.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus COL]
 gi|82751555|ref|YP_417296.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus RF122]
 gi|87160559|ref|YP_494534.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus USA300_FPR3757]
 gi|88195800|ref|YP_500610.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus NCTC 8325]
 gi|148268374|ref|YP_001247317.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus JH9]
 gi|150394436|ref|YP_001317111.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus JH1]
 gi|156980217|ref|YP_001442476.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus Mu3]
 gi|161510124|ref|YP_001575783.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus USA300_TCH1516]
 gi|221140354|ref|ZP_03564847.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus str. JKD6009]
 gi|253316910|ref|ZP_04840123.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus str. CF-Marseille]
 gi|253729679|ref|ZP_04863844.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus USA300_TCH959]
 gi|253734989|ref|ZP_04869154.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus TCH130]
 gi|255006688|ref|ZP_05145289.2| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus Mu50-omega]
 gi|257426033|ref|ZP_05602455.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus 55/2053]
 gi|257428706|ref|ZP_05605101.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus 65-1322]
 gi|257431316|ref|ZP_05607692.1| glutamyl-tRNA(Gln) amidotransferase [Staphylococcus aureus subsp.
          aureus 68-397]
 gi|257434034|ref|ZP_05610385.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus E1410]
 gi|257436938|ref|ZP_05612980.1| glutamyl-tRNA(Gln) amidotransferase [Staphylococcus aureus subsp.
          aureus M876]
 gi|257793745|ref|ZP_05642724.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A9781]
 gi|258408887|ref|ZP_05681169.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A9763]
 gi|258421009|ref|ZP_05683940.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A9719]
 gi|258422978|ref|ZP_05685877.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A9635]
 gi|258430019|ref|ZP_05688389.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A9299]
 gi|258443463|ref|ZP_05691805.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A8115]
 gi|258445321|ref|ZP_05693512.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Staphylococcus
          aureus A6300]
 gi|258447885|ref|ZP_05696019.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A6224]
 gi|258451033|ref|ZP_05699069.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A5948]
 gi|258453318|ref|ZP_05701303.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A5937]
 gi|262049945|ref|ZP_06022805.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus D30]
 gi|262052807|ref|ZP_06024994.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus 930918-3]
 gi|269203554|ref|YP_003282823.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus ED98]
 gi|282894568|ref|ZP_06302796.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Staphylococcus aureus A8117]
 gi|282904532|ref|ZP_06312417.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus C160]
 gi|282906305|ref|ZP_06314157.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282909221|ref|ZP_06317037.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus WW2703/97]
 gi|282911526|ref|ZP_06319326.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus WBG10049]
 gi|282914699|ref|ZP_06322484.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus M899]
 gi|282917248|ref|ZP_06325003.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Staphylococcus aureus subsp. aureus D139]
 gi|282919736|ref|ZP_06327468.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit
          [Staphylococcus aureus subsp. aureus C427]
 gi|282923240|ref|ZP_06330921.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Staphylococcus aureus A9765]
 gi|282925140|ref|ZP_06332800.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Staphylococcus aureus subsp. aureus C101]
 gi|282928074|ref|ZP_06335681.1| gatC, aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Staphylococcus aureus A10102]
 gi|283771051|ref|ZP_06343942.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Staphylococcus aureus subsp. aureus H19]
 gi|283958662|ref|ZP_06376108.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus A017934/97]
 gi|284024948|ref|ZP_06379346.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus 132]
 gi|293507776|ref|ZP_06667618.1| aspartyl-tRNA/glutamyl-tRNA amidotransferase subunit C
          [Staphylococcus aureus subsp. aureus 58-424]
 gi|293510278|ref|ZP_06668984.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus M809]
 gi|293539333|ref|ZP_06672012.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus M1015]
 gi|294849450|ref|ZP_06790192.1| aspartyl-tRNA(Asn)/glutamyl-tRNA amidotransferase subunit C
          [Staphylococcus aureus A9754]
 gi|295407282|ref|ZP_06817081.1| aspartyl-tRNA(Asn)/glutamyl-tRNA amidotransferase subunit C
          [Staphylococcus aureus A8819]
 gi|295428483|ref|ZP_06821110.1| aspartyl-tRNA(Asn)/glutamyl-tRNA amidotransferase subunit C
          [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|296275667|ref|ZP_06858174.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus MR1]
 gi|297208931|ref|ZP_06925335.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus ATCC 51811]
 gi|297246193|ref|ZP_06930044.1| aspartyl-tRNA(Asn)/glutamyl-tRNA amidotransferase subunit C
          [Staphylococcus aureus A8796]
 gi|297590045|ref|ZP_06948685.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus MN8]
 gi|300913012|ref|ZP_07130450.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus TCH70]
 gi|304379089|ref|ZP_07361836.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus ATCC BAA-39]
 gi|56748959|sp|Q6G832|GATC_STAAS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|56749013|sp|Q6GFF6|GATC_STAAR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|56749851|sp|P68807|GATC_STAAM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|56749852|sp|P68808|GATC_STAAN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|56749853|sp|P68809|GATC_STAAU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|56749854|sp|P68810|GATC_STAAW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|71152066|sp|Q5HEM1|GATC_STAAC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|122539111|sp|Q2FWY8|GATC_STAA8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|123485183|sp|Q2FFJ4|GATC_STAA3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|123548137|sp|Q2YU75|GATC_STAAB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|166218184|sp|A7X428|GATC_STAA1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|189045176|sp|A6U306|GATC_STAA2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|189045177|sp|A5IU68|GATC_STAA9 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|189045178|sp|A8Z2R5|GATC_STAAT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|112490473|pdb|2DF4|C Chain C, Structure Of Trna-Dependent Amidotransferase Gatcab
          Complexed With Mn2+
 gi|112490492|pdb|2DQN|C Chain C, Structure Of Trna-Dependent Amidotransferase Gatcab
          Complexed With Asn
 gi|112490543|pdb|2F2A|C Chain C, Structure Of Trna-Dependent Amidotransferase Gatcab
          Complexed With Gln
 gi|112490677|pdb|2G5H|C Chain C, Structure Of Trna-Dependent Amidotransferase Gatcab
 gi|112490682|pdb|2G5I|C Chain C, Structure Of Trna-Dependent Amidotransferase Gatcab
          Complexed With Adp-Alf4
 gi|269914492|pdb|3IP4|C Chain C, The High Resolution Structure Of Gatcab
 gi|6578923|gb|AAF18135.1|AF205033_1 glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus]
 gi|13701694|dbj|BAB42987.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus N315]
 gi|14247673|dbj|BAB58063.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus Mu50]
 gi|21205012|dbj|BAB95707.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus MW2]
 gi|49242271|emb|CAG40978.1| glutamyl-tRNA amidotransferase subunit C [Staphylococcus aureus
          subsp. aureus MRSA252]
 gi|49245163|emb|CAG43629.1| glutamyl-tRNA amidotransferase subunit C [Staphylococcus aureus
          subsp. aureus MSSA476]
 gi|57286308|gb|AAW38402.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus COL]
 gi|82657086|emb|CAI81523.1| glutamyl-tRNA amidotransferase subunit C [Staphylococcus aureus
          RF122]
 gi|87126533|gb|ABD21047.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus USA300_FPR3757]
 gi|87203358|gb|ABD31168.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus NCTC 8325]
 gi|147741443|gb|ABQ49741.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Staphylococcus aureus subsp. aureus JH9]
 gi|149946888|gb|ABR52824.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus JH1]
 gi|156722352|dbj|BAF78769.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus Mu3]
 gi|160368933|gb|ABX29904.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus USA300_TCH1516]
 gi|253726565|gb|EES95294.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus USA300_TCH959]
 gi|253727171|gb|EES95900.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus TCH130]
 gi|257271176|gb|EEV03333.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus 55/2053]
 gi|257274350|gb|EEV05862.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus 65-1322]
 gi|257277965|gb|EEV08621.1| glutamyl-tRNA(Gln) amidotransferase [Staphylococcus aureus subsp.
          aureus 68-397]
 gi|257280960|gb|EEV11104.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus E1410]
 gi|257283727|gb|EEV13852.1| glutamyl-tRNA(Gln) amidotransferase [Staphylococcus aureus subsp.
          aureus M876]
 gi|257787717|gb|EEV26057.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A9781]
 gi|257840334|gb|EEV64796.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A9763]
 gi|257842957|gb|EEV67375.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A9719]
 gi|257846765|gb|EEV70780.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A9635]
 gi|257849613|gb|EEV73581.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A9299]
 gi|257851348|gb|EEV75288.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A8115]
 gi|257855839|gb|EEV78763.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Staphylococcus
          aureus A6300]
 gi|257858817|gb|EEV81686.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A6224]
 gi|257861275|gb|EEV84087.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A5948]
 gi|257864526|gb|EEV87269.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus A5937]
 gi|259159300|gb|EEW44357.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus 930918-3]
 gi|259161953|gb|EEW46535.1| glutamyl-tRNAGln amidotransferase subunit C [Staphylococcus
          aureus D30]
 gi|262075844|gb|ACY11817.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus ED98]
 gi|269941373|emb|CBI49770.1| glutamyl-tRNA amidotransferase subunit C [Staphylococcus aureus
          subsp. aureus TW20]
 gi|282313098|gb|EFB43496.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Staphylococcus aureus subsp. aureus C101]
 gi|282316374|gb|EFB46751.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit
          [Staphylococcus aureus subsp. aureus C427]
 gi|282318875|gb|EFB49230.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Staphylococcus aureus subsp. aureus D139]
 gi|282321413|gb|EFB51739.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus M899]
 gi|282324535|gb|EFB54847.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus WBG10049]
 gi|282326789|gb|EFB57086.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus WW2703/97]
 gi|282330502|gb|EFB60019.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Staphylococcus aureus subsp. aureus Btn1260]
 gi|282590138|gb|EFB95219.1| gatC, aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Staphylococcus aureus A10102]
 gi|282593151|gb|EFB98150.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Staphylococcus aureus A9765]
 gi|282595088|gb|EFC00055.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus C160]
 gi|282763055|gb|EFC03187.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Staphylococcus aureus A8117]
 gi|283459645|gb|EFC06736.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
          [Staphylococcus aureus subsp. aureus H19]
 gi|283471172|emb|CAQ50383.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus ST398]
 gi|283789702|gb|EFC28524.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus A017934/97]
 gi|285817582|gb|ADC38069.1| Aspartyl-tRNA(Asn) amidotransferase subunit C; Glutamyl-tRNA(Gln)
          amidotransferase subunit C [Staphylococcus aureus
          04-02981]
 gi|290919868|gb|EFD96937.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus M1015]
 gi|291094839|gb|EFE25107.1| aspartyl-tRNA/glutamyl-tRNA amidotransferase subunit C
          [Staphylococcus aureus subsp. aureus 58-424]
 gi|291466642|gb|EFF09162.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus M809]
 gi|294823587|gb|EFG40014.1| aspartyl-tRNA(Asn)/glutamyl-tRNA amidotransferase subunit C
          [Staphylococcus aureus A9754]
 gi|294967857|gb|EFG43887.1| aspartyl-tRNA(Asn)/glutamyl-tRNA amidotransferase subunit C
          [Staphylococcus aureus A8819]
 gi|295127465|gb|EFG57104.1| aspartyl-tRNA(Asn)/glutamyl-tRNA amidotransferase subunit C
          [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|296886421|gb|EFH25350.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus ATCC 51811]
 gi|297176900|gb|EFH36157.1| aspartyl-tRNA(Asn)/glutamyl-tRNA amidotransferase subunit C
          [Staphylococcus aureus A8796]
 gi|297577173|gb|EFH95887.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus MN8]
 gi|298695241|gb|ADI98463.1| glutamyl-tRNA amidotransferase subunit C [Staphylococcus aureus
          subsp. aureus ED133]
 gi|300885790|gb|EFK80997.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus TCH70]
 gi|302333566|gb|ADL23759.1| bifunctional aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Staphylococcus aureus subsp. aureus JKD6159]
 gi|302751774|gb|ADL65951.1| bifunctional aspartyl/glutamyl-tRNA amidotransferase subunit C
          [Staphylococcus aureus subsp. aureus str. JKD6008]
 gi|304342324|gb|EFM08216.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus ATCC BAA-39]
 gi|312437632|gb|ADQ76703.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus TCH60]
 gi|312830274|emb|CBX35116.1| glutamyl-tRNA(Gln) amidotransferase subunit C (Glu-ADTsubunit C)
          [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315129289|gb|EFT85283.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus CGS03]
 gi|315193431|gb|EFU23828.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus CGS00]
 gi|315196228|gb|EFU26583.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus subsp. aureus CGS01]
 gi|320139718|gb|EFW31587.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus MRSA131]
 gi|320142365|gb|EFW34179.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Staphylococcus
          aureus subsp. aureus MRSA177]
 gi|323439843|gb|EGA97559.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus O11]
 gi|323443006|gb|EGB00627.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Staphylococcus
          aureus O46]
 gi|329314578|gb|AEB88991.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Staphylococcus aureus subsp. aureus T0131]
 gi|329724835|gb|EGG61339.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Staphylococcus aureus subsp. aureus 21172]
 gi|329728647|gb|EGG65077.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Staphylococcus aureus subsp. aureus 21189]
 gi|329731532|gb|EGG67895.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
          [Staphylococcus aureus subsp. aureus 21193]
          Length = 100

 Score = 40.4 bits (93), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V+ IA+ +R+ I  E+       L + L   ++    + EGVEP   V+ ++ V R D 
Sbjct: 8  EVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVLREDK 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVP 91
             G   E  L NA   E   F VP
Sbjct: 68 AIKGIPQELALKNAKETEDGQFKVP 92


>gi|171742050|ref|ZP_02917857.1| hypothetical protein BIFDEN_01154 [Bifidobacterium dentium ATCC
          27678]
 gi|306824231|ref|ZP_07457601.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Bifidobacterium
          dentium ATCC 27679]
 gi|309801669|ref|ZP_07695789.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bifidobacterium
          dentium JCVIHMP022]
 gi|171277664|gb|EDT45325.1| hypothetical protein BIFDEN_01154 [Bifidobacterium dentium ATCC
          27678]
 gi|304552434|gb|EFM40351.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Bifidobacterium
          dentium ATCC 27679]
 gi|308221611|gb|EFO77903.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Bifidobacterium
          dentium JCVIHMP022]
          Length = 98

 Score = 40.4 bits (93), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%)

Query: 11 IAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDG 70
          +   +RI++ +E+I      LN     + K+ E+  + V P  + +P++   RPDV    
Sbjct: 12 LGDLARIALTDEEITRLQGDLNVIAESINKVQEIATDDVPPTANPIPLEAYLRPDVPQTP 71

Query: 71 DKVESILSNAPHVEKNFFVVPK 92
             E   + AP  E   FV P+
Sbjct: 72 LTQEEATAGAPVSEAGMFVAPR 93


>gi|90962318|ref|YP_536234.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Lactobacillus salivarius UCC118]
 gi|227892260|ref|ZP_04010065.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Lactobacillus salivarius ATCC 11741]
 gi|301299729|ref|ZP_07205979.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          salivarius ACS-116-V-Col5a]
 gi|122448659|sp|Q1WSH8|GATC_LACS1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|90821512|gb|ABE00151.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Lactobacillus salivarius UCC118]
 gi|227865901|gb|EEJ73322.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Lactobacillus salivarius ATCC 11741]
 gi|300852660|gb|EFK80294.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          salivarius ACS-116-V-Col5a]
          Length = 99

 Score = 40.4 bits (93), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 46/91 (50%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +VK +A  ++++ K+E++  F  +++  +++++++SEV+   V     V     
Sbjct: 1  MAIGSEEVKHVAGLAKLAFKDEELAKFTGQMDEIINMVQQLSEVDTTDVPVTTHVTDAIN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
            R DV   G   + ++ N P  +  +  VP
Sbjct: 61 TLREDVAVKGTDRDLLMKNVPQSQDGYIKVP 91


>gi|229815880|ref|ZP_04446204.1| hypothetical protein COLINT_02936 [Collinsella intestinalis DSM
          13280]
 gi|229808575|gb|EEP44353.1| hypothetical protein COLINT_02936 [Collinsella intestinalis DSM
          13280]
          Length = 104

 Score = 40.4 bits (93), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 3/89 (3%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVS-VVPMKMVHRPD 65
          DV+ IA ++ I++ E ++      LN+ +++LE I +   E VEP       +  V RPD
Sbjct: 8  DVRTIADYATIALDETELAAMTSYLNDAVAMLEPILDYAAEDVEPTFHPDGGIANVMRPD 67

Query: 66 VVCDGD--KVESILSNAPHVEKNFFVVPK 92
             +G    ++  LSNA       F VP 
Sbjct: 68 QADEGRALGIDEALSNAASARDGQFRVPS 96


>gi|269925181|ref|YP_003321804.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thermobaculum
          terrenum ATCC BAA-798]
 gi|269788841|gb|ACZ40982.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thermobaculum
          terrenum ATCC BAA-798]
          Length = 98

 Score = 40.4 bits (93), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 44/83 (53%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V  I+  +R+ + + ++ LF  +L++ +  + K+SE++ E + P   V+ +  V   D  
Sbjct: 8  VLHISRLARLGLTDAEVELFRDQLSSIIEHVNKLSELDTEAIPPTAQVIELLDVFAKDEP 67

Query: 68 CDGDKVESILSNAPHVEKNFFVV 90
                + +L+NAP  E+N F V
Sbjct: 68 STSYSTDEMLANAPEKEENCFKV 90


>gi|260655065|ref|ZP_05860553.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Jonquetella
          anthropi E3_33 E1]
 gi|260630176|gb|EEX48370.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Jonquetella
          anthropi E3_33 E1]
          Length = 100

 Score = 40.0 bits (92), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query: 10 RIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCD 69
          +I   +R+ I   ++        + LS  E + E++V  V+         M   PD + D
Sbjct: 11 KIGKLARLEIDPSELDALEKHFGSVLSYFEVLKELDVSSVDLADKEGAESMRLEPDEIGD 70

Query: 70 -GDKVESILSNAPHVEKNFFVVPK 92
           G   E+ILS AP  + +FF VPK
Sbjct: 71 SGSNREAILSQAPQRDGDFFRVPK 94


>gi|327469120|gb|EGF14592.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis SK330]
          Length = 100

 Score = 40.0 bits (92), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A  S+++   E+   F   L   + ++E ++EV+ EGV P  S V   +
Sbjct: 1  MKITQEEVSHVAKLSKLAFSSEETAEFATTLTKIVDMVELLNEVDTEGV-PFTSNVAANI 59

Query: 61 VH-RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
           + R DV   G   + +  N P  E+ +  VP
Sbjct: 60 NYMREDVAQPGWNRDELFQNVPEKERGYIKVP 91


>gi|18257344|gb|AAH21775.1| Gatc protein [Mus musculus]
          Length = 155

 Score = 40.0 bits (92), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (59%), Gaps = 1/62 (1%)

Query: 31  LNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVCDGDKVESILSNAPHVEKNFFV 89
           L   ++  +++  V+ +GVEP+ SV+  + ++ R D V +G   E +L N+ HV + +FV
Sbjct: 75  LEKAIAFADQLHAVDTDGVEPLESVLEDRCLYLRSDNVAEGSCAEELLQNSNHVVEEYFV 134

Query: 90  VP 91
            P
Sbjct: 135 AP 136


>gi|332363359|gb|EGJ41144.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis SK49]
          Length = 100

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A  S+++   E+   F   L   + ++E ++EV+ EGV P  S V   +
Sbjct: 1  MKITQEEVSHVAKLSKLAFSPEETAEFATTLTKIVDMVELLNEVDTEGV-PFTSNVAANI 59

Query: 61 VH-RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
           + R DV   G   E +  N P  E+ +  VP
Sbjct: 60 NYMREDVAQLGWNREELFQNVPEKERGYIKVP 91


>gi|189502031|ref|YP_001957748.1| hypothetical protein Aasi_0621 [Candidatus Amoebophilus asiaticus
          5a2]
 gi|189497472|gb|ACE06019.1| hypothetical protein Aasi_0621 [Candidatus Amoebophilus asiaticus
          5a2]
          Length = 99

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%)

Query: 10 RIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCD 69
          ++   +++ + EE+     + L+     +EK+ EV+ EGVEP+ ++       R D+   
Sbjct: 8  KLMRMAKLDLPEEEQREMSIDLDKICGWIEKLQEVDTEGVEPLTTLALEPPTLREDIPQP 67

Query: 70 GDKVESILSNAPHVEKNFFVVPK 92
              E  LS + + + N+F VPK
Sbjct: 68 PLNHEKALSTSKYSDSNYFRVPK 90


>gi|254383203|ref|ZP_04998556.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Streptomyces sp. Mg1]
 gi|194342101|gb|EDX23067.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Streptomyces sp. Mg1]
          Length = 98

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+ +  E++  F  +L++ +  + ++SEV  + V P    +P+  V R D 
Sbjct: 8  EVVHLARLARLELSGEELDHFAGQLDDIIGAVARVSEVADQDVPPTSHPLPLTNVMRADE 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V         LS AP  E+  F VP+
Sbjct: 68 VRPSLTPAQALSGAPAQEQQRFKVPQ 93


>gi|218289365|ref|ZP_03493599.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Alicyclobacillus
          acidocaldarius LAA1]
 gi|218240471|gb|EED07652.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Alicyclobacillus
          acidocaldarius LAA1]
          Length = 100

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          V  +A  +R+ +  +++   + +LN+ L    K+  V+++GVEP         V RPDV 
Sbjct: 8  VSHVAKLARLWLHPQELSQLVPQLNDILEYAAKLQSVSLDGVEPTSHPFHEVNVVRPDVP 67

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAVE 95
           +    E  L NAP  ++    VP  +E
Sbjct: 68 RESLSREEALRNAPDQDQGMVRVPAVLE 95


>gi|256847803|ref|ZP_05553248.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          coleohominis 101-4-CHN]
 gi|256715492|gb|EEU30468.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Lactobacillus
          coleohominis 101-4-CHN]
          Length = 103

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 41/89 (46%)

Query: 3  IDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH 62
          ID  +VK +A  +++S  +  +     +L   + +   + +V+ +GVEPM +      V 
Sbjct: 5  IDRQEVKHVADLAKLSFDDAALDKITPQLEEIIDLFTDLQKVDTDGVEPMYTPTTEHNVM 64

Query: 63 RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
          R D      + + +L+NAP        VP
Sbjct: 65 REDKGVQSGQRDELLANAPETHDGLIKVP 93


>gi|302524944|ref|ZP_07277286.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptomyces sp.
          AA4]
 gi|302433839|gb|EFL05655.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Streptomyces sp.
          AA4]
          Length = 99

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 46/86 (53%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  +R+++ ++++ +F  +L+  L  + K+SEV  E V P    VP+  V R D 
Sbjct: 8  EVAHLARLARLAVTDDELDVFAGQLDQILDSVAKVSEVAAEDVPPTSHAVPLTNVFREDT 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V    + +  L+ AP  E   F VP+
Sbjct: 68 VRPSLEQQDALAAAPAAEDGRFRVPR 93


>gi|56417090|ref|YP_154164.1| hypothetical protein AM1030 [Anaplasma marginale str. St. Maries]
 gi|254995263|ref|ZP_05277453.1| hypothetical protein AmarM_04800 [Anaplasma marginale str.
           Mississippi]
 gi|56388322|gb|AAV86909.1| hypothetical protein AM1030 [Anaplasma marginale str. St. Maries]
          Length = 106

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 2/91 (2%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEP-MVSVVPMKMVHRPD 65
           ++ R A   R+ + E ++  +   L N ++    +SEV+  GV+P +    P     R D
Sbjct: 16  ELARAARLVRLRVPEHEVDRYCEELGNVVAWFNMLSEVDTSGVDPVLYGGAPGPSQVRDD 75

Query: 66  VVCDGDKVESILSNAP-HVEKNFFVVPKAVE 95
           VV DG   + +LS++    E   F V K +E
Sbjct: 76  VVDDGGIRDQVLSHSEVGTEAGCFFVQKIIE 106


>gi|320108681|ref|YP_004184271.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Terriglobus
           saanensis SP1PR4]
 gi|319927202|gb|ADV84277.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Terriglobus
           saanensis SP1PR4]
          Length = 108

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 47/96 (48%), Gaps = 9/96 (9%)

Query: 7   DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
           +V+ +A  + + +  E+ P     LN  L  + ++SE++  GV P+  +   +++H  D 
Sbjct: 14  EVRHVASLANLQLTPEEEPHMQRDLNAVLGYIAELSELDTTGVPPLAQIT--ELLHEADS 71

Query: 67  V---CDGDKVE----SILSNAPHVEKNFFVVPKAVE 95
                D  +      +++  AP+ +  FF VPK +E
Sbjct: 72  TWLRADEQRPSVDRATVMQEAPNTDGRFFKVPKVIE 107


>gi|300743920|ref|ZP_07072940.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rothia
          dentocariosa M567]
 gi|311113172|ref|YP_003984394.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Rothia
          dentocariosa ATCC 17931]
 gi|300380281|gb|EFJ76844.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Rothia
          dentocariosa M567]
 gi|310944666|gb|ADP40960.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Rothia
          dentocariosa ATCC 17931]
          Length = 98

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 40/84 (47%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          VK +A  +RI + E+++      L+  +S +E +SE     + P    + ++ V R DVV
Sbjct: 9  VKHLAELARIEMTEDELNAMAAELDIIVSSMEHLSETVTPDIPPTSHPISLQNVLREDVV 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVP 91
                E  LS AP  +   F VP
Sbjct: 69 GQTLTQEEALSGAPDAQDGKFRVP 92


>gi|58698640|ref|ZP_00373534.1| glutamyl-tRNA [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225629901|ref|YP_002726692.1| glutamyl-tRNA(Gln) amidotransferase, C subunit, putative [Wolbachia
           sp. wRi]
 gi|225677116|ref|ZP_03788117.1| glutamyl-tRNA(Gln) amidotransferase, C subunit, putative [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|58534841|gb|EAL58946.1| glutamyl-tRNA [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225590844|gb|EEH12070.1| glutamyl-tRNA(Gln) amidotransferase, C subunit, putative [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|225591882|gb|ACN94901.1| glutamyl-tRNA(Gln) amidotransferase, C subunit, putative [Wolbachia
           sp. wRi]
          Length = 117

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 2/86 (2%)

Query: 10  RIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RPDVVC 68
           +IA   RI +  ++I  +   L     + + + +VN EGV PM      K +H R DV+ 
Sbjct: 31  KIAQLVRIKLSNDEIDHYSKELTMLDWIHDTLLQVNTEGVSPMRYGSIDKDIHVRDDVIN 90

Query: 69  DGDKVESILSNAPHVEKNFFVVPKAV 94
             +  E ILSN    E  +FVVPK +
Sbjct: 91  SQNIKEEILSNTK-PEHGYFVVPKVI 115


>gi|170032853|ref|XP_001844294.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167873251|gb|EDS36634.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 149

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 12  AHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPM-KMVHRPDVVCDG 70
           A   R+S+ + DI      L + +    +I  V+ +GVEP+ +V+   ++  R D V DG
Sbjct: 57  AQTVRLSLVDLDIAEAHRTLEDAIEFASQILSVDTDGVEPLYTVLERERLTLREDRVSDG 116

Query: 71  DKVESILSNAPHVEKNFFVVP 91
           +  + +L NA   E+ +FV P
Sbjct: 117 NIQQDVLRNARVTEEEYFVAP 137


>gi|195397710|ref|XP_002057471.1| GJ18086 [Drosophila virilis]
 gi|194141125|gb|EDW57544.1| GJ18086 [Drosophila virilis]
          Length = 157

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 6   VDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVH-RP 64
           +D K I    R+S+ + D    L  L +++   +KI+ ++ + V P+ +V+  + +  R 
Sbjct: 63  IDTKTIQLLERLSLVDLDSDQALATLKSSIQFADKIAHIDTQNVRPLYTVLEKQQLQLRN 122

Query: 65  DVVCDGDKVESILSNAPHVEKNFFVVP 91
           D V  GD    +L  A   +++++V P
Sbjct: 123 DQVTAGDSRAELLRCAKVTDEDYYVSP 149


>gi|213964416|ref|ZP_03392616.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Corynebacterium
          amycolatum SK46]
 gi|213952609|gb|EEB63991.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Corynebacterium
          amycolatum SK46]
          Length = 97

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 44/86 (51%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDV 66
          +V  +A  SR+++ + ++  F  +++  ++ ++ + +V  + VEPM     +  V R DV
Sbjct: 8  EVAHLARLSRLALTDAELDEFAGQIDGIINHVQAVQKVAADDVEPMSHPSSLSGVMREDV 67

Query: 67 VCDGDKVESILSNAPHVEKNFFVVPK 92
          V      E  L  AP  ++  F VP+
Sbjct: 68 VKPTLTAEQALDQAPSQDRQRFEVPQ 93


>gi|217076595|ref|YP_002334311.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thermosipho
          africanus TCF52B]
 gi|217036448|gb|ACJ74970.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Thermosipho
          africanus TCF52B]
          Length = 93

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 2/91 (2%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   ++ IA  +R+ I  E+   F+  +   +   E ++ V+ E +EPM + +    
Sbjct: 1  MKIDEKLIEEIAKLARLEI--ENKQEFINEMQKIVDYFELLNNVDTECIEPMYTPLESSA 58

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
            R +   D + VE I  N P  E N+  VP
Sbjct: 59 SLRENGAVDFENVEGIRENFPEREGNYLKVP 89


>gi|126642812|ref|YP_001085796.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Acinetobacter baumannii ATCC 17978]
          Length = 79

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 39/79 (49%)

Query: 17 ISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVVCDGDKVESI 76
          +S+ +     +   LN  L ++E +  ++ EGVEP+ S        R DVV + +  +  
Sbjct: 1  MSLNDTQSAEYAQSLNKILGMMETLKGIDTEGVEPLKSPFDNPQPLRADVVTESNHRDEY 60

Query: 77 LSNAPHVEKNFFVVPKAVE 95
           + AP  +   ++VP+ +E
Sbjct: 61 QAVAPATQDGLYLVPRVIE 79


>gi|260577527|ref|ZP_05845467.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Corynebacterium
          jeikeium ATCC 43734]
 gi|258604331|gb|EEW17568.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Corynebacterium
          jeikeium ATCC 43734]
          Length = 101

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 45/92 (48%), Gaps = 8/92 (8%)

Query: 7  DVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMK------M 60
          DV  +A  +R+ + E+++  +  +++  +  +  I +V+ EGVEP+    P +       
Sbjct: 8  DVAHLARLARLDLGEQELDEYAAQIDGIVDHVAAIGKVDTEGVEPLSH--PTQNVDGDVA 65

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPK 92
          V R DVV      E  L+ AP   +  F VP+
Sbjct: 66 VMREDVVVPSLTAEQALNQAPKQSEQRFEVPQ 97


>gi|223040227|ref|ZP_03610505.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Campylobacter
          rectus RM3267]
 gi|222878480|gb|EEF13583.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Campylobacter
          rectus RM3267]
          Length = 95

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 46/95 (48%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M ID   + ++   S + ++ +       +L+  L+    + E+++     +VS +    
Sbjct: 1  MQIDDTLLTKLEKLSSLKVESDKRKEIEGQLSEILTFAGILDELDLSASRAVVSSIEGGT 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVPKAVE 95
            R DV    D +E+IL NAP    +FFVVPK +E
Sbjct: 61 PLREDVSVSSDVIETILKNAPMSSGHFFVVPKIIE 95


>gi|328866314|gb|EGG14699.1| glutamyl-tRNA amidotransferase C subunit [Dictyostelium
           fasciculatum]
          Length = 194

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 48/99 (48%), Gaps = 11/99 (11%)

Query: 8   VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMK--MVHRPD 65
           ++ +A  S + +K+ DI  +  +L   L  ++ + +V+  GV+PM SV+     ++H  D
Sbjct: 70  LEHLASLSMLKLKDSDIDSYCKQLGGVLHAMDTMQQVDTTGVQPMHSVLENDHIIMHDED 129

Query: 66  VVCDGD---------KVESILSNAPHVEKNFFVVPKAVE 95
                          K ++IL ++     NF+ VPK V+
Sbjct: 130 TSSKDSDNNDDDVYLKTKTILQHSTSTIANFYKVPKRVK 168


>gi|332366170|gb|EGJ43926.1| glutamyl-tRNA(Gln) amidotransferase subunit C [Streptococcus
          sanguinis SK1059]
          Length = 100

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M I   +V  +A  S+++   E+   F   L   + ++E ++EV+ EGV P  S V   +
Sbjct: 1  MKITQEEVSHVAKLSKLAFSPEETAEFATTLTKIVDMVELLNEVDTEGV-PFTSNVAANI 59

Query: 61 VH-RPDVVCDGDKVESILSNAPHVEKNFFVVP 91
           + R DV   G   + +  N P  E+ +  VP
Sbjct: 60 NYMREDVTQPGWNRDELFQNVPEKERGYIKVP 91


>gi|146304503|ref|YP_001191819.1| aspartyl/glutamyl-tRNA amidotransferase subunit C [Metallosphaera
          sedula DSM 5348]
 gi|172046928|sp|A4YHJ3|GATC_METS5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
          subunit C; Short=Asp/Glu-ADT subunit C
 gi|145702753|gb|ABP95895.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
          [Metallosphaera sedula DSM 5348]
          Length = 97

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 8  VKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMVHRPDVV 67
          ++++   + IS+ +++   F+  L   L    KI E+N+EGVEPM   +    + RPD  
Sbjct: 10 MRKLEKLALISLTDQERQEFMRDLTKILDFFNKIDELNLEGVEPMFHPLSTGKL-RPDEP 68

Query: 68 CDGDKVESILSNAPHVEKNFFVVPKAV 94
                +  L+N P  +  + + P  +
Sbjct: 69 AQPLSRDDALANVPKKKDGYIIGPSTI 95


>gi|283781968|ref|YP_003372723.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Pirellula staleyi
          DSM 6068]
 gi|283440421|gb|ADB18863.1| glutamyl-tRNA(Gln) amidotransferase, C subunit [Pirellula staleyi
          DSM 6068]
          Length = 96

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 44/91 (48%)

Query: 1  MLIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKM 60
          M +   DV++I+   R+ +   ++     +L   +  +E++SE+N +GV+PM   + +  
Sbjct: 1  MALTRADVEKISLLGRLRLTPSELDTMTAQLGAIMHYVEQLSELNTDGVQPMAHALDIHN 60

Query: 61 VHRPDVVCDGDKVESILSNAPHVEKNFFVVP