HHsearch alignment for GI: 254780979 and conserved domain: TIGR00134

>TIGR00134 gatE_arch glutamyl-tRNA(Gln) amidotransferase, subunit E; InterPro: IPR004414 The aspartyl-tRNA(Asn) amidotransferase, B subunit or designated here gatB_rel, is found only in the archaea. It is paralogous to the gatB-encoded subunit of Glu-tRNA(Gln) amidotransferase. The GatABC system operates in many bacteria to convert Glu-tRNA(Gln) into Gln-tRNA(Gln). However, the homologous system in archaea instead converts Asp-tRNA(Asn) to Asn-tRNA(Asn). Glu-tRNA(Gln) is converted to Gln-tRNA(Gln) by a heterodimeric amidotransferase of GatE (this protein) and GatD. The Archaea have an Asp-tRNA(Asn) amidotransferase instead of an Asp--tRNA ligase, but the genes have not been identified. It is likely that this protein replaces gatB in Asp-tRNA(Asn) amidotransferase but that both enzymes share gatA . ; GO: 0016884 carbon-nitrogen ligase activity with glutamine as amido-N-donor, 0006412 translation.
Probab=100.00  E-value=0  Score=422.98  Aligned_cols=446  Identities=28%  Similarity=0.418  Sum_probs=384.2

Q ss_pred             CCCEE---EEEEEEEEECCCCCCCCCCCCCC-CCCC-CC-------------------------------------CCCH
Q ss_conf             80338---98999788868986555884246-8987-65-------------------------------------2061
Q gi|254780979|r   21 DWEVV---IGIEVHAQLSVVSKLFSGASVNF-GAEP-NT-------------------------------------QVSF   58 (500)
Q Consensus        21 ~~e~v---IGLEiH~qL~t~tKlFc~c~~~~-~~~p-Nt-------------------------------------~v~~   58 (500)
T Consensus         3 ~~~~~gl~~g~~~~~~l~~~~~l~c~c~~~~~~~~~~~~~~~~~l~~~~~~~g~~d~~~~~~~~~~~~~~~~~~~~~~cl   82 (631)
T TIGR00134         3 DYEKVGLKVGLEIHQQLDTKHKLFCPCPTLLRDDEPSDGEIVRYLRPSLSELGEFDRAALEEAERGKKFIYEFYNDTTCL   82 (631)
T ss_pred             CHHHHCHHHCHHHHHHHCCCCHHEECCCHHHCCCCCCCCHHHHHHCHHHHHHCHHHHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             50221102011344330311000001302212455444300101000034401134678888774212221002542024


Q ss_pred             HHCCCCCCCCCCCHHHHHHHHHHHHHHCCEECCCCEEECCCEECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEE
Q ss_conf             30268988873789999999998778297624420131132123767888201445442015338999706777774103
Q gi|254780979|r   59 FDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT  138 (500)
Q Consensus        59 ~~~g~PG~lP~lN~~av~~ai~~~~al~~~i~~~~~fdRK~YfYpDlpkgyQiTQ~~~Pi~~~G~l~~~~~~~~~~~~~~  138 (500)
T Consensus        83 ~~~d~~pp~-~~~~~~l~~~~~~~~~~~~~~~d~~~~~~~~~~dg~~~~g~~~~~~---~~~~g~~~~~~----------  148 (631)
T TIGR00134        83 VEADEEPPH-PPNPEALLIALEVALLLNMEVVDEAHTMRKIVIDGSNTGGFQRTGL---VAFDGYLETPG----------  148 (631)
T ss_pred             EECCCCCCC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHEEE---EEECCEEECCC----------
T ss_conf             432556888-7666788899999988512456667665543112666543100021---23065222476----------


Q ss_pred             EEEEEEEEEEEECCCCCCCCCCCCCEEEEECCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEC
Q ss_conf             79842366652023100115678714886615786125763036527789999999999999864204567643220112
Q gi|254780979|r  139 IEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRA  218 (500)
Q Consensus       139 ~~v~I~~i~lEED~gk~~h~~~~~~slvD~NRaGvPLiEIVT~Pd~~s~~ea~~~~~~l~~ilr~~gisd~~meeGslR~  218 (500)
T Consensus       149 ~~~~~~~lcl~~~~~~~~~~~-~~~~~~~ld~lg~pl~~~~~~p~~~~p~~~~~~~~~~g~~l~~~g~~~~gl--g~~~~  225 (631)
T TIGR00134       149 GKVGIASLCLEEDAARKIEDG-GDGVVYNLDRLGIPLVEIGTDPDIDDPELAKEVAARLGEILRSTGKVKRGL--GTIRQ  225 (631)
T ss_pred             CCEEHHHHHHHHHHHHHHHCC-CCEEEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHH
T ss_conf             520012222203555432025-770466400016530220467776666789999998878876310123200--01222


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCC---------------------------------
Q ss_conf             57543213766678862223540246599999999999999731398---------------------------------
Q gi|254780979|r  219 DVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGG---------------------------------  265 (500)
Q Consensus       219 DvNVSi~~~~~~~GtRvEIKNlnS~~~i~~AI~yEi~RQ~~ll~~G~---------------------------------  265 (500)
T Consensus       226 d~~~~~~d-----g~~~~~~g~~~ld~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~  300 (631)
T TIGR00134       226 DLNISIRD-----GARVEVKGVQDLDLLPKIVENEVLRQLNLLKIRDELKERGAEVEEKIFDVTEVFADTKSKIIRNALK  300 (631)
T ss_pred             CCCEEECC-----CCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             02201126-----7513322530234567887778876666778778887415413455543577753235666643332


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q gi|254780979|r  266 --------------------------------------------------------------------------------  265 (500)
Q Consensus       266 --------------------------------------------------------------------------------  265 (500)
                                                                                                      
T Consensus       301 ~~~g~~~~~~l~g~~g~~g~~~~pg~~lg~~~~d~~~~~~g~~g~~~~d~lp~~g~~~~~~~~l~~~~~~~~~d~~~~~~  380 (631)
T TIGR00134       301 KKNGKVKAVLLRGFGGLVGKEIQPGRRLGTEFADYAKTYAGVGGLFHTDELPAYGITEEEVKGLRDAVGAEEGDAVVLVA  380 (631)
T ss_pred             HCCCCEEEEEECCCCCCCCCCCCCCCHHCCHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEC
T ss_conf             01453212211022320133126630101035555555420243111222443467678887777750666676268851


Q ss_pred             ----------------------CCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHH
Q ss_conf             ----------------------0034432337554336653035667777833277877312699999998853024836
Q gi|254780979|r  266 ----------------------HIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPD  323 (500)
Q Consensus       266 ----------------------~v~qETR~~d~~~~~T~~mR~KE~a~DYRyfPEPDLPpi~is~e~i~~i~~~lPelP~  323 (500)
T Consensus       381 ~~~~~~~~~l~~~~~~~~~~~~g~p~~~~~~~-~dg~~~~l~plp~~~--~~~~~~d~p~~~~~~~~~~~~~~~~p~l~~  457 (631)
T TIGR00134       381 GEEVKVERALREVIERAKEALVGVPEETRKAL-EDGNTAYLRPLPGAA--RMYPETDIPPVVIEEELLEGIRANLPELPE  457 (631)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCHHHHHCC-CCCCCHHHCCCCCCH--HHCCCCCCCCEEEHHHHHHHHHHHCCCCHH
T ss_conf             50345778999999876676505852454215-576510102476300--002123666202107787677642010036


Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCC---CCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             898864320268899988876411367898864024---30245777765457887643387400064898999999988
Q gi|254780979|r  324 AKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDL  400 (500)
Q Consensus       324 ~~~~rl~~~yGLs~~dA~~L~~~~~la~~FE~v~~~---~~pk~~Anwi~~el~~~ln~~~~~~~~~~i~p~~laeLi~l  400 (500)
T Consensus       458 ~~~~~~~~~~~l~~~l~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~l~~~-~~~~~~~g~~~~~--l~~~~~~~~~~~  533 (631)
T TIGR00134       458 EKAERFKKEYGLPDDLAWELVD-SPYVDLFEDLCEKFKNVDPTVIATLLEGT-LKELRREGYDIDG--LEDRHLRDALKL  533 (631)
T ss_pred             HHHHHHHHHHCCCHHHHHHHHH-HHHHHHHHHHHHHHHCCCHHHHHHHHHHH-HHHHHHCCCCCCC--CCHHHHHHHHHH
T ss_conf             7888888761473567888875-46788899998874044336778888876-8987531552000--214678999988


Q ss_pred             HHCCCCCHHHHHHHHHHHHHCCCCH-HHHHHHCCCEECCCHHHHHHHHHHHHHHCHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             8638731478999999998179998-899996398761898899999999998399989975272132265899999972
Q gi|254780979|r  401 IIDGTISGKIAKDIFNILWEKGGTP-KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNT  479 (500)
Q Consensus       401 i~~g~Is~~~aK~il~~l~~~~~~p-~~iie~~gL~~isD~~eL~~iv~eVI~~np~~V~~~kgk~ka~gfLvGqVMK~t  479 (500)
T Consensus       534 ~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~-~~~~~~~~~~~~~~~~~~~~~~g--~~~~~~l~g~~~~~~  610 (631)
T TIGR00134       534 LLEGKIAKEGLEEVLKGLCEEPDKAEDAAGELKGLKLLA-EEEIEGIIEGLIEENLDLIAERG--EGAFGPLMGLAMGKL  610 (631)
T ss_pred             HHHCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHC--CHHHHHHHHHHHHHH
T ss_conf             862011256799999986216613567777643233100-56788999998654555655403--202467888888874


Q ss_pred             CCCCCHHHHHHHHHHHHCC
Q ss_conf             8977889999999997078
Q gi|254780979|r  480 GGKANPSIVQKMLKEKLGI  498 (500)
Q Consensus       480 kGkAdpk~v~~lL~e~L~~  498 (500)
T Consensus       611 ~g~~dg~~~~~~l~~~~~~  629 (631)
T TIGR00134       611 RGKADGKVVNDILRKKLKE  629 (631)
T ss_pred             HCCCCHHHHHHHHHHHHHH
T ss_conf             0211046889999998762