HHsearch alignment for GI: 254780979 and conserved domain: pfam02637

>pfam02637 GatB_Yqey GatB domain. This domain is found in GatB. It is about 140 amino acid residues long. This domain is found at the C terminus of GatB, which transamidates Glu-tRNA to Gln-tRNA.
Probab=100.00  E-value=1.2e-34  Score=275.62  Aligned_cols=146  Identities=50%  Similarity=0.853  Sum_probs=141.2

Q ss_pred             HHHHHHH-CCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             8988640-243024577776545788764338740006489899999998886387314789999999981799988999
Q gi|254780979|r  351 DYFEKLA-VNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIV  429 (500)
Q Consensus       351 ~~FE~v~-~~~~pk~~Anwi~~el~~~ln~~~~~~~~~~i~p~~laeLi~li~~g~Is~~~aK~il~~l~~~~~~p~~ii  429 (500)
T Consensus         1 d~FE~~~~~~~~~k~aanwi~~el~~~l~~~~~~~~~~~i~~~~la~li~lv~~g~Is~~~ak~vl~~~~~~~~~~~~ii   80 (148)
T pfam02637         1 DFFEEAVKAGADPKLAANWLLGELLGYLNKEGLDIDESPLTPEHLAELIKLIDEGTISGKIAKEVLEELLENGKSPEEIV   80 (148)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCHHHCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             97899988079899999999999999997779986637989999999999998699768999999999987699879999


Q ss_pred             HHCCCEECCCHHHHHHHHHHHHHHCHHHHHHHH-CCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             963987618988999999999983999899752-7213226589999997289778899999999970
Q gi|254780979|r  430 EELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL  496 (500)
Q Consensus       430 e~~gL~~isD~~eL~~iv~eVI~~np~~V~~~k-gk~ka~gfLvGqVMK~tkGkAdpk~v~~lL~e~L  496 (500)
T Consensus        81 ~~~gl~~i~d~~~l~~iv~~vi~~np~~v~~yk~Gk~k~~~~lvGqvMK~tkGkadp~~v~~~l~e~L  148 (148)
T pfam02637        81 EEKGLVQISDEEELEKIVDEVIAENPKAVEDYKSGKEKALGFLVGQVMKKTRGKADPKLVNELLKEKL  148 (148)
T ss_pred             HHCCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHC
T ss_conf             88197646888999999999999899999999837677899999999998579989999999999659