HHsearch alignment of GI: 254780979 and MMDB domain: 3ip4_B_293-411

>3ip4_B (B:293-411) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_B 2dqn_B* 2g5h_B 2g5i_B* 2f2a_B
Probab=99.92  E-value=3.9e-24  Score=197.76  Aligned_cols=118  Identities=41%  Similarity=0.729  Sum_probs=114.9

Q ss_pred             CCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHH
Q ss_conf             248368988643202688999888764113678988640-2430245777765457887643387400064898999999
Q gi|254780979|r  319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGEL  397 (500)
Q Consensus       319 PelP~~~~~rl~~~yGLs~~dA~~L~~~~~la~~FE~v~-~~~~pk~~Anwi~~el~~~ln~~~~~~~~~~i~p~~laeL  397 (500)
                      ||||+++++||+++|||+.++|.+|++++.+++|||++. .+.+||.++||+++|+.+.+|+.+.++++++++|++|++|
T Consensus         1 PELP~~~~~Rl~~~ygLs~~~A~~L~~~~~l~~yFe~~~~~~~~~k~~anwi~~el~~~ln~~~~~~~~~~i~~~~la~l   80 (119)
T 3ip4_B            1 PELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGM   80 (119)
T ss_dssp             CCCHHHHHHHHHHTSCCCHHHHHHHTSSHHHHHHHHHHHTTTCCHHHHHHHHHTHHHHHHHHTTCCGGGSSCCHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHCCCHHHHHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHH
T ss_conf             99879999999987099878755431006778888877643663488999999999887540256444589699999999


Q ss_pred             HHHHHCCCCCHHHHHHHHHHHHHCCCCHHHHHHHCCCEE
Q ss_conf             988863873147899999999817999889999639876
Q gi|254780979|r  398 IDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ  436 (500)
Q Consensus       398 i~li~~g~Is~~~aK~il~~l~~~~~~p~~iie~~gL~~  436 (500)
                      +.++++|+||.++||+||..|+.++++|++||+++||.|
T Consensus        81 i~lv~~~~Is~~~aK~vl~~~~~~~~~~~~iie~~gL~Q  119 (119)
T 3ip4_B           81 IKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQ  119 (119)
T ss_dssp             HHHHHHTSSCHHHHHHHHHHHHHHCCCHHHHHHTTTCCC
T ss_pred             HHHHHCCCCCHHHHHHHHHHHHHCCCCHHHHHHHCCCCC
T ss_conf             999974974488999999999857999999999759960