PSIBLAST alignment of GI: 254780977 and protein with PDB id: 3al0

>gi|307776357|pdb|3AL0|C Chain C, Crystal Structure Of The Glutamine Transamidosome From Thermotoga Maritima In The Glutamylation State Length = 592
 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 37/90 (41%)

Query: 2  LIDVVDVKRIAHFSRISIKEEDIPLFLLRLNNTLSVLEKISEVNVEGVEPMVSVVPMKMV 61
           +    V  + + +R+ + E+     +      L  +E ++EV+VEGVEPM + V     
Sbjct: 4  KVTKDLVLHLENLARLELSEDQRESLMKDFQEILDYVELLNEVDVEGVEPMYTPVEDSAK 63

Query: 62 HRPDVVCDGDKVESILSNAPHVEKNFFVVP 91
           R       +  + I  N P  +     VP
Sbjct: 64 LRKGDPRFFEMRDLIKKNFPEEKDGHIKVP 93