HHsearch alignment of GI: 254780979 and MMDB domain: 2d6f_C_1-273_395-445

>2d6f_C (C:1-273,C:395-445) Glutamyl-tRNA(Gln) amidotransferase subunit E; ligase, ligase/RNA complex; 3.15A {Methanothermobacterthermautotrophicus}
Probab=100.00  E-value=0  Score=769.78  Aligned_cols=275  Identities=29%  Similarity=0.457  Sum_probs=259.2

Q ss_pred             CCCEE---EEEEEEEEECCCCCCCCCCCCCC-CCCCCCCCCHHHCCCCCCCCC---------------------------
Q ss_conf             80338---98999788868986555884246-898765206130268988873---------------------------
Q gi|254780979|r   21 DWEVV---IGIEVHAQLSVVSKLFSGASVNF-GAEPNTQVSFFDAAMPGMLPI---------------------------   69 (500)
Q Consensus        21 ~~e~v---IGLEiH~qL~t~tKlFc~c~~~~-~~~pNt~v~~~~~g~PG~lP~---------------------------   69 (500)
                      |||.+   ||||||+||+|+|||||+|+++| +++||+++|++|.++||+||+                           
T Consensus         2 dye~v~l~IGLEIH~QL~T~tKLFc~c~t~~~~~epn~~v~~~~~~~pg~Lp~id~aa~~e~~k~~~~~y~~~~~~tClv   81 (324)
T 2d6f_C            2 DWEKVGLKMGLEIHQQLDTESKLFCPCRTELTDSEPDHDIVRNLRPTQSELGKFDRAAFEEAMRKLHFHYENYHEETCLV   81 (324)
T ss_dssp             CHHHHTCEEEEEEEEECCCSBCSSSCSBSSCCCSCCSEEEEEECCCC----------CTTTTGGGGEEEEEECTTTCCHH
T ss_pred             CHHHHCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             86671780667987886798677789988778899986646545678765555548899887542001102356654423


Q ss_pred             ---------CCHHHHHHHHHHHHHHCCEECCCCEEECCCEECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEE
Q ss_conf             ---------78999999999877829762442013113212376788820144544201533899970677777410379
Q gi|254780979|r   70 ---------LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE  140 (500)
Q Consensus        70 ---------lN~~av~~ai~~~~al~~~i~~~~~fdRK~YfYpDlpkgyQiTQ~~~Pi~~~G~l~~~~~~~~~~~~~~~~  140 (500)
                               +|++|+++|+++|+||||+|++.++||||||||||||+||||||+   ||.||+++++          .++
T Consensus        82 ~~~e~p~~pln~eav~~ai~~a~aln~~i~~~~~f~RK~y~y~dlp~gyQiTq~---ia~~G~i~~~----------~~~  148 (324)
T 2d6f_C           82 EADEEPPHPLNPEALEIAVTIALLLNMRVVDEFHTMRKQVIDGSNTGGFQRTGL---VATDGHLETP----------QGT  148 (324)
T ss_dssp             HHTSSCCCCCCHHHHHHHHHHHHHTTCEECSEECCEEEECTTSSSSSSEEEEEE---EEEEEEEEET----------TEE
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCEEEEE---ECCEEEEEEC----------CCE
T ss_conf             356678888799999999999997298225455101146678888867514058---4004589613----------661


Q ss_pred             EEEEEEEEEECCCCCCCCCCCCCEEEEECCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCC
Q ss_conf             84236665202310011567871488661578612576303652778999999999999986420456764322011257
Q gi|254780979|r  141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADV  220 (500)
Q Consensus       141 v~I~~i~lEED~gk~~h~~~~~~slvD~NRaGvPLiEIVT~Pd~~s~~ea~~~~~~l~~ilr~~gisd~~meeGslR~Dv  220 (500)
                      |+|.+|||||||||++|+. +++|++||||||+|||||||+|||+||+||++|+++|+++|||+|+|++   +|+|||||
T Consensus       149 V~I~~i~LEEDaak~ih~~-~~~s~vDlNRaGiPLiEIvTePdi~speeA~~~~~~i~~ilr~~Gv~~g---~GsiR~Dv  224 (324)
T 2d6f_C          149 VKIENLCLEEDAARRIRET-GDGVVFRLDRLGIPLVEITTDPSMSDPQQLREVAYQIGQILRSTRVKRG---LGTIRQDL  224 (324)
T ss_dssp             EEEEEEEEEECCCEEEEEE-TTEEEEETTSTTCEEEEEECCSCCCCHHHHHHHHHHHHHHHTTSSCCCS---STTCEEEE
T ss_pred             EEEEEEEECCCCCCCCCCC-CCCEEECHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCC---CCCCCCCC
T ss_conf             4122366336777423466-7623431000586347887247858889999999999988753211466---53323523


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCC--------CCCCCCCCCCCEEEEEECCCCCCC
Q ss_conf             543213766678862223540246599999999999999731398003--------443233755433665303566777
Q gi|254780979|r  221 NVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIR--------QETRLFDPSKNETRSLRTKEDALD  292 (500)
Q Consensus       221 NVSi~~~~~~~GtRvEIKNlnS~~~i~~AI~yEi~RQ~~ll~~G~~v~--------qETR~~d~~~~~T~~mR~KE~a~D  292 (500)
                      ||||++     |+||||||||||++|++||+||+.||.++|+.|+++.        .|||+..+ .|.|.+||+.++++ 
T Consensus       225 NVSi~~-----G~RvEIKNvnsl~~I~~aIeyEv~RQ~~ll~~g~~l~~r~~~~vp~etr~~~~-~g~t~~~rp~pg~~-  297 (324)
T 2d6f_C          225 NISIRD-----GARVEVKGVQDLDLIPEIVEREVKRQLSLVEIRDTLQERGAVVVPEETRKALP-DGNTQYLRPLPTSS-  297 (324)
T ss_dssp             EEECTT-----SCCEEEECCCCGGGHHHHHHHHHHHHHHHHHHHHHHHHTTCCECCCEEEEECS-SSCEEEEEECCCCC-
T ss_pred             CCCCCC-----CCEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEECCHHHHCCCC-CCCCCCCCCCCCCC-
T ss_conf             456689-----86022368765679999999999999999970650102662435254414587-88741221225556-


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHCCC
Q ss_conf             7833277877312699999998853024
Q gi|254780979|r  293 YRYFSEPDLLPLEIDEDFIRAIKKQIPE  320 (500)
Q Consensus       293 YRyfPEPDLPpi~is~e~i~~i~~~lPe  320 (500)
                       |||||||+||+.|++++++.+++++||
T Consensus       298 -rmypetd~~~~~~~~~~~~~~~~~~pe  324 (324)
T 2d6f_C          298 -RMYLETDIPLFRIEDDLLEGIRRNLPE  324 (324)
T ss_dssp             -CEEECTTSCCEECCHHHHHHHHTTCCC
T ss_pred             -CCCCCCCCCCEECCHHHHHHHHHHCCC
T ss_conf             -658999988874688999999985899