HHsearch alignment for GI: 254780979 and conserved domain: COG1610

>COG1610 Uncharacterized conserved protein [Function unknown].
Probab=96.05  E-value=0.024  Score=37.75  Aligned_cols=97  Identities=19%  Similarity=0.217  Sum_probs=64.0

Q ss_pred             CCCCHHHHHHHH-HHHHCCCCCHHHHHHHHHHHHHCCC-C-------HHHHHHHCCCEECCCHHHHHHHHHHHHHHCHHH
Q ss_conf             648989999999-8886387314789999999981799-9-------889999639876189889999999999839998
Q gi|254780979|r  387 TPISPNQLGELI-DLIIDGTISGKIAKDIFNILWEKGG-T-------PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNN  457 (500)
Q Consensus       387 ~~i~p~~laeLi-~li~~g~Is~~~aK~il~~l~~~~~-~-------p~~iie~~gL~~isD~~eL~~iv~eVI~~np~~  457 (500)
T Consensus        43 ~~l~d~~il~vl~k~iKQ-------RrdS~~~y~~agR~dLa~kE~~Ei~Ii~~ylP~qLs-d~e~~~~v~~aIae~Ga-  113 (148)
T COG1610          43 DELDDEEILKVLAKEIKQ-------RRDSAEEYEKAGRQDLAAKERAEIAIIEEYLPQQLS-EDELRALVDAAIAEVGA-  113 (148)
T ss_pred             CCCCHHHHHHHHHHHHHH-------HHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCC-HHHHHHHHHHHHHHHHH-
T ss_conf             889869999999999998-------789999998768487999999499999986764689-89999999999999877-


Q ss_pred             HHHHHCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             9975272132265899999972897788999999999707
Q gi|254780979|r  458 VARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG  497 (500)
Q Consensus       458 V~~~kgk~ka~gfLvGqVMK~tkGkAdpk~v~~lL~e~L~  497 (500)
T Consensus       114 -----s~~~dMGkvM~al~~k~~GkaD~~~vs~~VK~~L~  148 (148)
T COG1610         114 -----SSMKDMGKVMKALKPKVAGKADGGRVSKLVKELLS  148 (148)
T ss_pred             -----HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC
T ss_conf             -----21888999999881885266838899999998729