HHsearch results for GI: 254780979 and protein with PDBid: 3kfu_F

>3kfu_F Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus}
Probab=100.00  E-value=0  Score=1140.70  Aligned_cols=393  Identities=41%  Similarity=0.722  Sum_probs=381.1

Q ss_pred             CCEEEEEEEEEEECCCCCCCCCCCCC-CCCCCCCCCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCEECCCCEEECCCE
Q ss_conf             03389899978886898655588424-68987652061302689888737899999999987782976244201311321
Q gi|254780979|r   22 WEVVIGIEVHAQLSVVSKLFSGASVN-FGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNY  100 (500)
Q Consensus        22 ~e~vIGLEiH~qL~t~tKlFc~c~~~-~~~~pNt~v~~~~~g~PG~lP~lN~~av~~ai~~~~al~~~i~~~~~fdRK~Y  100 (500)
                      ||+||||||||||+|+|||||+|+++ ||++|||+|||||+|+||+||++|++||++|+++|+||||+|++.++||||||
T Consensus         2 ~e~vIGLEiH~qL~T~tKlFc~c~~~~~~~~pNt~vc~vc~g~PG~lP~lN~~av~~ai~~~lal~~~i~~~~~fdRK~Y   81 (466)
T 3kfu_F            2 YEAVIGLEVHLHLKTRTKMFCGCRADYFGAEPNTHTCPVCLGLPGALPVPNRVAVEHGLRLALALGAEVPERLVFHRKNY   81 (466)
T ss_dssp             CCEEEEEEEEEEBCCSSCSSSCSCCCCSSCCTTSSCCTTTTTCTTCCCCCBHHHHHHHHHHHHHHTEECCSEECCEEEEC
T ss_pred             CCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEE
T ss_conf             75388899878818997788899886568998563086024799998877999999999999983984674637867779


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEEEEEEEEEEEECCCCCCCCCCCCCEEEEECCCCCCEEEEEE
Q ss_conf             23767888201445442015338999706777774103798423666520231001156787148866157861257630
Q gi|254780979|r  101 FYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT  180 (500)
Q Consensus       101 fYpDlpkgyQiTQ~~~Pi~~~G~l~~~~~~~~~~~~~~~~v~I~~i~lEED~gk~~h~~~~~~slvD~NRaGvPLiEIVT  180 (500)
                      |||||||||||||++.|||.||++++.          .++|+|.||||||||||++|.  ++.|+|||||||+|||||||
T Consensus        82 fYpDlpkgyQiTQ~~~pi~~~G~l~~~----------~~~i~I~rihLEEDagk~~h~--~~~slvD~NRaGvPLiEIVT  149 (466)
T 3kfu_F           82 FYPDLPKNYQISQYDLPLGRGGSLPLG----------ERRVRIKRLHLEEDAGKSLHL--EGRTLLDLNRAGSPLIELVT  149 (466)
T ss_dssp             CCTTCTTSEEEECSSSCSEEECEEEET----------TEEEEEEEEEEEECCCEEEEE--TTEEEEETTSTTCEEEEEEE
T ss_pred             ECCCCCCCCCCCCCCCCCCCCCEEECC----------CEEECEEEEEEEHHCCEECCC--CCCEEEEECCCCCCEEEEEE
T ss_conf             889899883612141552278577358----------658752899996301721157--99769851368985479980


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             36527789999999999999864204567643220112575432137666788622235402465999999999999997
Q gi|254780979|r  181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI  260 (500)
Q Consensus       181 ~Pd~~s~~ea~~~~~~l~~ilr~~gisd~~meeGslR~DvNVSi~~~~~~~GtRvEIKNlnS~~~i~~AI~yEi~RQ~~l  260 (500)
                      +|||+||+||++|+++|++||||+|+|||+||+|+||||||||||+.|++|||||||||||||++|++||+||+.||+++
T Consensus       150 ePd~~s~~eA~~~~~~L~~ilr~lgvsd~~meeGslR~DvNVSir~~g~~~g~RvEiKNlNS~~~v~kAIeyEi~RQ~~~  229 (466)
T 3kfu_F          150 EPDLKTPEEARLFLQRIQALVQTLGISDASPEEGKLRADVNVSVRRVGEPLGTKVEIKNLNSFKSVQRALEYEIRRQTEI  229 (466)
T ss_dssp             CTTBCCHHHHHHHHHHHHHHHHHHTSBCCCGGGTCEEEEEEEEECCSSSSCCCCEEEEEECCHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             47868899999999999999997087767511361414650564147887776577516655468999999999999999


Q ss_pred             HHCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHH
Q ss_conf             31398003443233755433665303566777783327787731269999999885302483689886432026889998
Q gi|254780979|r  261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDA  340 (500)
Q Consensus       261 l~~G~~v~qETR~~d~~~~~T~~mR~KE~a~DYRyfPEPDLPpi~is~e~i~~i~~~lPelP~~~~~rl~~~yGLs~~dA  340 (500)
                      ++.|+.|.||||+||+.++.|++||+||+++||||||||||||+.|+++||++++++|||||+++++|| .+||||+++|
T Consensus       230 l~~G~~v~qETR~wd~~~~~T~~mRsKE~a~DYRYfPEPDLPPi~Is~e~Ie~Ir~~LPELP~~rr~Rl-~~yGLs~~dA  308 (466)
T 3kfu_F          230 LRRGEKVKQATMGFEEGSGKTYPMRTKEEEADYRYFPEPDLPPVAIPRDWLEEVRRSLPELPWEKEARY-RALGIKEKDA  308 (466)
T ss_dssp             HTSSCCCCCCEECEETTTTEECCC------CCCCCEECTTSCCEECCHHHHHHHHSSCCCCHHHHHHHH-TTTTCCHHHH
T ss_pred             HHCCCCCCEEEECCCCCCCCEEEEEECCCCCCCCEECCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHH-HHCCCCHHHH
T ss_conf             976996310440443456960013665776655543179978765788999999971998879999999-9839999999


Q ss_pred             HHHHHHHHHHHHHHHHHC--CCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             887641136789886402--430245777765457887643387400064898999999988863873147899999999
Q gi|254780979|r  341 SVLVSDKSIADYFEKLAV--NRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNIL  418 (500)
Q Consensus       341 ~~L~~~~~la~~FE~v~~--~~~pk~~Anwi~~el~~~ln~~~~~~~~~~i~p~~laeLi~li~~g~Is~~~aK~il~~l  418 (500)
                      .+|++++.+++|||++..  ..+||.+||||++||++.||+.++++++++++|++|++|++|+++|+||+++||+||++|
T Consensus       309 ~vLv~d~~la~yFE~~v~~~~~~pK~~ANWi~~eL~~~Lnk~~~~i~~~~vtp~~LaeLI~LI~~g~IS~k~AKeVL~em  388 (466)
T 3kfu_F          309 EVLAYTPSLARFLDQALPLGLASPQALANWLLADVAGLLHERGLRLEETRLSPEGLARLVGLFERGEVTSRVAKSLLPEV  388 (466)
T ss_dssp             HHHHSCHHHHHHHHHHTTSSSSCHHHHHHHHHTHHHHHHHHHTCCSTTSSCCHHHHHHHHHHHHTTSSCHHHHHHHHHHH
T ss_pred             HHHHCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCHHHCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             99972898999999999853888899888999999999977789866579999999999999967987668999999999


Q ss_pred             HHCCCCHHHH
Q ss_conf             8179998899
Q gi|254780979|r  419 WEKGGTPKEI  428 (500)
Q Consensus       419 ~~~~~~p~~i  428 (500)
                      ++ |+||+..
T Consensus       389 le-GeDP~~~  397 (466)
T 3kfu_F          389 LE-GQDPEAX  397 (466)
T ss_dssp             TT-TCCCCCC
T ss_pred             HC-CCCCCCC
T ss_conf             77-9998864