Query         gi|254780979|ref|YP_003065392.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 500
No_of_seqs    209 out of 1752
Neff          6.3 
Searched_HMMs 23785
Date          Tue May 31 23:32:20 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780979.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3ip4_B Aspartyl/glutamyl-tRNA( 100.0       0       0 1328.4  48.5  471   21-499     2-475 (483)
  2 3h0l_B Aspartyl/glutamyl-tRNA( 100.0       0       0 1325.3  42.3  471   20-497     3-476 (478)
  3 3al0_B Aspartyl/glutamyl-tRNA( 100.0       0       0 1291.6  40.4  473   21-499     2-482 (482)
  4 2d6f_C Glutamyl-tRNA(Gln) amid 100.0       0       0 1167.0  24.3  447   21-499     2-618 (619)
  5 3kfu_F Aspartyl/glutamyl-tRNA( 100.0       0       0 1140.7  36.6  393   22-428     2-397 (466)
  6 1zq1_C Glutamyl-tRNA(Gln) amid 100.0       0       0 1156.0  22.4  449   17-498     8-629 (633)
  7 2hz7_A Glutaminyl-tRNA synthet 100.0       0       0  381.9   0.1  202  290-497   647-851 (851)
  8 1ng6_A Hypothetical protein YQ  98.0 2.6E-05 1.1E-09   58.0   8.4   96  388-497    44-148 (148)
  9 2d6f_C Glutamyl-tRNA(Gln) amid  76.4    0.31 1.3E-05   28.0  -0.7   57  271-327   303-368 (619)
 10 1ltz_A Phenylalanine-4-hydroxy  61.2     4.6 0.00019   19.3   2.6   45  279-335   117-161 (297)
 11 2v27_A Phenylalanine hydroxyla  59.6     5.3 0.00022   18.9   2.7   44  279-334   101-144 (275)
 12 1va6_A Glutamate--cysteine lig  53.9      10 0.00043   16.8   4.2   34  166-203    59-92  (518)
 13 3nzt_A Glutamate--cysteine lig  48.7      12 0.00051   16.2   4.3  105  363-481   408-523 (525)
 14 1qqp_2 FMDV, protein (genome p  45.2     7.4 0.00031   17.8   1.6   19   26-45    103-121 (218)
 15 2ws9_2 P1; 3.00A {Equine rhini  43.7     9.2 0.00039   17.1   1.9   22   24-46    104-125 (230)
 16 1cuk_A RUVA protein; DNA repai  43.7      14  0.0006   15.7   9.9   57  324-380    70-135 (203)
 17 2ztd_A Holliday junction ATP-d  43.2      15 0.00061   15.6   8.4   54  324-377    85-147 (212)
 18 1mlw_A Tryptophan 5-monooxygen  39.6     7.1  0.0003   17.9   0.8   45  279-335   150-194 (301)
 19 1toh_A Tyroh, tyrosine hydroxy  37.1     8.2 0.00034   17.5   0.8   45  279-335   155-199 (343)
 20 1phz_A Protein (phenylalanine   35.4     9.1 0.00038   17.1   0.8   44  280-335   265-308 (429)
 21 1j8u_A Phenylalanine-4-hydroxy  34.8     9.4 0.00039   17.0   0.8   45  279-335   162-206 (325)
 22 2x26_A Periplasmic aliphatic s  34.5     5.5 0.00023   18.7  -0.4   10  304-313   188-197 (308)
 23 3fdx_A Putative filament prote  33.7      20 0.00084   14.6   2.4   40   53-96      2-41  (143)
 24 3cji_C Polyprotein; virus caps  33.7      14 0.00057   15.8   1.4   24   22-46    109-132 (284)
 25 1bev_2 Bovine enterovirus coat  33.4      13 0.00054   16.1   1.3   22   24-46    102-123 (248)
 26 1d4m_2 Protein (coxsackievirus  32.9      14  0.0006   15.7   1.4   24   22-46    100-123 (261)
 27 1ncq_B Coat protein VP2; HRV,   32.0      15 0.00063   15.5   1.4   24   22-46    100-123 (262)
 28 2jml_A DNA binding domain/tran  30.7      22 0.00094   14.3   2.7   54  272-346    23-76  (81)
 29 1zth_A RIO1 serine protein kin  30.3      23 0.00095   14.2   5.7  141  105-251    42-233 (258)
 30 1jke_A O145, D-Tyr-trnaTyr dea  29.9      23 0.00097   14.2   2.8   46  180-228    89-137 (145)
 31 1tme_2 Theiler'S murine enceph  29.4      18 0.00074   15.0   1.4   24   22-46    104-127 (267)
 32 1naf_A ADP-ribosylation factor  28.7      17 0.00073   15.1   1.3   35  342-376    11-47  (158)
 33 1aym_2 HRV16, human rhinovirus  28.1      21  0.0009   14.4   1.7   24   22-46    100-123 (261)
 34 1gjy_A Sorcin, CP-22, V19; cal  26.3      26  0.0011   13.7  10.7   58  348-410     3-63  (167)
 35 3doa_A Fibrinogen binding prot  26.2      26  0.0011   13.7   4.1  151  174-346    56-212 (288)
 36 3myd_A Flagellar biosynthesis   24.3      28  0.0012   13.5   4.0   43  388-430   197-243 (365)
 37 2dbo_A D-tyrosyl-tRNA(Tyr) dea  24.2      29  0.0012   13.5   3.2   46  180-228    89-137 (148)
 38 1emx_A HPTX2, heteropodatoxin   24.1      21 0.00087   14.5   1.0   12   38-49      4-15  (30)
 39 1dw9_A Cyanate lyase; cyanate   23.2      30  0.0013   13.3   5.4   38  306-343    38-75  (156)
 40 1xrs_A D-lysine 5,6-aminomutas  23.0      30  0.0013   13.3   7.7   68  406-483   423-494 (516)
 41 1hxs_2 Genome polyprotein, coa  22.2      27  0.0011   13.7   1.3   24   23-47    101-124 (272)
 42 1vcc_A DNA topoisomerase I; DN  21.9      20 0.00085   14.6   0.6   11   95-105    65-75  (77)
 43 1of8_A Phospho-2-dehydro-3-deo  20.8      33  0.0014   13.0   3.4   26  178-203    71-97  (370)
 44 2pw6_A Uncharacterized protein  20.6      13 0.00056   15.9  -0.6   32  266-307   111-142 (271)
 45 1pov_0 Poliovirus native empty  20.3      31  0.0013   13.2   1.3   22   24-46    170-191 (340)

No 1  
>3ip4_B Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_B 2dqn_B* 2g5h_B 2g5i_B* 2f2a_B
Probab=100.00  E-value=0  Score=1328.43  Aligned_cols=471  Identities=44%  Similarity=0.758  Sum_probs=458.3

Q ss_pred             CCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCEECCCCEEECCCE
Q ss_conf             80338989997888689865558842468987652061302689888737899999999987782976244201311321
Q gi|254780979|r   21 DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNY  100 (500)
Q Consensus        21 ~~e~vIGLEiH~qL~t~tKlFc~c~~~~~~~pNt~v~~~~~g~PG~lP~lN~~av~~ai~~~~al~~~i~~~~~fdRK~Y  100 (500)
                      +||+||||||||||+|+|||||+|+++|+++|||+|||||+|+|||||+||++||++|+++|+||||+|+++++||||||
T Consensus         2 ~~~~viGlEiH~qL~t~~KlF~~~~~~~~~~pN~~v~~~~~~~pG~lP~lN~~av~~a~~~~~al~~~i~~~~~fdRK~y   81 (483)
T 3ip4_B            2 HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNY   81 (483)
T ss_dssp             CEEEEEEEEEEEECCCSBCSSSSSBSSCCSSTTCSCCTTTTTCTTCCCCCBHHHHHHHHHHHHHTTCEECSEECCEEEEC
T ss_pred             CCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHCEECCCCC
T ss_conf             96158899998882899676789998678998767686122699987656999999999999984985341024344444


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEEEEEEEEEEEECCCCCCCCCCCCCEEEEECCCCCCEEEEEE
Q ss_conf             23767888201445442015338999706777774103798423666520231001156787148866157861257630
Q gi|254780979|r  101 FYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT  180 (500)
Q Consensus       101 fYpDlpkgyQiTQ~~~Pi~~~G~l~~~~~~~~~~~~~~~~v~I~~i~lEED~gk~~h~~~~~~slvD~NRaGvPLiEIVT  180 (500)
                      |||||||||||||++.|||.||+|++.++..      .++|+|.||||||||||++|+  +++|++||||||+|||||||
T Consensus        82 fypdlp~gyQiTq~~~pi~~~G~i~~~~~~~------~k~i~I~~i~lEEDagk~~~~--~~~~~~D~NR~GvPLiEIvT  153 (483)
T 3ip4_B           82 FYPDNPKAYQISQFDQPIGENGYIDIEVDGE------TKRIGITRLHMEEDAGKSTHK--GEYSLVDLNRQGTPLIEIVS  153 (483)
T ss_dssp             CBTTBTTSEEEECSSSCSEEEEEEEECSSSS------CEEEEEEEEEEEECCCEEEEE--TTEEEEECTTTTCEEEEEEE
T ss_pred             CCCCCCHHHHHHCCCCCCCCCEEEEEECCCC------CEEECCCEEEEEECCCCCCCC--CCCEEEECCCCCCCEEEEEC
T ss_conf             4898981354642766678750780112786------128650248872135755568--99607843578986579970


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCC-CCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             3652778999999999999986420456764322011257543213766-678862223540246599999999999999
Q gi|254780979|r  181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-AWGTRCEVKNVNSIRFLGLAIEYEARRQIA  259 (500)
Q Consensus       181 ~Pd~~s~~ea~~~~~~l~~ilr~~gisd~~meeGslR~DvNVSi~~~~~-~~GtRvEIKNlnS~~~i~~AI~yEi~RQ~~  259 (500)
                      +|||+||+||++|+++||+||||+|+|||+||+|+||||||||||+.|. .|||||||||||||++|++||+||+.||++
T Consensus       154 ~Pd~~s~~ea~~~~~~l~~ilr~~gv~~~~me~GsiR~DvNVSi~~~g~~~~G~RvEIKNlnS~~~I~~AI~~Ei~RQ~~  233 (483)
T 3ip4_B          154 EPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEE  233 (483)
T ss_dssp             CSCBCSHHHHHHHHHHHHHHHHHHTSCCCCGGGTSEEEEEEEEEEETTSCCCCCEEEEECCCSHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHH
T ss_conf             59977899999999999999997176556644565435540332678887776358874477838999999999999999


Q ss_pred             HHHCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCHHH
Q ss_conf             73139800344323375543366530356677778332778773126999999988530248368988643202688999
Q gi|254780979|r  260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYD  339 (500)
Q Consensus       260 ll~~G~~v~qETR~~d~~~~~T~~mR~KE~a~DYRyfPEPDLPpi~is~e~i~~i~~~lPelP~~~~~rl~~~yGLs~~d  339 (500)
                      +|++|+.|.||||+||+.+++|++||+||+++||||||||||||+.|+++||+.++.+|||||+++++||+++|||+.++
T Consensus       234 ~le~G~~v~qeTR~~d~~~~~T~~mR~Ke~a~DYRy~PEpDLppi~I~~e~ie~ik~~lPeLP~~~~~rl~~~~gl~~~~  313 (483)
T 3ip4_B          234 ELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYD  313 (483)
T ss_dssp             HHHHTCCCCEEEEEECTTTSCEEEEEEECSCCCCCCEECTTSCCEECCHHHHHHHHTTCCCCHHHHHHHHHHTSCCCHHH
T ss_pred             HHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHCCCHHH
T ss_conf             98669971243412355443466313567653245667888787658899999999868999799999999870999899


Q ss_pred             HHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             888764113678988640-2430245777765457887643387400064898999999988863873147899999999
Q gi|254780979|r  340 ASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNIL  418 (500)
Q Consensus       340 A~~L~~~~~la~~FE~v~-~~~~pk~~Anwi~~el~~~ln~~~~~~~~~~i~p~~laeLi~li~~g~Is~~~aK~il~~l  418 (500)
                      |.+|+.++.+++||+++. .+.+|+.+|||+++++.+.+|+.+..+.+++++|++|++|+.++++|+||.++||++|..|
T Consensus       314 a~~l~~~~~l~~~fe~~~~~~~~~k~~anwl~~el~~~l~~~~~~~~~~~i~~~~l~~Li~li~~g~Is~~~aK~il~~l  393 (483)
T 3ip4_B          314 AHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPEL  393 (483)
T ss_dssp             HHHHTSSHHHHHHHHHHHTTTCCHHHHHHHHHTHHHHHHHHTTCCGGGSSCCHHHHHHHHHHHHHTSSCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             88875218888888998861562789999999999999875267543379899999999999864974488999999999


Q ss_pred             HHCCCCHHHHHHHCCCEECCCHHHHHHHHHHHHHHCHHHHHHHH-CCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             81799988999963987618988999999999983999899752-72132265899999972897788999999999707
Q gi|254780979|r  419 WEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG  497 (500)
Q Consensus       419 ~~~~~~p~~iie~~gL~~isD~~eL~~iv~eVI~~np~~V~~~k-gk~ka~gfLvGqVMK~tkGkAdpk~v~~lL~e~L~  497 (500)
                      +.++++|.++++++||.|+||+++|+++|++||++||++|++|+ ||++++|||||||||+|||||||+.|+++|+++|+
T Consensus       394 ~~~~~s~~eiiee~gl~qisDe~eLe~ii~eVi~~n~~~Ve~~k~Gk~ka~gfLmGqVMK~tkGkAdpk~v~elL~e~L~  473 (483)
T 3ip4_B          394 AAKGGNAKQIMEDNGLVQISDEATLLKFVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELD  473 (483)
T ss_dssp             HHHCCCHHHHHHTTTCCCBCCHHHHHHHHHHHHHHCHHHHHHHHTTCSCHHHHHHHHHHHHTTSCBCHHHHHHHHHHHHH
T ss_pred             HHCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             85699999999975996048999999999999997999999997565877867999999996798799999999999999


Q ss_pred             CC
Q ss_conf             88
Q gi|254780979|r  498 IK  499 (500)
Q Consensus       498 ~k  499 (500)
                      -+
T Consensus       474 k~  475 (483)
T 3ip4_B          474 KR  475 (483)
T ss_dssp             HT
T ss_pred             HH
T ss_conf             98


No 2  
>3h0l_B Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_B 3h0r_B*
Probab=100.00  E-value=0  Score=1325.29  Aligned_cols=471  Identities=48%  Similarity=0.857  Sum_probs=458.9

Q ss_pred             CCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCEECCCCEEECCC
Q ss_conf             78033898999788868986555884246898765206130268988873789999999998778297624420131132
Q gi|254780979|r   20 GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKN   99 (500)
Q Consensus        20 ~~~e~vIGLEiH~qL~t~tKlFc~c~~~~~~~pNt~v~~~~~g~PG~lP~lN~~av~~ai~~~~al~~~i~~~~~fdRK~   99 (500)
                      .+||+||||||||||+|+|||||+|+++|+++|||+|||||+|+||+||+||++||++|+++|+||||+|+++++|||||
T Consensus         3 ~~~e~viGLEiH~qL~T~~KlFc~c~~~~~~~pn~~~~~~~~g~pg~lP~ln~~av~~a~~~~~aln~~i~~~~~f~RK~   82 (478)
T 3h0l_B            3 EKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEYAIRASLALNCEVHEESVFARKH   82 (478)
T ss_dssp             CCEEEEEEEEEEEECCCSBCSSSSCBCCTTCCTTCSCCTTTTTCTTCCCCCBHHHHHHHHHHHHHTTCEECSEECEEEEE
T ss_pred             CCCEEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEE
T ss_conf             88517888998878189967689999867888645517614658998763689999999999998398725352688887


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEEEEEEEEEEEECCCCCCCCCCCCCEEEEECCCCCCEEEEE
Q ss_conf             12376788820144544201533899970677777410379842366652023100115678714886615786125763
Q gi|254780979|r  100 YFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIV  179 (500)
Q Consensus       100 YfYpDlpkgyQiTQ~~~Pi~~~G~l~~~~~~~~~~~~~~~~v~I~~i~lEED~gk~~h~~~~~~slvD~NRaGvPLiEIV  179 (500)
                      ||||||||||||||++.|||.||++++...++.     .++|+|+||||||||||++|+  +++|+|||||||+||||||
T Consensus        83 yfy~dlp~gyQiTq~~~pi~~~G~~~~~~~~g~-----~k~i~I~~i~lEEDa~k~~~~--~~~s~~D~NR~G~PLiEIv  155 (478)
T 3h0l_B           83 YFYPDLPKGYQISQYEKPLATNGWVELNLPNGE-----KKKVRIRRLHIEEDAGKNIHE--GDKTLVDLNRAGTPLMEIV  155 (478)
T ss_dssp             CCCTTCTTSEEEEESSSCSEEEEEEEEECTTSC-----EEEEEEEEEEEEECCCEEEEE--TTEEEEECSSTTCEEEEEE
T ss_pred             ECCCCCCCHHCCCCCCCCCCCCCEEEEEECCCC-----EEEEEEEEEEEECCCCCCCCC--CCCEEEECCCCCCCEEEEE
T ss_conf             417999830011045256033566999825896-----658967789950357766657--9961884146898537887


Q ss_pred             ECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCCCCCCCCCC-CCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             0365277899999999999998642045676432201125754321376-667886222354024659999999999999
Q gi|254780979|r  180 TKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQI  258 (500)
Q Consensus       180 T~Pd~~s~~ea~~~~~~l~~ilr~~gisd~~meeGslR~DvNVSi~~~~-~~~GtRvEIKNlnS~~~i~~AI~yEi~RQ~  258 (500)
                      |+|||+||+||++|+++|++||||+|+|||+||+|+||||||||||+.| .+|||||||||||||++|++||+||+.||+
T Consensus       156 TePd~~s~~ea~~~~~~l~~ilr~~g~~~~~me~GsiR~DvNVSir~~g~~~~G~RvEIKNlnS~~~i~~AI~~Ei~RQ~  235 (478)
T 3h0l_B          156 TEPDIRTPEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQI  235 (478)
T ss_dssp             ECTTBCSHHHHHHHHHHHHHHHHHHTSCCCCGGGTSEEEEEEEEEEETTCCSCCCCEEEECCCSHHHHHHHHHHHHHHHH
T ss_pred             ECCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             05775689999999999999999709775665556423665525577888777765888588768999999999999999


Q ss_pred             HHHHCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCHH
Q ss_conf             97313980034432337554336653035667777833277877312699999998853024836898864320268899
Q gi|254780979|r  259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLY  338 (500)
Q Consensus       259 ~ll~~G~~v~qETR~~d~~~~~T~~mR~KE~a~DYRyfPEPDLPpi~is~e~i~~i~~~lPelP~~~~~rl~~~yGLs~~  338 (500)
                      ++|++|+.|.||||+||+.++.|++||+||+++||||||||||||+.|+++||++|+++|||||+++++||+++|||+++
T Consensus       236 ~lle~G~~v~qeTr~~d~~~~~T~~~R~KE~a~DYRyfPEpDLPpi~i~~e~i~~ir~~lPelP~~~~~rl~~~ygls~~  315 (478)
T 3h0l_B          236 NVVEEGGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMPELPDQRFERLIKEYGLSEY  315 (478)
T ss_dssp             HHHHTTCCCCCCEEEEETTTTEEECCSCCCCCCCCCCEECTTSCCEECCHHHHHHHHHTCCCCHHHHHHHHHHHTCCCHH
T ss_pred             HHHHCCCCEECCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHCCCHH
T ss_conf             99985997302430047654257523554445567888888877743689999999986899838999999998399988


Q ss_pred             HHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             9888764113678988640-243024577776545788764338740006489899999998886387314789999999
Q gi|254780979|r  339 DASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNI  417 (500)
Q Consensus       339 dA~~L~~~~~la~~FE~v~-~~~~pk~~Anwi~~el~~~ln~~~~~~~~~~i~p~~laeLi~li~~g~Is~~~aK~il~~  417 (500)
                      +|.+|++++.+++|||++. ...+||.+|||+++++.+.+|+.+..+++++++|++|++|+.++++|+||+++||++|+.
T Consensus       316 ~a~~L~~~~~~~~~fe~~~~~~~~~k~~anwl~~el~~~l~~~~~~i~~~~i~~~~laeLi~lv~~g~It~~~aK~il~~  395 (478)
T 3h0l_B          316 EAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGISIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKE  395 (478)
T ss_dssp             HHHHHHHSHHHHHHHHHHHHHSCCHHHHHHHHHHTHHHHHHHHTCCGGGCSSCHHHHHHHHHHHHTTSSCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCHHHCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             99999731777888887764046704788999999999998758977766989999999999986487417789999999


Q ss_pred             HHHCCCCHHHHHHHCCCEECCCHHHHHHHHHHHHHHCHHHHHHHH-CCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             981799988999963987618988999999999983999899752-7213226589999997289778899999999970
Q gi|254780979|r  418 LWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL  496 (500)
Q Consensus       418 l~~~~~~p~~iie~~gL~~isD~~eL~~iv~eVI~~np~~V~~~k-gk~ka~gfLvGqVMK~tkGkAdpk~v~~lL~e~L  496 (500)
                      |++++++|+++++++||.++||+++|+++|++||++||++|++|+ ||++++|||||||||+|||||||+.|+++|+++|
T Consensus       396 l~~~~~~p~eii~e~gl~~isD~~ele~iI~~Vi~~np~~V~~~k~Gk~kaig~LmGqVMK~tkGkAdpk~V~~lL~e~L  475 (478)
T 3h0l_B          396 MVETGKTPSQIVEEKGLKQITDENQIKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELV  475 (478)
T ss_dssp             HHHHCCCHHHHHHHHCC---------------------------------------------------------------
T ss_pred             HHHCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             98669999999997699414888999999999999798999999775076787899999998679879999999999998


Q ss_pred             C
Q ss_conf             7
Q gi|254780979|r  497 G  497 (500)
Q Consensus       497 ~  497 (500)
                      .
T Consensus       476 k  476 (478)
T 3h0l_B          476 K  476 (478)
T ss_dssp             -
T ss_pred             H
T ss_conf             4


No 3  
>3al0_B Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase; protein-RNA complex, ligase-RNA complex; HET: GSU; 3.37A {Thermotoga maritima}
Probab=100.00  E-value=0  Score=1291.56  Aligned_cols=473  Identities=43%  Similarity=0.730  Sum_probs=457.7

Q ss_pred             CCCEEEEEEEEEEECCCCCCCCCCCCC-CCCCCCCCCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCEECCCCEEECCC
Q ss_conf             803389899978886898655588424-6898765206130268988873789999999998778297624420131132
Q gi|254780979|r   21 DWEVVIGIEVHAQLSVVSKLFSGASVN-FGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKN   99 (500)
Q Consensus        21 ~~e~vIGLEiH~qL~t~tKlFc~c~~~-~~~~pNt~v~~~~~g~PG~lP~lN~~av~~ai~~~~al~~~i~~~~~fdRK~   99 (500)
                      +|++||||||||||+|+|||||+|+++ |+++|||+|||||+|+||+||++|++||++|+++|+||||+|+++++|||||
T Consensus         2 ~~~~viGLEiH~qL~T~~KlFc~c~~~~~~~~pn~~~~~v~~~~pg~lP~ln~~av~~a~~~~~al~~~i~~~~~f~RK~   81 (482)
T 3al0_B            2 RYRPVIGLEIHVQLSTKTKAFCSCPADVFELPPNTAICPVCTGQPGALPVPNEEMIRFAVKTALALNCKIHKYSRFDRKN   81 (482)
T ss_dssp             CSCCCCEEEEEEECCCSBCSSSSSBSCCTTCCTTSSCCTTTTTCTTCCCCCBHHHHHHHHHHHHHTTCCBCSEECCEEEE
T ss_pred             CCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEECCCC
T ss_conf             96348999987771799776789988656889845527153159998777799999999999998298425464412111


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEEEEEEEEEEEECCCCCCCCCC----CCCEEEEECCCCCCE
Q ss_conf             1237678882014454420153389997067777741037984236665202310011567----871488661578612
Q gi|254780979|r  100 YFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQY----SAVSCIDLNRSGVAL  175 (500)
Q Consensus       100 YfYpDlpkgyQiTQ~~~Pi~~~G~l~~~~~~~~~~~~~~~~v~I~~i~lEED~gk~~h~~~----~~~slvD~NRaGvPL  175 (500)
                      ||||||||||||||++.|||.||++++....+      .++|+|.||||||||||++|+..    +++|++||||||+||
T Consensus        82 y~y~d~p~gyQiTq~~~pi~~~G~i~~~~~~~------~~~v~I~~i~lEEDa~k~~~~~~~~~~~~~sl~d~nR~GiPL  155 (482)
T 3al0_B           82 YFYPDLPKGYQISQYFYPIATEGFLEIDGDEG------RKKVRIRRLHLEEDAGKLVHEGDSITRASYSLVDMNRCGVPL  155 (482)
T ss_dssp             CCBTTBTTSEEEECSSSCSBCCEEEEECCSSS------SEEEEEEEEEEECCCCEEEETTBSSSCCSEEEEEGGGTTCCE
T ss_pred             CCCCCCCCHHHHHCCCCCCCCCCEEECCCCCC------CEEEEEEEEEECCCCCCCCCCCCCCCCCCCEEEECCCCCCCE
T ss_conf             03799983263541601256476231247888------348806898752456623235666677863277214689864


Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCCCCCCCCCC-CCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             57630365277899999999999998642045676432201125754321376-66788622235402465999999999
Q gi|254780979|r  176 MEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEA  254 (500)
Q Consensus       176 iEIVT~Pd~~s~~ea~~~~~~l~~ilr~~gisd~~meeGslR~DvNVSi~~~~-~~~GtRvEIKNlnS~~~i~~AI~yEi  254 (500)
                      |||||+|||+||+||++|+++|++||||+|+|||+||+|+|||||||||++.| ..+||||||||+||||+|++||+||+
T Consensus       156 iEIvT~Pd~~s~eea~~~~~~l~~ilr~~g~~~~~me~G~~R~DvNvSv~~~~~~~~g~rvEIKNlnS~r~v~~Ai~~Ei  235 (482)
T 3al0_B          156 IEIVTEPDISSPREARVFMEKLRSIVRYLGVSTGDMEKGALRCDANISVVDTETGRQSNRVEVKNMNSFRFVERALEYEF  235 (482)
T ss_dssp             EEEEECTTCCSHHHHHHHHHHHHHHHHHHTSCCCCGGGTSEEEEEECCCCSSSCSSCCCCCCCCCCCSSHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEECCCCEEECCCCCCCCCCEEEECCCCHHHHHHHHHHHH
T ss_conf             79982389888899999999999999973823467544405403453353046656655032568786889999999999


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCC
Q ss_conf             99999731398003443233755433665303566777783327787731269999999885302483689886432026
Q gi|254780979|r  255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFG  334 (500)
Q Consensus       255 ~RQ~~ll~~G~~v~qETR~~d~~~~~T~~mR~KE~a~DYRyfPEPDLPpi~is~e~i~~i~~~lPelP~~~~~rl~~~yG  334 (500)
                      .||++++++|+.|.||||+||+.++.|++||+||++.||||||||||||+.|+++||++++++|||||+++++||+++||
T Consensus       236 ~RQ~~~l~~G~~v~qeTr~~d~~~~~T~~~R~Ke~a~dYRyfPEpDLPpi~i~~e~ie~i~~~LPelP~~~~~rl~~~yg  315 (482)
T 3al0_B          236 ERIVKAMERGEDVERETRGWDMATKITVSMRGKEEESDYRYFPEPDIPPVVLSDEYLEEVKKELPELPDEKAERFMREYG  315 (482)
T ss_dssp             HTTSSSSSSSCCCCCCCCEEETTTTEEECCSSCCCSCCCCCEECTTSCCEECCHHHHTTSSSSSCCCTTHHHHHHHHHHS
T ss_pred             HHHHHHHHCCCCCCCEEEEECCCCCEEEEECCCCCCCCCCCCCCCCCCCEECCHHHHHHHHHHCCCCHHHHHHHHHHHHC
T ss_conf             99998875487410002233155543675214555564466667887863059999999998689986999999999809


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHH
Q ss_conf             88999888764113678988640-24302457777654578876433874000648989999999888638731478999
Q gi|254780979|r  335 ISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKD  413 (500)
Q Consensus       335 Ls~~dA~~L~~~~~la~~FE~v~-~~~~pk~~Anwi~~el~~~ln~~~~~~~~~~i~p~~laeLi~li~~g~Is~~~aK~  413 (500)
                      ||+++|++|++++.+++||+++. ...+|+.++||+++++++.||+.+.++.+++++|++|++|+.++++|+||+++||+
T Consensus       316 Ls~~~a~~L~~~~~l~~~fe~~~~~~~~~k~aanwi~~el~~~ln~~~~~~~~~~i~~~~la~Li~li~~g~Is~~~aK~  395 (482)
T 3al0_B          316 LPEYDAKVLTSSKELAEFFEECVKVVNRPKDLSNWIMTEVLRELNERNIEITESKLTPQHFADLFKLMDEGKISIKIAKE  395 (482)
T ss_dssp             CCHHHHHHHTSSHHHHHHHHHHHHHSCCHHHHHHHHHTHHHHHTTTTTCCTTSSSCCHHHHHHHHHHHTTTSSCTTHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHH
T ss_conf             89999998873277788999999851778899999888889986241033323899999999999867548765899999


Q ss_pred             HHHHHHHCCCCHHHHHHHCCCEECCCHHHHHHHHHHHHHHCHHHHHHHH-CCCCCHHHHHHHHHHHHCCCCCHHHHHHHH
Q ss_conf             9999981799988999963987618988999999999983999899752-721322658999999728977889999999
Q gi|254780979|r  414 IFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKML  492 (500)
Q Consensus       414 il~~l~~~~~~p~~iie~~gL~~isD~~eL~~iv~eVI~~np~~V~~~k-gk~ka~gfLvGqVMK~tkGkAdpk~v~~lL  492 (500)
                      +|+.|++++++|+++++++||.++||+++|+++|++||++||++|++|+ ||++++|||||||||+|||||||++|+++|
T Consensus       396 il~~l~~~~~~~~~iie~~gl~~isD~~ele~ii~evi~~np~~V~~~k~Gk~ka~g~LmGqVMK~tkGkadpk~v~eiL  475 (482)
T 3al0_B          396 IFPEVFETGKMPSQIVEEKGLTQINDEKLIEELVKKAMEQNPKAVQDYKSGKKKAAGFFVGYVMRETKGKANPELTNRII  475 (482)
T ss_dssp             SHHHHHHHCCCHHHHHHHHTCCCCCCSSCHHHHHHHHHHTCHHHHHHHTTCCTTSTHHHHHHHHHTTSSCSCHHHHHHHH
T ss_pred             HHHHHHHCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHH
T ss_conf             99999866999999999749961688899999999999979899999877518667479999999857997999999999


Q ss_pred             HHHHCCC
Q ss_conf             9970788
Q gi|254780979|r  493 KEKLGIK  499 (500)
Q Consensus       493 ~e~L~~k  499 (500)
                      +++|.-+
T Consensus       476 ~~~L~~e  482 (482)
T 3al0_B          476 QKLLEGE  482 (482)
T ss_dssp             HHHSSCC
T ss_pred             HHHHCCC
T ss_conf             9987679


No 4  
>2d6f_C Glutamyl-tRNA(Gln) amidotransferase subunit E; ligase, ligase/RNA complex; 3.15A {Methanothermobacterthermautotrophicus} SCOP: a.182.1.2 d.74.4.1 d.128.1.5
Probab=100.00  E-value=0  Score=1166.95  Aligned_cols=447  Identities=28%  Similarity=0.457  Sum_probs=413.3

Q ss_pred             CCCEE---EEEEEEEEECCCCCCCCCCCCCC-CCCCCCCCCHHHCCCCCCCCC---------------------------
Q ss_conf             80338---98999788868986555884246-898765206130268988873---------------------------
Q gi|254780979|r   21 DWEVV---IGIEVHAQLSVVSKLFSGASVNF-GAEPNTQVSFFDAAMPGMLPI---------------------------   69 (500)
Q Consensus        21 ~~e~v---IGLEiH~qL~t~tKlFc~c~~~~-~~~pNt~v~~~~~g~PG~lP~---------------------------   69 (500)
                      |||+|   ||||||+||+|+|||||+|+++| +++|||+|||+|+|+||+||+                           
T Consensus         2 ~~e~v~~~IGLEiH~QL~T~tKlFc~c~~~~~~~~pn~~~~~~~~~~pg~lp~~~~aa~~~~~~~~~~~~~~~~~~~c~v   81 (619)
T 2d6f_C            2 DWEKVGLKMGLEIHQQLDTESKLFCPCRTELTDSEPDHDIVRNLRPTQSELGKFDRAAFEEAMRKLHFHYENYHEETCLV   81 (619)
T ss_dssp             CHHHHTCEEEEEEEEECCCSBCSSSCSBSSCCCSCCSEEEEEECCCC----------CTTTTGGGGEEEEEECTTTCCHH
T ss_pred             CHHHCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             85560780767997885799677889988778899986646545678765555448888876531001112456655433


Q ss_pred             ---------CCHHHHHHHHHHHHHHCCEECCCCEEECCCEECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEE
Q ss_conf             ---------78999999999877829762442013113212376788820144544201533899970677777410379
Q gi|254780979|r   70 ---------LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE  140 (500)
Q Consensus        70 ---------lN~~av~~ai~~~~al~~~i~~~~~fdRK~YfYpDlpkgyQiTQ~~~Pi~~~G~l~~~~~~~~~~~~~~~~  140 (500)
                               +|++||++|+++|+||||+|++.++|||||||||||||||||||   |||.||++++.          .++
T Consensus        82 ~~~~~p~~~lN~~av~~ai~~~~aln~~i~~~~~f~RK~yfypdlpkgyQitq---~i~~~G~l~~~----------~~~  148 (619)
T 2d6f_C           82 EADEEPPHPLNPEALEIAVTIALLLNMRVVDEFHTMRKQVIDGSNTGGFQRTG---LVATDGHLETP----------QGT  148 (619)
T ss_dssp             HHTSSCCCCCCHHHHHHHHHHHHHTTCEECSEECCEEEECTTSSSSSSEEEEE---EEEEEEEEEET----------TEE
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCCCCCCCCCE---EEECCEEEEEC----------CCE
T ss_conf             35667888879999999999999739833635444003688999886764024---86157089724----------863


Q ss_pred             EEEEEEEEEECCCCCCCCCCCCCEEEEECCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCC
Q ss_conf             84236665202310011567871488661578612576303652778999999999999986420456764322011257
Q gi|254780979|r  141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADV  220 (500)
Q Consensus       141 v~I~~i~lEED~gk~~h~~~~~~slvD~NRaGvPLiEIVT~Pd~~s~~ea~~~~~~l~~ilr~~gisd~~meeGslR~Dv  220 (500)
                      |+|+||||||||||++|+. ++.|++||||||||||||||+|||+||+||++|+++|+++|||+|+|++   +|||||||
T Consensus       149 v~I~rihLEEDagK~~h~~-~~~~~~DlNRaGvPLiEIVTePd~~s~eea~~~~~~l~~ilr~~~v~~g---~GslR~Dv  224 (619)
T 2d6f_C          149 VKIENLCLEEDAARRIRET-GDGVVFRLDRLGIPLVEITTDPSMSDPQQLREVAYQIGQILRSTRVKRG---LGTIRQDL  224 (619)
T ss_dssp             EEEEEEEEEECCCEEEEEE-TTEEEEETTSTTCEEEEEECCSCCCCHHHHHHHHHHHHHHHTTSSCCCS---STTCEEEE
T ss_pred             EEEEEEEECCCCCCCCCCC-CCCCEECCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCC---CCCCCCCE
T ss_conf             7578888614667233679-9972211556898648997168869999999999999999985254566---43113613


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC----------------------------------
Q ss_conf             5432137666788622235402465999999999999997313980----------------------------------
Q gi|254780979|r  221 NVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGH----------------------------------  266 (500)
Q Consensus       221 NVSi~~~~~~~GtRvEIKNlnS~~~i~~AI~yEi~RQ~~ll~~G~~----------------------------------  266 (500)
                      |||||+     ||||||||+|||++|++||+||+.||+++++.|+.                                  
T Consensus       225 NVSvr~-----GtRvEIKNlnS~~~i~kAI~~Ei~RQ~~lle~~~~~~~~~~~~~~~~~dvt~~~~~~~s~~~~~~~~~~  299 (619)
T 2d6f_C          225 NISIRD-----GARVEVKGVQDLDLIPEIVEREVKRQLSLVEIRDTLQERGAVVEDKIFDVSEVFADTESRIISSAESVL  299 (619)
T ss_dssp             EEECTT-----SCCEEEECCCCGGGHHHHHHHHHHHHHHHHHHHHHHHHTTCCEEEEEECTTGGGTTCSCHHHHTSSEEE
T ss_pred             EECCCC-----CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCHHCCCCCEEECCCCCCHHHHCCCCEEEECCCCCEE
T ss_conf             355579-----862023687656789999999999999999712201036742202324622220357426742565311


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q gi|254780979|r  267 --------------------------------------------------------------------------------  266 (500)
Q Consensus       267 --------------------------------------------------------------------------------  266 (500)
                                                                                                      
T Consensus       300 ~~~~r~~~~~~g~~~~~~~R~~~E~~dy~~~~g~~g~~hsdElp~ygi~~~et~~~r~~~~~~~~~~~~~~~~~~~~~~~  379 (619)
T 2d6f_C          300 AVKLRGFDGLIGVEIQPGRRLGTEMADYAKKRGVSGIFHTDELPAYGITEEEVRGLRDAVGASQGDAVVMVAHERVTAEN  379 (619)
T ss_dssp             EEEETTCTTTSSSEEETTEEHHHHHHHHHHTTSCSCCEETTTTTCSSCCHHHHHHHHHHTTCCSSSEEEEEEECHHHHHH
T ss_pred             EEECCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEECCCHHHHHH
T ss_conf             01126766655543466532005766556642665333332233456413577877764299802335676160778888


Q ss_pred             ---------------CCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             ---------------03443233755433665303566777783327787731269999999885302483689886432
Q gi|254780979|r  267 ---------------IRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIG  331 (500)
Q Consensus       267 ---------------v~qETR~~d~~~~~T~~mR~KE~a~DYRyfPEPDLPpi~is~e~i~~i~~~lPelP~~~~~rl~~  331 (500)
                                     |.||||+|+++ +.|.+||  |.+.||||||||||||+.|+++||++++++|||||+++++||++
T Consensus       380 a~~~v~~R~~~~~~~vpqETR~~~pd-~~t~~lR--p~~~dYRYfPEPDLppi~is~~~i~~ik~~lPELP~~~~~Rl~~  456 (619)
T 2d6f_C          380 ALREVIRRAEMAIQGVPEETRKALPD-GNTQYLR--PLPTSSRMYLETDIPLFRIEDDLLEGIRRNLPELPSEKKERIMR  456 (619)
T ss_dssp             HHHHHHHHHHHHHHCCCCEEEEECSS-SCEEEEE--ECCCCCCEEECTTSCCEECCHHHHHHHHTTCCCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHCCCCCCHHHCCCCCC-CCCCCCC--CCCCCCCCCCCCCCCCEECCHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             89999999985002452231146788-8753344--33555665889998876358899999998689998999999998


Q ss_pred             HCCCCHHHHHHHHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHH
Q ss_conf             026889998887641136789886402-4302457777654578876433874000648989999999888638731478
Q gi|254780979|r  332 EFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKI  410 (500)
Q Consensus       332 ~yGLs~~dA~~L~~~~~la~~FE~v~~-~~~pk~~Anwi~~el~~~ln~~~~~~~~~~i~p~~laeLi~li~~g~Is~~~  410 (500)
                      +||||.++|.+|++ ..+++|||+++. ..+|+.+|||+.+++ +.||+.+.+++  +++|++|++|+.|+++|+||+++
T Consensus       457 ~ygLs~~~a~~L~~-~~~~~~Fe~~~~~~~~~k~~an~l~~~l-~~L~~~~~~i~--~v~~~~La~Li~li~~g~Is~~~  532 (619)
T 2d6f_C          457 DYGLSEDLASQLVK-RNLVDEFEALTEFRVDTTVIASLLAYTL-RELRREGHDVD--GLGLDELRDAIKLLEVGKISKDA  532 (619)
T ss_dssp             TTCCCHHHHHHHHH-TTCTTTC--------CCHHHHHTTTTHH-HHHTC-------------------------------
T ss_pred             HHCCCHHHHHHHHC-CHHHHHHHHHHHCCCCHHHHHHHHHHHH-HHHHHCCCCCC--CCCHHHHHHHHHHHHCCCCCHHH
T ss_conf             72876899998851-3136899999751556033433569999-99986679867--79999999999999859956799


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHCCCEECCCHHHHHHHHHHHHHHCHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCHHHHHH
Q ss_conf             99999999817999889999639876189889999999999839998997527213226589999997289778899999
Q gi|254780979|r  411 AKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQK  490 (500)
Q Consensus       411 aK~il~~l~~~~~~p~~iie~~gL~~isD~~eL~~iv~eVI~~np~~V~~~kgk~ka~gfLvGqVMK~tkGkAdpk~v~~  490 (500)
                      ||+||+.|++++++|++++++.||.|++| ++|+.+|++||++||++|++|++  +++|||||||||+|||||||+.|++
T Consensus       533 aK~vl~~m~~~~~~~~eii~~~gL~qisd-~eLe~iv~eVI~~Np~~V~~yk~--G~~gflvGqVMK~tkGkAnPk~V~~  609 (619)
T 2d6f_C          533 LRDIVACMADEGLAAEDAARKLNLLLLAE-DEIESIIQEIVEGNLDMISERGM--GAMGPLMGQAMGRLRGRADGKVVNR  609 (619)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHHHHHHHHCCCCHHHHHHHCCCEECCH-HHHHHHHHHHHHHCHHHHHHHHC--CCCCCHHHHHHHHHCCCCCHHHHHH
T ss_conf             99999999857999999999769930588-99999999999979999999858--9834389999998679979999999


Q ss_pred             HHHHHHCCC
Q ss_conf             999970788
Q gi|254780979|r  491 MLKEKLGIK  499 (500)
Q Consensus       491 lL~e~L~~k  499 (500)
                      +|+++|+-+
T Consensus       610 lL~ekL~~~  618 (619)
T 2d6f_C          610 ILREKIQER  618 (619)
T ss_dssp             ---------
T ss_pred             HHHHHHHHH
T ss_conf             999999701


No 5  
>3kfu_F Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus}
Probab=100.00  E-value=0  Score=1140.70  Aligned_cols=393  Identities=41%  Similarity=0.722  Sum_probs=381.1

Q ss_pred             CCEEEEEEEEEEECCCCCCCCCCCCC-CCCCCCCCCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCEECCCCEEECCCE
Q ss_conf             03389899978886898655588424-68987652061302689888737899999999987782976244201311321
Q gi|254780979|r   22 WEVVIGIEVHAQLSVVSKLFSGASVN-FGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNY  100 (500)
Q Consensus        22 ~e~vIGLEiH~qL~t~tKlFc~c~~~-~~~~pNt~v~~~~~g~PG~lP~lN~~av~~ai~~~~al~~~i~~~~~fdRK~Y  100 (500)
                      ||+||||||||||+|+|||||+|+++ ||++|||+|||||+|+||+||++|++||++|+++|+||||+|++.++||||||
T Consensus         2 ~e~vIGLEiH~qL~T~tKlFc~c~~~~~~~~pNt~vc~vc~g~PG~lP~lN~~av~~ai~~~lal~~~i~~~~~fdRK~Y   81 (466)
T 3kfu_F            2 YEAVIGLEVHLHLKTRTKMFCGCRADYFGAEPNTHTCPVCLGLPGALPVPNRVAVEHGLRLALALGAEVPERLVFHRKNY   81 (466)
T ss_dssp             CCEEEEEEEEEEBCCSSCSSSCSCCCCSSCCTTSSCCTTTTTCTTCCCCCBHHHHHHHHHHHHHHTEECCSEECCEEEEC
T ss_pred             CCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEE
T ss_conf             75388899878818997788899886568998563086024799998877999999999999983984674637867779


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEEEEEEEEEEEECCCCCCCCCCCCCEEEEECCCCCCEEEEEE
Q ss_conf             23767888201445442015338999706777774103798423666520231001156787148866157861257630
Q gi|254780979|r  101 FYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT  180 (500)
Q Consensus       101 fYpDlpkgyQiTQ~~~Pi~~~G~l~~~~~~~~~~~~~~~~v~I~~i~lEED~gk~~h~~~~~~slvD~NRaGvPLiEIVT  180 (500)
                      |||||||||||||++.|||.||++++.          .++|+|.||||||||||++|.  ++.|+|||||||+|||||||
T Consensus        82 fYpDlpkgyQiTQ~~~pi~~~G~l~~~----------~~~i~I~rihLEEDagk~~h~--~~~slvD~NRaGvPLiEIVT  149 (466)
T 3kfu_F           82 FYPDLPKNYQISQYDLPLGRGGSLPLG----------ERRVRIKRLHLEEDAGKSLHL--EGRTLLDLNRAGSPLIELVT  149 (466)
T ss_dssp             CCTTCTTSEEEECSSSCSEEECEEEET----------TEEEEEEEEEEEECCCEEEEE--TTEEEEETTSTTCEEEEEEE
T ss_pred             ECCCCCCCCCCCCCCCCCCCCCEEECC----------CEEECEEEEEEEHHCCEECCC--CCCEEEEECCCCCCEEEEEE
T ss_conf             889899883612141552278577358----------658752899996301721157--99769851368985479980


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             36527789999999999999864204567643220112575432137666788622235402465999999999999997
Q gi|254780979|r  181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI  260 (500)
Q Consensus       181 ~Pd~~s~~ea~~~~~~l~~ilr~~gisd~~meeGslR~DvNVSi~~~~~~~GtRvEIKNlnS~~~i~~AI~yEi~RQ~~l  260 (500)
                      +|||+||+||++|+++|++||||+|+|||+||+|+||||||||||+.|++|||||||||||||++|++||+||+.||+++
T Consensus       150 ePd~~s~~eA~~~~~~L~~ilr~lgvsd~~meeGslR~DvNVSir~~g~~~g~RvEiKNlNS~~~v~kAIeyEi~RQ~~~  229 (466)
T 3kfu_F          150 EPDLKTPEEARLFLQRIQALVQTLGISDASPEEGKLRADVNVSVRRVGEPLGTKVEIKNLNSFKSVQRALEYEIRRQTEI  229 (466)
T ss_dssp             CTTBCCHHHHHHHHHHHHHHHHHHTSBCCCGGGTCEEEEEEEEECCSSSSCCCCEEEEEECCHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             47868899999999999999997087767511361414650564147887776577516655468999999999999999


Q ss_pred             HHCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHH
Q ss_conf             31398003443233755433665303566777783327787731269999999885302483689886432026889998
Q gi|254780979|r  261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDA  340 (500)
Q Consensus       261 l~~G~~v~qETR~~d~~~~~T~~mR~KE~a~DYRyfPEPDLPpi~is~e~i~~i~~~lPelP~~~~~rl~~~yGLs~~dA  340 (500)
                      ++.|+.|.||||+||+.++.|++||+||+++||||||||||||+.|+++||++++++|||||+++++|| .+||||+++|
T Consensus       230 l~~G~~v~qETR~wd~~~~~T~~mRsKE~a~DYRYfPEPDLPPi~Is~e~Ie~Ir~~LPELP~~rr~Rl-~~yGLs~~dA  308 (466)
T 3kfu_F          230 LRRGEKVKQATMGFEEGSGKTYPMRTKEEEADYRYFPEPDLPPVAIPRDWLEEVRRSLPELPWEKEARY-RALGIKEKDA  308 (466)
T ss_dssp             HTSSCCCCCCEECEETTTTEECCC------CCCCCEECTTSCCEECCHHHHHHHHSSCCCCHHHHHHHH-TTTTCCHHHH
T ss_pred             HHCCCCCCEEEECCCCCCCCEEEEEECCCCCCCCEECCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHH-HHCCCCHHHH
T ss_conf             976996310440443456960013665776655543179978765788999999971998879999999-9839999999


Q ss_pred             HHHHHHHHHHHHHHHHHC--CCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             887641136789886402--430245777765457887643387400064898999999988863873147899999999
Q gi|254780979|r  341 SVLVSDKSIADYFEKLAV--NRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNIL  418 (500)
Q Consensus       341 ~~L~~~~~la~~FE~v~~--~~~pk~~Anwi~~el~~~ln~~~~~~~~~~i~p~~laeLi~li~~g~Is~~~aK~il~~l  418 (500)
                      .+|++++.+++|||++..  ..+||.+||||++||++.||+.++++++++++|++|++|++|+++|+||+++||+||++|
T Consensus       309 ~vLv~d~~la~yFE~~v~~~~~~pK~~ANWi~~eL~~~Lnk~~~~i~~~~vtp~~LaeLI~LI~~g~IS~k~AKeVL~em  388 (466)
T 3kfu_F          309 EVLAYTPSLARFLDQALPLGLASPQALANWLLADVAGLLHERGLRLEETRLSPEGLARLVGLFERGEVTSRVAKSLLPEV  388 (466)
T ss_dssp             HHHHSCHHHHHHHHHHTTSSSSCHHHHHHHHHTHHHHHHHHHTCCSTTSSCCHHHHHHHHHHHHTTSSCHHHHHHHHHHH
T ss_pred             HHHHCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCHHHCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             99972898999999999853888899888999999999977789866579999999999999967987668999999999


Q ss_pred             HHCCCCHHHH
Q ss_conf             8179998899
Q gi|254780979|r  419 WEKGGTPKEI  428 (500)
Q Consensus       419 ~~~~~~p~~i  428 (500)
                      ++ |+||+..
T Consensus       389 le-GeDP~~~  397 (466)
T 3kfu_F          389 LE-GQDPEAX  397 (466)
T ss_dssp             TT-TCCCCCC
T ss_pred             HC-CCCCCCC
T ss_conf             77-9998864


No 6  
>1zq1_C Glutamyl-tRNA(Gln) amidotransferase subunit E; X-RAY, 3D structure, asparaginase 1 family, GATD subfamily, lyase; 3.00A {Pyrococcus abyssi} SCOP: a.182.1.2 d.74.4.1 d.128.1.5
Probab=100.00  E-value=0  Score=1156.04  Aligned_cols=449  Identities=27%  Similarity=0.416  Sum_probs=412.0

Q ss_pred             CCCCCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCC----CCCCCHHHCCC----CCCCCCC------------------
Q ss_conf             454780338989997888689865558842468987----65206130268----9888737------------------
Q gi|254780979|r   17 GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEP----NTQVSFFDAAM----PGMLPIL------------------   70 (500)
Q Consensus        17 ~~~~~~e~vIGLEiH~qL~t~tKlFc~c~~~~~~~p----Nt~v~~~~~g~----PG~lP~l------------------   70 (500)
                      .+.+.|+.+||||||+||+|+ ||||+|+++|+++|    |+++||+|.++    ||+||++                  
T Consensus         8 ~~~~~~~~~iGLEiH~QL~T~-KlFc~c~~~~~~~~~~~~~~~~~~~~~~l~~~~Pgalp~~~~~~~~~~~~~~~~~~l~   86 (633)
T 1zq1_C            8 FNYEELGLKVGLEIHRQLDTK-KLFSPVPSELSDKVEFTFQRRLRPTMSELGEIDPAALEEFKKGRVYVYEGNYELTDLV   86 (633)
T ss_dssp             SCTTTTTCCBEEEEEEEBSSB-CTTSSCBCCCCSCCCEEEEECCCCCEETTSCBCHHHHHHHHTTCEEEEEECTTTCBGG
T ss_pred             CCHHHHCCEEEEEEEEEECCC-EECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCC
T ss_conf             698997967879999876773-1478998767777654456777873013466787524555421000002454421001


Q ss_pred             ----------CHHHHHHHHHHHHHHCCEECCCCEEECCCEECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEE
Q ss_conf             ----------8999999999877829762442013113212376788820144544201533899970677777410379
Q gi|254780979|r   71 ----------NGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE  140 (500)
Q Consensus        71 ----------N~~av~~ai~~~~al~~~i~~~~~fdRK~YfYpDlpkgyQiTQ~~~Pi~~~G~l~~~~~~~~~~~~~~~~  140 (500)
                                |++||++|+++|+||||+|++.++|||||||||||||||||||   |||.||+++++.          ++
T Consensus        87 ~~~~~p~~~~N~~Av~~ai~~~~alnc~i~~~~~f~RK~yfypd~p~gyQitq---~i~~~G~i~~~~----------~~  153 (633)
T 1zq1_C           87 YMDEEPPRGPDREALEVALQIAYLLNAKPVDEVYYMRKIVIDGSNVSGFQRTA---IIATDGKVETPW----------GA  153 (633)
T ss_dssp             GTTSSCCCCCCHHHHHHHHHHHHHTTCEECSEECCEEEECSSSSSTTSEEEEC---EEEEEEEECCTT----------CC
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCEEE---EEECCEEEECCC----------CC
T ss_conf             24667887668999999999999819972435556026761888777634036---863773895357----------71


Q ss_pred             EEEEEEEEEECCCCCCCCCCCCCEEEEECCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCC
Q ss_conf             84236665202310011567871488661578612576303652778999999999999986420456764322011257
Q gi|254780979|r  141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADV  220 (500)
Q Consensus       141 v~I~~i~lEED~gk~~h~~~~~~slvD~NRaGvPLiEIVT~Pd~~s~~ea~~~~~~l~~ilr~~gisd~~meeGslR~Dv  220 (500)
                      |+|.||||||||||++|+. +++|+|||||||+|||||||+|||+||+||++|+++||++|||+|+|+++|  |||||||
T Consensus       154 i~I~rihLEEDagK~~h~~-~~~s~vD~NRaGvPLiEIVTePd~~speeA~~~~~~l~~~lr~~~~~~~~~--Gs~R~Dv  230 (633)
T 1zq1_C          154 VGIPTICLEEDAARIIERK-DKEVIYRLDRLGIPLIEISTTPDIHHPEQAKVVAKFIGDALRATKKVKRGL--GTIRQDL  230 (633)
T ss_dssp             EEEEEEEEEECCCEEEEEE-TTEEEEESTTTTCEEEEEECCTTBCSHHHHHHHHHHHHHHHHHTSCBCCSS--TTEEEEE
T ss_pred             CCEEEEEEECCCCCCCCCC-CCCEEEECCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCC--CCCCCCC
T ss_conf             6527898602345212578-995478104689756898506886799999999999999999986325778--7423566


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH--------------------------------------
Q ss_conf             543213766678862223540246599999999999999731--------------------------------------
Q gi|254780979|r  221 NVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILE--------------------------------------  262 (500)
Q Consensus       221 NVSi~~~~~~~GtRvEIKNlnS~~~i~~AI~yEi~RQ~~ll~--------------------------------------  262 (500)
                      ||||+     +||||||||+|||++|++||+||+.||+++|+                                      
T Consensus       231 NVSv~-----~g~rvEIKNlns~~~i~~aie~Ei~RQ~~ll~~~~~~~~~~~~~~~~~~~~~dvT~~f~~~~sk~v~~~l  305 (633)
T 1zq1_C          231 NVSIK-----GGARIEIKGVQELDMIPIIIEREVERQLNLLKIRDELRKRGVKPKDIKEEFYDVTDIFENTKSKIIARVI  305 (633)
T ss_dssp             EECCT-----TSCCEEEECCCSGGGHHHHHHHHHHHHHHHHHHHHHHHHHCCCGGGSCCCCEECTTTTTTCSCHHHHHHH
T ss_pred             CCCCC-----CCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHCCCCHHHHHHHH
T ss_conf             63468-----9854885066568899999999999999999724466541467665664202312321344138888775


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q gi|254780979|r  263 --------------------------------------------------------------------------------  262 (500)
Q Consensus       263 --------------------------------------------------------------------------------  262 (500)
                                                                                                      
T Consensus       306 ~~gg~v~~~~l~~~~g~~g~~~~~~~Rlg~Ela~~aK~~v~Gi~HsDElp~ygi~~~ev~~i~~~l~~~~~dafil~~~~  385 (633)
T 1zq1_C          306 KKGGKVLAIKLPKFRGLIGREIQPGRRLGTEFADRAKKYVPGIFHIDELPNYGISQEEVNKVIERLNLSEEDAFVLVAAE  385 (633)
T ss_dssp             HTTCEEEECEETTCTTTSSSEEETTEEHHHHHHHHHTTTCSCCEEGGGCSBTTBCHHHHHHHHHHTTCCSSCEEEEEEES
T ss_pred             HCCCEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEECCC
T ss_conf             05875898642665554454457664100466777753247766644456667527889999987368855445785160


Q ss_pred             -----------------CCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHH
Q ss_conf             -----------------398003443233755433665303566777783327787731269999999885302483689
Q gi|254780979|r  263 -----------------DGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAK  325 (500)
Q Consensus       263 -----------------~G~~v~qETR~~d~~~~~T~~mR~KE~a~DYRyfPEPDLPpi~is~e~i~~i~~~lPelP~~~  325 (500)
                                       +|+.|.||||+||++ +.|.+||+|+  .||||||||||||+.|+++||++++++|||||+++
T Consensus       386 ~~~~~~a~~~v~~R~~E~g~~I~QETR~~d~d-g~T~~mR~~~--~DYRYFPEPDLPPl~Is~e~Ie~ir~~LPELP~~r  462 (633)
T 1zq1_C          386 EEKAKNALREVIKRAREAIEGVPEETRRALPD-GNTEYMRPLP--GKARMYPETDIPPLRIPDDLKKKIKENLPELPQAK  462 (633)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCCCCCEEEECTT-SCEEEEECCC--CCCCEEECTTSCCEECCHHHHHHHHTSCCCCHHHH
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC-CCEEEECCCC--CCCCCCCCCCCCCEECCHHHHHHHHHHCCCCHHHH
T ss_conf             88888778877555664279765301244788-9875300025--56787999997887628999999998689987999


Q ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHHHHH-HHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             886432026889998887641136789886-4024302457777654578876433874000648989999999888638
Q gi|254780979|r  326 RERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDG  404 (500)
Q Consensus       326 ~~rl~~~yGLs~~dA~~L~~~~~la~~FE~-v~~~~~pk~~Anwi~~el~~~ln~~~~~~~~~~i~p~~laeLi~li~~g  404 (500)
                      ++||+++||||+++|.+|++++ +++||++ +..+.+||.+|||++++|.+++++    +...+++|++|++|+.|+.+|
T Consensus       463 ~~R~~~~ygLs~~dA~iL~~~~-~~~~Fee~v~~~~~pk~aanwl~~~L~~~~~e----~~~~~i~~~~la~Li~lv~~g  537 (633)
T 1zq1_C          463 VERYVKEYKLDRSLAQTLVDDE-RDELFEELVSMGVKPSLAASILVVVLKGLRKE----VPIENVTDEHIREAFQLYLEG  537 (633)
T ss_dssp             HHHHHTTTCCCHHHHHHHHHTS-THHHHHHHHHTTCSTTHHHHHHHHTTCC-----------------------------
T ss_pred             HHHHHHHCCCCHHHHHHHHCCH-HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH----CCCCCCCHHHHHHHHHHHHCC
T ss_conf             9999997199999999986222-37889999873888899999999999987431----776789999999999999769


Q ss_pred             CCCHHHHHHHHHHHHHC-CCCHHHHHHHCCCEECCCHHHHHHHHHHHHHHCHHHHHHHHCCCCCHHHHHHHHHHHHCCCC
Q ss_conf             73147899999999817-99988999963987618988999999999983999899752721322658999999728977
Q gi|254780979|r  405 TISGKIAKDIFNILWEK-GGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKA  483 (500)
Q Consensus       405 ~Is~~~aK~il~~l~~~-~~~p~~iie~~gL~~isD~~eL~~iv~eVI~~np~~V~~~kgk~ka~gfLvGqVMK~tkGkA  483 (500)
                      +||.++||+||.+|+.+ +++|.+||+++||.|+||+ +|+++|++||++||++|++++  .+++|||||||||+|||||
T Consensus       538 ~Is~~~aK~vl~~~~~~~~~~~~~Iiee~gL~qisD~-eL~~iV~eVi~~Np~~Vk~~k--~~a~gfLvGqVMK~tkGkA  614 (633)
T 1zq1_C          538 KIAKEAFEEIFKELARNPSKSAREVAEEKGLTLLSEE-EVTRIIEEVIQQNIEVVKAKG--MGAMGLIMGRVMAKVRGKA  614 (633)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CCHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCCCCHH-HHHHHHHHHHHHCHHHHHHCC--CCCCCCHHHHHHHHHCCCC
T ss_conf             1379999999999975899899999996799147999-999999999997999997243--6661257999999867996


Q ss_pred             CHHHHHHHHHHHHCC
Q ss_conf             889999999997078
Q gi|254780979|r  484 NPSIVQKMLKEKLGI  498 (500)
Q Consensus       484 dpk~v~~lL~e~L~~  498 (500)
                      ||+.|+++|+++|+-
T Consensus       615 nPk~V~elL~e~L~~  629 (633)
T 1zq1_C          615 DGKLVSQIVRRKLQE  629 (633)
T ss_dssp             ---------------
T ss_pred             CHHHHHHHHHHHHHH
T ss_conf             999999999999998


No 7  
>2hz7_A Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, class I aminoacyl-tRNA synthetase, ligase; 2.30A {Deinococcus radiodurans}
Probab=100.00  E-value=0  Score=381.86  Aligned_cols=202  Identities=25%  Similarity=0.378  Sum_probs=185.5

Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             7777833277877312699999998853024836898864320268--89998887641136789886402430245777
Q gi|254780979|r  290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGI--SLYDASVLVSDKSIADYFEKLAVNRDKKIVAN  367 (500)
Q Consensus       290 a~DYRyfPEPDLPpi~is~e~i~~i~~~lPelP~~~~~rl~~~yGL--s~~dA~~L~~~~~la~~FE~v~~~~~pk~~An  367 (500)
                      ..++++++. |--....+.+.....+..+||||+++++||+.+|||  +++||.+|++++.+++|||+++.+.+||.+||
T Consensus       647 ~p~ak~~~~-~~~~~~~s~~~~~~~~~~~PeLp~~~~~Rf~~~~~L~~~~~dA~~l~~~~~la~~fe~~~~~~~~k~~an  725 (851)
T 2hz7_A          647 RPSTKGRGP-DEVRGEGSSSPAKAHAPKAQPLTPEQDAEFTRLLGLGASEGDARTIARDPALLAFVGGAAPGDTFAQVAS  725 (851)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHCCHHHHHHHHHHHHCCCHHHHHH
T ss_conf             753334688-7665534456542122457889999999999875479998899988678889999999971697588899


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCHHHHHHHCCCEECCCHHHHHHHH
Q ss_conf             76545788764338740006489899999998886387314789999999981799988999963987618988999999
Q gi|254780979|r  368 WVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVV  447 (500)
Q Consensus       368 wi~~el~~~ln~~~~~~~~~~i~p~~laeLi~li~~g~Is~~~aK~il~~l~~~~~~p~~iie~~gL~~isD~~eL~~iv  447 (500)
                      |+++||++.||+.     +++++|++|++|+.||++|+||+++||+||++|++++++|.+||+++||.|+||+++|+.+|
T Consensus       726 w~~~e~~~~l~~~-----~~~v~~~~la~l~~~i~~~~Is~k~ak~v~~~~~~~g~~p~~ive~~Gl~qisd~~~l~~~v  800 (851)
T 2hz7_A          726 WTVNELVAGLRAG-----EVKVRAADLAPLAEGVASGQLSARIAREALARAAASGDAPLTIIEREGLNAGLSAEALQQVV  800 (851)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHHHHHHHHCCC-----CCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCHHHHHHHCCCEECCCHHHHHHHH
T ss_conf             9999998871457-----78889999999999997396307879999999986399989999854980327889999999


Q ss_pred             HHHHHHCHHHHHHHH-CCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             999983999899752-72132265899999972897788999999999707
Q gi|254780979|r  448 DEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG  497 (500)
Q Consensus       448 ~eVI~~np~~V~~~k-gk~ka~gfLvGqVMK~tkGkAdpk~v~~lL~e~L~  497 (500)
                      ++||++||++|++|+ ||++++|||||||||+|||||||++|++||+++|.
T Consensus       801 ~~vla~np~~v~~y~~Gk~k~~gf~vGqvMk~t~GkAnp~~vn~ll~~~Ls  851 (851)
T 2hz7_A          801 AQVIAANPDKAEAYRGGKTALLGFFTGQVMRATAGKADPQALAAALKDALA  851 (851)
T ss_dssp             ---------------------------------------------------
T ss_pred             HHHHHHCHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC
T ss_conf             999997969999987326765446888878860798798999999999749


No 8  
>1ng6_A Hypothetical protein YQEY; structural genomics, domain GATB/YQEY, PFAM02637, DUF186, PSI, protein structure initiative; 1.40A {Bacillus subtilis} SCOP: a.182.1.1
Probab=98.01  E-value=2.6e-05  Score=57.99  Aligned_cols=96  Identities=17%  Similarity=0.260  Sum_probs=68.3

Q ss_pred             CCCHHHHHHHHH-HHHCCCCCHHHHHHHHHHHHHCCC--------CHHHHHHHCCCEECCCHHHHHHHHHHHHHHCHHHH
Q ss_conf             489899999998-886387314789999999981799--------98899996398761898899999999998399989
Q gi|254780979|r  388 PISPNQLGELID-LIIDGTISGKIAKDIFNILWEKGG--------TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNV  458 (500)
Q Consensus       388 ~i~p~~laeLi~-li~~g~Is~~~aK~il~~l~~~~~--------~p~~iie~~gL~~isD~~eL~~iv~eVI~~np~~V  458 (500)
                      +++.+.+..++. ++.+       -++-++.+-..+.        .--+++++.-..++| +++|+.+|+++|+++..  
T Consensus        44 ~l~D~~~i~vi~k~vKq-------r~es~~~~~~~~R~dl~e~e~~Ei~il~~yLP~~ls-eeEl~~~v~~~i~e~~a--  113 (148)
T 1ng6_A           44 SLTEDEELTVLSRELKQ-------RKDSLQEFSNANRLDLVDKVQKELDILEVYLPEQLS-EEELRTIVNETIAEVGA--  113 (148)
T ss_dssp             CCCHHHHHHHHHHHHHH-------HHHHHHHHHHHTCHHHHHHHHHHHHHHGGGSCCCCC-HHHHHHHHHHHHHHTTC--
T ss_pred             CCCHHHHHHHHHHHHHH-------HHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCC-HHHHHHHHHHHHHHHCC--
T ss_conf             99989999999999998-------999999998838688999899888999984610489-79999999999998189--


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             975272132265899999972897788999999999707
Q gi|254780979|r  459 ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG  497 (500)
Q Consensus       459 ~~~kgk~ka~gfLvGqVMK~tkGkAdpk~v~~lL~e~L~  497 (500)
                          ..++-+|..||.+|++.+|+||++.|++++++.|+
T Consensus       114 ----~~~kdmGkvM~~l~~~~~g~~Dg~~vs~iVk~~Ls  148 (148)
T 1ng6_A          114 ----SSKADMGKVMGAIMPKVKGKADGSLINKLVSSQLS  148 (148)
T ss_dssp             ----CSGGGHHHHHHHHHHHHTTTSCHHHHHHHHHHHCC
T ss_pred             ----CCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHC
T ss_conf             ----98136899999999882787877999999998709


No 9  
>2d6f_C Glutamyl-tRNA(Gln) amidotransferase subunit E; ligase, ligase/RNA complex; 3.15A {Methanothermobacterthermautotrophicus} SCOP: a.182.1.2 d.74.4.1 d.128.1.5
Probab=76.38  E-value=0.31  Score=28.00  Aligned_cols=57  Identities=19%  Similarity=0.223  Sum_probs=36.8

Q ss_pred             CCCCCCCCCEEEE--EECCCCCCCC-------CCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHH
Q ss_conf             3233755433665--3035667777-------8332778773126999999988530248368988
Q gi|254780979|r  271 TRLFDPSKNETRS--LRTKEDALDY-------RYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRE  327 (500)
Q Consensus       271 TR~~d~~~~~T~~--mR~KE~a~DY-------RyfPEPDLPpi~is~e~i~~i~~~lPelP~~~~~  327 (500)
                      ||+||...|.+..  +|.|++..||       -.|+--.+|..-|+++.+..++..+...+.++..
T Consensus       303 ~r~~~~~~g~~~~~~~R~~~E~~dy~~~~g~~g~~hsdElp~ygi~~~et~~~r~~~~~~~~~~~~  368 (619)
T 2d6f_C          303 LRGFDGLIGVEIQPGRRLGTEMADYAKKRGVSGIFHTDELPAYGITEEEVRGLRDAVGASQGDAVV  368 (619)
T ss_dssp             ETTCTTTSSSEEETTEEHHHHHHHHHHTTSCSCCEETTTTTCSSCCHHHHHHHHHHTTCCSSSEEE
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCEEE
T ss_conf             267666555434665320057665566426653333322334564135778777642998023356


No 10 
>1ltz_A Phenylalanine-4-hydroxylase; oxidoreductase, dihydrobiopterin, bacterial enzyme; HET: HBI; 1.40A {Chromobacterium violaceum} SCOP: d.178.1.1 PDB: 1ltv_A 1ltu_A*
Probab=61.15  E-value=4.6  Score=19.30  Aligned_cols=45  Identities=22%  Similarity=0.377  Sum_probs=36.9

Q ss_pred             CEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCC
Q ss_conf             336653035667777833277877312699999998853024836898864320268
Q gi|254780979|r  279 NETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGI  335 (500)
Q Consensus       279 ~~T~~mR~KE~a~DYRyfPEPDLPpi~is~e~i~~i~~~lPelP~~~~~rl~~~yGL  335 (500)
                      -.|..+|+.+.-.   |-||||+         +-++---+|.|-+.....|...||.
T Consensus       117 p~t~~IR~~~~~~---YtpEPDi---------fHe~~GHvP~Lanp~fAdf~q~~G~  161 (297)
T 1ltz_A          117 PVTWWLREPHQLD---YLQEPDV---------FHDLFGHVPLLINPVFADYLEAYGK  161 (297)
T ss_dssp             EEECSCCCTTCSS---SCCSCCH---------HHHHHHTGGGGGSHHHHHHHHHHHH
T ss_pred             CCCCEECCCCCCC---CCCCCCC---------HHCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             4523315876456---6889941---------3200024642038899999999977


No 11 
>2v27_A Phenylalanine hydroxylase; cold adaptation, tetrahydrobiopterin, stability, flexibility, alkaptonuria, oxidoreductase; 1.50A {Colwellia psychrerythraea 34H} PDB: 2v28_A
Probab=59.61  E-value=5.3  Score=18.87  Aligned_cols=44  Identities=23%  Similarity=0.505  Sum_probs=34.9

Q ss_pred             CEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCC
Q ss_conf             33665303566777783327787731269999999885302483689886432026
Q gi|254780979|r  279 NETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFG  334 (500)
Q Consensus       279 ~~T~~mR~KE~a~DYRyfPEPDLPpi~is~e~i~~i~~~lPelP~~~~~rl~~~yG  334 (500)
                      -.|..||+.+.-   -|-||||+         +-++---+|.|-+.....|...||
T Consensus       101 p~t~~IR~~~~~---~YtpEPDi---------fHe~fGH~PlL~~p~fA~f~~~~G  144 (275)
T 2v27_A          101 PVATFIRSREEM---DYLQEPDI---------FHEIFGHCPLLTNSSFANYTEAYG  144 (275)
T ss_dssp             EEECCCCCSTTT---TCCSSCCH---------HHHHHHTGGGGGSHHHHHHHHHHH
T ss_pred             CCCCEECCCCCC---CCCCCCCC---------HHCCCCCCHHHCCHHHHHHHHHHH
T ss_conf             452432688756---67899961---------003314231207999999999999


No 12 
>1va6_A Glutamate--cysteine ligase; glutathione homeostasis, beta barrel, peptide synthesis, transition state analogue; HET: P2S ADP P6G; 2.10A {Escherichia coli} SCOP: d.128.1.4 PDB: 1v4g_A* 2d32_A* 2d33_A*
Probab=53.87  E-value=10  Score=16.79  Aligned_cols=34  Identities=21%  Similarity=0.220  Sum_probs=24.4

Q ss_pred             EEECCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             86615786125763036527789999999999999864
Q gi|254780979|r  166 IDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRY  203 (500)
Q Consensus       166 vD~NRaGvPLiEIVT~Pd~~s~~ea~~~~~~l~~ilr~  203 (500)
                      -||--   .|+|+||- ...|+++|..|+..|+..+..
T Consensus        59 TDfsE---s~lE~iTp-~~~~~~~~~~~L~~lh~~~~~   92 (518)
T 1va6_A           59 TDFAE---ALLEFITP-VDGDIEHMLTFMRDLHRYTAR   92 (518)
T ss_dssp             ECSBT---TEEEEECC-CBSCHHHHHHHHHHHHHHHHT
T ss_pred             CCCCH---HHHHHCCC-CCCCHHHHHHHHHHHHHHHHH
T ss_conf             75668---87773789-999999999999999999995


No 13 
>3nzt_A Glutamate--cysteine ligase; structural genomics, center for structural genomics of infec diseases, csgid, alpha and beta proteins; HET: AMP; 2.00A {Francisella tularensis subsp}
Probab=48.72  E-value=12  Score=16.23  Aligned_cols=105  Identities=10%  Similarity=0.150  Sum_probs=43.1

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCHHHH----HH-------H
Q ss_conf             457777654578876433874000648989999999888638731478999999998179998899----99-------6
Q gi|254780979|r  363 KIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEI----VE-------E  431 (500)
Q Consensus       363 k~~Anwi~~el~~~ln~~~~~~~~~~i~p~~laeLi~li~~g~Is~~~aK~il~~l~~~~~~p~~i----ie-------~  431 (500)
                      +.+|..|+.++......-+..      -.+.+......+.+-..|-+  -.+++.|-+.+  ..+.    ++       .
T Consensus       408 kd~a~~ILdeL~~iAe~LD~e------Y~~al~~~~~kv~dP~lTpS--arIL~e~~e~g--f~efgL~lAk~hke~~~~  477 (525)
T 3nzt_A          408 KDYALELFDEIEAVAKKMPKE------YLDAVEIQKRKVLDISQTPS--AKIIELARQHG--YKKFILDISRRVSQQFRS  477 (525)
T ss_dssp             HHHHHHHHHHHHHHHTTSCHH------HHHHHHHHHHHHHCGGGSHH--HHHHHHHHHHC--HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHCHH------HHHHHHHHHHHHCCCCCCHH--HHHHHHHHHCC--HHHHHHHHHHHHHHHHHC
T ss_conf             999999999999999986899------99999999998609577958--99999999669--999999999999999974


Q ss_pred             CCCEECCCHHHHHHHHHHHHHHCHHHHHHHHCCCCCHHHHHHHHHHHHCC
Q ss_conf             39876189889999999999839998997527213226589999997289
Q gi|254780979|r  432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGG  481 (500)
Q Consensus       432 ~gL~~isD~~eL~~iv~eVI~~np~~V~~~kgk~ka~gfLvGqVMK~tkG  481 (500)
                      ..+.. .+...++....+.+.+- +.++.  .....+--|+.+-.+.+||
T Consensus       478 ~~ls~-~~~~~le~eA~~SL~~q-~~IE~--~d~~sFdeyL~~Y~~q~K~  523 (525)
T 3nzt_A          478 YELPA-AIVAKLKDQAGQSVAAE-KELVA--NDKISLDEYINRYYKSSKG  523 (525)
T ss_dssp             SCCCH-HHHHHHHHHHHHHHHHH-HHHHH--HCCSCHHHHHHHHHHGGGS
T ss_pred             CCCCH-HHHHHHHHHHHHHHHHH-HHHHH--CCCCCHHHHHHHHHHHHCC
T ss_conf             88884-78999999999999999-98874--2689999999999998547


No 14 
>1qqp_2 FMDV, protein (genome polyprotein); heparan sulphate, virus-receptor interactions/protein-carbohydrate interactions; HET: IDX SGN IDS; 1.90A {Foot-and-mouth disease virus} PDB: 1fod_2 1bbt_2* 1fmd_2 1qgc_2 1zba_2* 1zbe_2
Probab=45.19  E-value=7.4  Score=17.81  Aligned_cols=19  Identities=16%  Similarity=0.174  Sum_probs=16.2

Q ss_pred             EEEEEEEEECCCCCCCCCCC
Q ss_conf             98999788868986555884
Q gi|254780979|r   26 IGIEVHAQLSVVSKLFSGAS   45 (500)
Q Consensus        26 IGLEiH~qL~t~tKlFc~c~   45 (500)
                      -|++||||.+. +|.+++|-
T Consensus       103 ~g~~v~Vqvna-s~Fh~G~L  121 (218)
T 1qqp_2          103 NGWDVEVTAVG-NQFNGGCL  121 (218)
T ss_dssp             EEEEEEEEECC-CTTCEEEE
T ss_pred             CCEEEEEEEEC-CCCCCEEE
T ss_conf             88999999959-98650089


No 15 
>2ws9_2 P1; 3.00A {Equine rhinitis a virus} PDB: 2wff_2
Probab=43.68  E-value=9.2  Score=17.09  Aligned_cols=22  Identities=36%  Similarity=0.306  Sum_probs=17.8

Q ss_pred             EEEEEEEEEEECCCCCCCCCCCC
Q ss_conf             38989997888689865558842
Q gi|254780979|r   24 VVIGIEVHAQLSVVSKLFSGASV   46 (500)
Q Consensus        24 ~vIGLEiH~qL~t~tKlFc~c~~   46 (500)
                      .-.|.+||||.|. +|-+++|--
T Consensus       104 ~R~G~~v~VQ~Na-s~Fh~G~Ll  125 (230)
T 2ws9_2          104 VKNGWDVVVQVNA-SFAHSGALC  125 (230)
T ss_dssp             EEEEEEEEEEECC-CTTCEEEEE
T ss_pred             ECCCEEEEEEEEC-CCCCCCEEE
T ss_conf             0287899999936-875422799


No 16 
>1cuk_A RUVA protein; DNA repair, SOS response, DNA-binding, DNA recombination, helicase; 1.90A {Escherichia coli} SCOP: a.5.1.1 a.60.2.1 b.40.4.2 PDB: 1hjp_A 1bdx_A* 1c7y_A 1d8l_A
Probab=43.65  E-value=14  Score=15.69  Aligned_cols=57  Identities=14%  Similarity=0.112  Sum_probs=40.6

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCC---------HHHHHHHHHHHHHHHHHHC
Q ss_conf             89886432026889998887641136789886402430---------2457777654578876433
Q gi|254780979|r  324 AKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRD---------KKIVANWVINDLLGVLNRS  380 (500)
Q Consensus       324 ~~~~rl~~~yGLs~~dA~~L~~~~~la~~FE~v~~~~~---------pk~~Anwi~~el~~~ln~~  380 (500)
                      +.+..|++--|+-+..|-.+++.-...++..++..+..         .|..|.-|+.||..-+.+-
T Consensus        70 ~lF~~Li~VsGIGPK~AL~ILs~~~~~~l~~aI~~~D~~~L~~vpGIGkKtA~rIilELkdK~~~~  135 (203)
T 1cuk_A           70 TLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVGALVKLPGIGKKTAERLIVEMKDRFKGL  135 (203)
T ss_dssp             HHHHHHHHSSSCCHHHHHHHHHHSCHHHHHHHHHTTCHHHHHTSTTCCHHHHHHHHHHHHHHGGGC
T ss_pred             HHHHHHHCCCCCCHHHHHHHHHCCCHHHHHHHHHHCCHHHHHCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             999998576885756688886127989999998718998860699877999999999999998763


No 17 
>2ztd_A Holliday junction ATP-dependent DNA helicase RUVA; recombination, branch migration, DNA binding, oligomerization, acidic PIN; 2.40A {Mycobacterium tuberculosis} PDB: 2ztc_A 2zte_A 2h5x_A 1bvs_A
Probab=43.18  E-value=15  Score=15.64  Aligned_cols=54  Identities=13%  Similarity=-0.018  Sum_probs=32.8

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCC---------HHHHHHHHHHHHHHHH
Q ss_conf             89886432026889998887641136789886402430---------2457777654578876
Q gi|254780979|r  324 AKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRD---------KKIVANWVINDLLGVL  377 (500)
Q Consensus       324 ~~~~rl~~~yGLs~~dA~~L~~~~~la~~FE~v~~~~~---------pk~~Anwi~~el~~~l  377 (500)
                      +.+..|++--|+-+..|-.+++.....++..++..+..         .+..|.-|+.||..-+
T Consensus        85 ~lF~~Li~VsGIGPK~AL~ILs~~~~~~l~~aI~~~D~~~L~~vpGIGkKtAeRIilELkdKl  147 (212)
T 2ztd_A           85 DLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKV  147 (212)
T ss_dssp             HHHHHHHTSTTCCHHHHHHHHHHSCHHHHHHHHHTTCHHHHHTSTTCCHHHHHHHHHHHTTTC
T ss_pred             HHHHHHHHCCCCCHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHCCCCCHHHHHHHHHHHHHHH
T ss_conf             999999834897746787888549999999999808999985177824888999999997543


No 18 
>1mlw_A Tryptophan 5-monooxygenase; aromatic amino acid hydroxylase catalytic domain fold, oxidoreductase; HET: HBI; 1.71A {Homo sapiens} SCOP: d.178.1.1 PDB: 3hf6_A* 3hf8_A* 3hfb_A* 3e2t_A*
Probab=39.64  E-value=7.1  Score=17.95  Aligned_cols=45  Identities=27%  Similarity=0.493  Sum_probs=34.7

Q ss_pred             CEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCC
Q ss_conf             336653035667777833277877312699999998853024836898864320268
Q gi|254780979|r  279 NETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGI  335 (500)
Q Consensus       279 ~~T~~mR~KE~a~DYRyfPEPDLPpi~is~e~i~~i~~~lPelP~~~~~rl~~~yGL  335 (500)
                      -.|..+|+.+.-.   |-||||+         +-++---+|.|-+.....|..++|+
T Consensus       150 p~TqyIR~~~~~~---YtpEPDi---------~HEl~GHvPlLadp~fA~f~q~~G~  194 (301)
T 1mlw_A          150 HCTQYVRHSSDPF---YTPEPDT---------CHELLGHVPLLAEPSFAQFSQEIGL  194 (301)
T ss_dssp             EECCCCCCTTCTT---CCSSCCH---------HHHHHHTHHHHTSHHHHHHHHHHHH
T ss_pred             CCCCEECCCCCCC---CCCCCCC---------CCCCCCCCHHCCCHHHHHHHHHHHH
T ss_conf             5522336899888---7899940---------0044233520079899999999989


No 19 
>1toh_A Tyroh, tyrosine hydroxylase; neurotransmitter biosynthesis, non-heme iron, pterin CO-substrate; 2.30A {Rattus norvegicus} SCOP: d.178.1.1 PDB: 2toh_A*
Probab=37.09  E-value=8.2  Score=17.47  Aligned_cols=45  Identities=22%  Similarity=0.363  Sum_probs=34.1

Q ss_pred             CEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCC
Q ss_conf             336653035667777833277877312699999998853024836898864320268
Q gi|254780979|r  279 NETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGI  335 (500)
Q Consensus       279 ~~T~~mR~KE~a~DYRyfPEPDLPpi~is~e~i~~i~~~lPelP~~~~~rl~~~yGL  335 (500)
                      -.|..||+.+.-   -|-||||+         +-++---+|.|-+.....|..++|+
T Consensus       155 p~TqyIRh~~~p---~YtpEPDi---------~HEl~GHvPlLadp~fA~f~q~iG~  199 (343)
T 1toh_A          155 QCTQYIRHASSP---MHSPEPDC---------CHELLGHVPMLADRTFAQFSQDIGL  199 (343)
T ss_dssp             EECCCCCCTTCT---TCCSSCCH---------HHHHHHTHHHHTSHHHHHHHHHHHH
T ss_pred             CEEEEECCCCCC---CCCCCCCH---------HHHHHCCCCCCCCHHHHHHHHHHHH
T ss_conf             325333268887---77899951---------5555454610189999999999999


No 20 
>1phz_A Protein (phenylalanine hydroxylase); aromatic amino acid hydroxylase, phosphorylation, intrasteric regulation, allosteric regulation; 2.20A {Rattus norvegicus} SCOP: d.58.18.3 d.178.1.1 PDB: 2phm_A
Probab=35.37  E-value=9.1  Score=17.15  Aligned_cols=44  Identities=25%  Similarity=0.459  Sum_probs=32.5

Q ss_pred             EEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCC
Q ss_conf             36653035667777833277877312699999998853024836898864320268
Q gi|254780979|r  280 ETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGI  335 (500)
Q Consensus       280 ~T~~mR~KE~a~DYRyfPEPDLPpi~is~e~i~~i~~~lPelP~~~~~rl~~~yGL  335 (500)
                      .|..+|+.+.-   -|-||||+         +-++---+|.|-+.....|..++|+
T Consensus       265 ~tqyIR~~~~~---~YtpEPDi---------~Hel~GHvPlLa~p~fA~f~q~~G~  308 (429)
T 1phz_A          265 CTQYIRHGSKP---MYTPEPDI---------CHELLGHVPLFSDRSFAQFSQEIGL  308 (429)
T ss_dssp             ECCCCCCTTCT---TCCSSCCH---------HHHHHHTHHHHTSHHHHHHHHHHHH
T ss_pred             EEEEECCCCCC---CCCCCCCC---------HHHHHCCCCCCCCHHHHHHHHHHHH
T ss_conf             35333266545---55789961---------4455456722179999999999999


No 21 
>1j8u_A Phenylalanine-4-hydroxylase; ferrous iron, 2-His-1-carboxylate facial triad, tetrahydrobiopterin, oxidoreductase; HET: H4B; 1.50A {Homo sapiens} SCOP: d.178.1.1 PDB: 1j8t_A* 1kw0_A* 1lrm_A* 1mmk_A* 1mmt_A* 2pah_A 1pah_A 3pah_A* 4pah_A* 5pah_A* 6pah_A* 1tdw_A 1tg2_A* 1dmw_A*
Probab=34.81  E-value=9.4  Score=17.04  Aligned_cols=45  Identities=24%  Similarity=0.458  Sum_probs=33.8

Q ss_pred             CEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCC
Q ss_conf             336653035667777833277877312699999998853024836898864320268
Q gi|254780979|r  279 NETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGI  335 (500)
Q Consensus       279 ~~T~~mR~KE~a~DYRyfPEPDLPpi~is~e~i~~i~~~lPelP~~~~~rl~~~yGL  335 (500)
                      -.|..+|..+.-   -|-||||+         +-++---+|.|-+.....|..++|+
T Consensus       162 ~~TqyIRh~~~p---~YtpEPDi---------~HEl~GHvPlLadp~fA~f~q~iG~  206 (325)
T 1j8u_A          162 HCTQYIRHGSKP---MYTPEPDI---------CHELLGHVPLFSDRSFAQFSQEIGL  206 (325)
T ss_dssp             EECCCCCCTTCT---TCCSSCCH---------HHHHHHTHHHHTSHHHHHHHHHHHH
T ss_pred             CCCCEECCCCCC---CCCCCCCH---------HHHHHCCCCCCCCHHHHHHHHHHHH
T ss_conf             452332688878---87899951---------5555455622179999999999989


No 22 
>2x26_A Periplasmic aliphatic sulphonates-binding protein; transport protein; 1.75A {Escherichia coli}
Probab=34.52  E-value=5.5  Score=18.72  Aligned_cols=10  Identities=0%  Similarity=0.006  Sum_probs=6.2

Q ss_pred             CCCCHHHHHH
Q ss_conf             1269999999
Q gi|254780979|r  304 LEIDEDFIRA  313 (500)
Q Consensus       304 i~is~e~i~~  313 (500)
                      +..+++|+++
T Consensus       188 ~~~~~~~~~~  197 (308)
T 2x26_A          188 YLAARPYAEK  197 (308)
T ss_dssp             EEEEHHHHHH
T ss_pred             EEECHHHHHH
T ss_conf             9961688887


No 23 
>3fdx_A Putative filament protein / universal stress protein F; structural genomics, APC60640.1, PSI-2, protein structure initiative; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A*
Probab=33.75  E-value=20  Score=14.62  Aligned_cols=40  Identities=13%  Similarity=0.066  Sum_probs=30.9

Q ss_pred             CCCCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCEECCCCEEE
Q ss_conf             65206130268988873789999999998778297624420131
Q gi|254780979|r   53 NTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFA   96 (500)
Q Consensus        53 Nt~v~~~~~g~PG~lP~lN~~av~~ai~~~~al~~~i~~~~~fd   96 (500)
                      ||=.+|+|+..+    -+++.|+++|+.++...++++.-...++
T Consensus         2 ~~ILv~vD~s~~----~~s~~al~~A~~la~~~~a~l~ll~v~~   41 (143)
T 3fdx_A            2 NAILVPIDISDK----EFTERIISHVESEARIDDAEVHFLTVIP   41 (143)
T ss_dssp             CEEEEECCTTCS----SCCTTHHHHHHHHHHHHTCEEEEEEEEC
T ss_pred             CEEEEEECCCCH----HHHHHHHHHHHHHHHHCCCEEEEEEEEC
T ss_conf             989999889987----8999999999999987599899999526


No 24 
>3cji_C Polyprotein; virus capsid protein structure, ATP-binding, cytoplasm, cytoplasmic vesicle, helicase, hydrolase, membrane, nucleotide-binding; 2.30A {Seneca valley virus}
Probab=33.66  E-value=14  Score=15.85  Aligned_cols=24  Identities=21%  Similarity=0.397  Sum_probs=19.0

Q ss_pred             CCEEEEEEEEEEECCCCCCCCCCCC
Q ss_conf             0338989997888689865558842
Q gi|254780979|r   22 WEVVIGIEVHAQLSVVSKLFSGASV   46 (500)
Q Consensus        22 ~e~vIGLEiH~qL~t~tKlFc~c~~   46 (500)
                      |=.-.|.+||||.|+ ||--++|--
T Consensus       109 ~l~R~G~~VhVQcNa-SkFHqG~Ll  132 (284)
T 3cji_C          109 FLMKCGWQVQVQCNL-TQFHQGALL  132 (284)
T ss_dssp             EEEEEEEEEEEECCC-CTTCEEEEE
T ss_pred             HHHCCCEEEEEEECC-CCCCCEEEE
T ss_conf             744188399999779-801310698


No 25 
>1bev_2 Bovine enterovirus coat proteins VP1 to VP4; bovine enterovirus VG-5-27, picornavirus, icosahedral virus; HET: MYR; 3.00A {Bovine enterovirus}
Probab=33.40  E-value=13  Score=16.06  Aligned_cols=22  Identities=27%  Similarity=0.344  Sum_probs=18.2

Q ss_pred             EEEEEEEEEEECCCCCCCCCCCC
Q ss_conf             38989997888689865558842
Q gi|254780979|r   24 VVIGIEVHAQLSVVSKLFSGASV   46 (500)
Q Consensus        24 ~vIGLEiH~qL~t~tKlFc~c~~   46 (500)
                      .-.|++||||.|+ +|-.++|--
T Consensus       102 ~R~G~~v~VQ~Na-SkFH~G~Ll  123 (248)
T 1bev_2          102 YRGGWAVHVQCNA-TKFHQGTLL  123 (248)
T ss_dssp             EEEEEEEEEECCC-CTTEEEEEE
T ss_pred             EECCEEEEEEEEC-CCCCCCEEE
T ss_conf             5456799999979-956511799


No 26 
>1d4m_2 Protein (coxsackievirus A9); picornavirus structure, RGD, uncoating, virus-receptor interaction, WIN compound, virus/viral protein; HET: MYR W71; 2.90A {Human coxsackievirus A9} PDB: 1mqt_B* 1oop_B* 1h8t_B* 1upn_B 1m11_2 1cov_2* 1jew_2 1ev1_2* 2c8i_B
Probab=32.91  E-value=14  Score=15.70  Aligned_cols=24  Identities=25%  Similarity=0.372  Sum_probs=18.7

Q ss_pred             CCEEEEEEEEEEECCCCCCCCCCCC
Q ss_conf             0338989997888689865558842
Q gi|254780979|r   22 WEVVIGIEVHAQLSVVSKLFSGASV   46 (500)
Q Consensus        22 ~e~vIGLEiH~qL~t~tKlFc~c~~   46 (500)
                      |-.-.|.+||||.|+ ||--++|--
T Consensus       100 ~l~R~G~~VhVQcNa-SkFH~G~Ll  123 (261)
T 1d4m_2          100 YLGRAGYTIHVQCNA-SKFHQGCLL  123 (261)
T ss_dssp             EEEEEEEEEEEECCC-CTTCEEEEE
T ss_pred             CEECCCEEEEEEECC-CCCCCCEEE
T ss_conf             142487189999579-904610699


No 27 
>1ncq_B Coat protein VP2; HRV, pleconaril, icosahedral virus; HET: W11; 2.50A {Human rhinovirus 14} SCOP: b.121.4.1 PDB: 1d3i_2* 1hrv_2* 1na1_B* 1hri_2* 1r08_2* 1r09_2* 1rmu_2 1ruc_2* 1rud_2* 1rue_2* 1ruf_2 1rug_2* 1ruh_2* 1rui_2* 1ruj_2 1rvf_2 1vrh_2* 2r04_2* 2r06_2* 2r07_2* ...
Probab=31.96  E-value=15  Score=15.52  Aligned_cols=24  Identities=29%  Similarity=0.278  Sum_probs=18.9

Q ss_pred             CCEEEEEEEEEEECCCCCCCCCCCC
Q ss_conf             0338989997888689865558842
Q gi|254780979|r   22 WEVVIGIEVHAQLSVVSKLFSGASV   46 (500)
Q Consensus        22 ~e~vIGLEiH~qL~t~tKlFc~c~~   46 (500)
                      |=.-.|.+||||.|+ ||--++|--
T Consensus       100 ~l~R~G~~V~VQcNa-SkFH~G~Ll  123 (262)
T 1ncq_B          100 SLGRSGYTVHVQCNA-TKFHSGCLL  123 (262)
T ss_dssp             EEEEEEEEEEEECCC-CTTCEEEEE
T ss_pred             HHHCCCEEEEEEECC-CHHHHHEEE
T ss_conf             401187499999779-955401786


No 28 
>2jml_A DNA binding domain/transcriptional regulator; anti-repressor, MERR, carotenogenesis; HET: DNA; NMR {Myxococcus xanthus dk 1622}
Probab=30.72  E-value=22  Score=14.27  Aligned_cols=54  Identities=28%  Similarity=0.492  Sum_probs=29.0

Q ss_pred             CCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             233755433665303566777783327787731269999999885302483689886432026889998887641
Q gi|254780979|r  272 RLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSD  346 (500)
Q Consensus       272 R~~d~~~~~T~~mR~KE~a~DYRyfPEPDLPpi~is~e~i~~i~~~lPelP~~~~~rl~~~yGLs~~dA~~L~~~  346 (500)
                      |.|+..-+...+-|.  ++.-||||.+-||          +.++         ..++|..+.|+|..++..++.+
T Consensus        23 R~ye~~~gl~~p~r~--~~~g~R~Y~~~~i----------~~l~---------~I~~l~~~~G~si~~i~~~l~~   76 (81)
T 2jml_A           23 RAWERRYGFPRPLRS--EGNNYRVYSREEV----------EAVR---------RVARLIQEEGLSVSEAIAQVKT   76 (81)
T ss_dssp             HHHHHHTCCSCCBSS--SCSSSCEECHHHH----------HHHH---------HHHHHHHHTSTHHHHHHHHHHH
T ss_pred             HHHHHHCCCCCCEEE--CCCCCEECCHHHH----------HHHH---------HHHHHHHHCCCCHHHHHHHHHC
T ss_conf             999982699986256--8997366789999----------9999---------9999999869989999999863


No 29 
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A*
Probab=30.34  E-value=23  Score=14.23  Aligned_cols=141  Identities=11%  Similarity=0.130  Sum_probs=77.0

Q ss_pred             CCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEEEEEEEEEEEECCCCCCC---------------------------
Q ss_conf             78882014454420153389997067777741037984236665202310011---------------------------
Q gi|254780979|r  105 LPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIH---------------------------  157 (500)
Q Consensus       105 lpkgyQiTQ~~~Pi~~~G~l~~~~~~~~~~~~~~~~v~I~~i~lEED~gk~~h---------------------------  157 (500)
                      |...|.++....+||.||+-.+..+-... ..+...|-|+.+..+..+.+...                           
T Consensus        42 l~~~~~i~~i~~~IG~G~~g~Vy~a~~~~-~~~~~~vAiKv~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E  120 (258)
T 1zth_A           42 LSAKGYITAMGGVISTGKEANVFYADGVF-DGKPVAMAVKIYRIETSEFDKMDEYLYGDERFDMRRISPKEKVFIWTEKE  120 (258)
T ss_dssp             HHHTTSEEEEEEEEEECSSEEEEEEEEEE-TTEEEEEEEEEECCC-------GGGTTTCTTSCC----CHHHHHHHHHHH
T ss_pred             HHHCCCEEEECCEEEECCCEEEEEEEECC-CCCEEEEEEEEEEHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98679760108787475866999999658-99566899999742313166899998663998887661789999999999


Q ss_pred             --------C-CCCCCEEEEECCCCCCEEEEEECCCCC-----------CHHHHHHHHHHHHHHHHHH----CCCCCCCCC
Q ss_conf             --------5-678714886615786125763036527-----------7899999999999998642----045676432
Q gi|254780979|r  158 --------D-QYSAVSCIDLNRSGVALMEIVTKPDMR-----------SSLEAKAFLTKLRSILRYL----GTCDGNMEE  213 (500)
Q Consensus       158 --------~-~~~~~slvD~NRaGvPLiEIVT~Pd~~-----------s~~ea~~~~~~l~~ilr~~----gisd~~mee  213 (500)
                              + .......+++++ ..-.+|-+..+++.           +++++..++..+-..+.|+    |+..+.+--
T Consensus       121 ~~~L~~l~~~~~~~~~~~~~~~-~~iVMEy~~g~~L~~~~~~~~~~~l~~~~~~~i~~ql~~~l~~l~h~~gIiHrDLKP  199 (258)
T 1zth_A          121 FRNLERAKEAGVSVPQPYTYMK-NVLLMEFIGEDELPAPTLVELGRELKELDVEGIFNDVVENVKRLYQEAELVHADLSE  199 (258)
T ss_dssp             HHHHHHHHHTTCCCCCEEEEET-TEEEEECCEETTEECCBHHHHGGGGGGSCHHHHHHHHHHHHHHHHHTSCEECSSCST
T ss_pred             HHHHHHHHHCCCCCCEEEECCC-CEEEEEECCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCEEECCCCH
T ss_conf             9999999867988880021135-359999768976788988751168999999999999999999999839999677999


Q ss_pred             CEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             20112575432137666788622235402465999999
Q gi|254780979|r  214 GSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE  251 (500)
Q Consensus       214 GslR~DvNVSi~~~~~~~GtRvEIKNlnS~~~i~~AI~  251 (500)
                      .++=.|-++=|    --||.-+++.|=|...++.+-+.
T Consensus       200 ~NIL~~~~vkL----IDFG~a~~~~~p~~~~~l~~d~~  233 (258)
T 1zth_A          200 YNIMYIDKVYF----IDMGQAVTLRHPMAESYLERDVR  233 (258)
T ss_dssp             TSEEESSSEEE----CCCTTCEETTSTTHHHHHHHHHH
T ss_pred             HHEEECCCEEE----EECCCCEECCCCCHHHHHHHHHH
T ss_conf             99227598899----97678553799987999998898


No 30 
>1jke_A O145, D-Tyr-trnaTyr deacylase, ORF_O145; beta-alpha-barrel, hydrolase; 1.55A {Escherichia coli} SCOP: c.110.1.1
Probab=29.85  E-value=23  Score=14.17  Aligned_cols=46  Identities=24%  Similarity=0.334  Sum_probs=36.9

Q ss_pred             ECCCCCC---HHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             0365277---899999999999998642045676432201125754321376
Q gi|254780979|r  180 TKPDMRS---SLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPG  228 (500)
Q Consensus       180 T~Pd~~s---~~ea~~~~~~l~~ilr~~gisd~~meeGslR~DvNVSi~~~~  228 (500)
                      ..|+++.   |++|+.+-.++-..+|..+.   .-+.|.+-.|-+||+-.+|
T Consensus        89 ~rPsF~~Aa~p~~A~~ly~~f~~~l~~~~~---~v~~G~FGa~M~V~l~NDG  137 (145)
T 1jke_A           89 MRPSFSKGASPDRAEALYDYFVERCRQQEM---NTQTGRFAADMQVSLVNDG  137 (145)
T ss_dssp             SSCBCSSBCCHHHHHHHHHHHHHHHHHTTC---CEEECCTTSCEEEEEEEEE
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHCCC---CCEEEECCCCCEEEEEECC
T ss_conf             998834359978999999999999986699---7557788988489999879


No 31 
>1tme_2 Theiler'S murine encephalomyelitis virus (subunit VP2); icosahedral virus; 2.80A {Theiler} PDB: 1tmf_2 2mev_2 1mec_2
Probab=29.39  E-value=18  Score=15.00  Aligned_cols=24  Identities=21%  Similarity=0.351  Sum_probs=19.0

Q ss_pred             CCEEEEEEEEEEECCCCCCCCCCCC
Q ss_conf             0338989997888689865558842
Q gi|254780979|r   22 WEVVIGIEVHAQLSVVSKLFSGASV   46 (500)
Q Consensus        22 ~e~vIGLEiH~qL~t~tKlFc~c~~   46 (500)
                      |-.-.|.+||||.|+ ||--++|--
T Consensus       104 ~l~R~G~~VhVQcNa-SkFHqG~Ll  127 (267)
T 1tme_2          104 YLCKTGWRVQVQCNA-SQFHAGSLL  127 (267)
T ss_dssp             EEEEEEEEEEEECCC-CTTCEEEEE
T ss_pred             HHHCCCEEEEEEECC-CHHCCEEEE
T ss_conf             755187299999779-812000788


No 32 
>1naf_A ADP-ribosylation factor binding protein GGA1, golgi-localized, gamma EAR-; clathrin-adaptor, GAT domain, helical paper-CLIP, three-helix bundle; 2.80A {Homo sapiens} SCOP: a.7.8.1
Probab=28.67  E-value=17  Score=15.05  Aligned_cols=35  Identities=17%  Similarity=0.295  Sum_probs=21.1

Q ss_pred             HHHHHHHHHHHHHHHHCCCCHH--HHHHHHHHHHHHH
Q ss_conf             8764113678988640243024--5777765457887
Q gi|254780979|r  342 VLVSDKSIADYFEKLAVNRDKK--IVANWVINDLLGV  376 (500)
Q Consensus       342 ~L~~~~~la~~FE~v~~~~~pk--~~Anwi~~el~~~  376 (500)
                      .+..+.+-+..+..+.....|.  ..|||++-...+.
T Consensus        11 ~~f~~e~~s~~L~~Lirs~~PeDLq~AN~LiK~m~~~   47 (158)
T 1naf_A           11 VIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQE   47 (158)
T ss_dssp             ----CCHHHHHHHHHHSSCSTTHHHHHHHHHHHHHHH
T ss_pred             HHHCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH
T ss_conf             5651299999999998719976699999999999887


No 33 
>1aym_2 HRV16, human rhinovirus 16 coat protein; RNA, site-directed mutagenesis, icosahedral virus; HET: MYR DAO; 2.15A {Human rhinovirus SP} PDB: 1ayn_2* 1ncr_B* 1nd2_B* 1nd3_B* 1qju_2* 1qjx_2* 1qjy_2* 1c8m_2* 1d3e_2 1r1a_2* 2hwd_2* 2hwe_2* 2hwf_2* 1fpn_2* 1v9u_2* 3dpr_B*
Probab=28.14  E-value=21  Score=14.40  Aligned_cols=24  Identities=29%  Similarity=0.357  Sum_probs=19.0

Q ss_pred             CCEEEEEEEEEEECCCCCCCCCCCC
Q ss_conf             0338989997888689865558842
Q gi|254780979|r   22 WEVVIGIEVHAQLSVVSKLFSGASV   46 (500)
Q Consensus        22 ~e~vIGLEiH~qL~t~tKlFc~c~~   46 (500)
                      |-.-.|-+||||.|+ ||--++|--
T Consensus       100 ~l~R~G~~V~VQcNa-SkFH~G~Ll  123 (261)
T 1aym_2          100 FLGRSGYTVHVQCNA-SKFHQGTLL  123 (261)
T ss_dssp             EEEEEEEEEEEECCC-CTTCEEEEE
T ss_pred             HHHHCCEEEEEEECC-CHHHCEEEE
T ss_conf             776287299999679-832110788


No 34 
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8
Probab=26.26  E-value=26  Score=13.73  Aligned_cols=58  Identities=22%  Similarity=0.337  Sum_probs=28.2

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHC---CCCCHHH
Q ss_conf             36789886402430245777765457887643387400064898999999988863---8731478
Q gi|254780979|r  348 SIADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIID---GTISGKI  410 (500)
Q Consensus       348 ~la~~FE~v~~~~~pk~~Anwi~~el~~~ln~~~~~~~~~~i~p~~laeLi~li~~---g~Is~~~  410 (500)
                      .+..+|..++ +.+.+.-+    .||-..|++.+......+++++...+|+.+.+.   |.|+..-
T Consensus         3 ~~~~~F~~~a-~~dG~I~~----~EL~~~L~~~~~~~~~~~~s~~~~~~li~~~D~d~~G~i~f~E   63 (167)
T 1gjy_A            3 PLYGYFASVA-GQDGQIDA----DELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNE   63 (167)
T ss_dssp             TTHHHHHHHC-CTTSCBCH----HHHHHHHHHHTCSTTSCCCCHHHHHHHHHHHCTTCCSCBCHHH
T ss_pred             HHHHHHHHHC-CCCCCCCH----HHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCHHH
T ss_conf             7899999975-98997869----9999999971887676768999999999985899899697999


No 35 
>3doa_A Fibrinogen binding protein; structural genomics, MCSG., PSI-2, protein structure initiative, midwest center for structural genomics; 2.81A {Staphylococcus aureus subsp}
Probab=26.18  E-value=26  Score=13.72  Aligned_cols=151  Identities=15%  Similarity=0.180  Sum_probs=75.7

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCCCCCCCCC-CCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             125763036527789999999999999864204567643220112575432137-6667886222354024659999999
Q gi|254780979|r  174 ALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEY  252 (500)
Q Consensus       174 PLiEIVT~Pd~~s~~ea~~~~~~l~~ilr~~gisd~~meeGslR~DvNVSi~~~-~~~~GtRvEIKNlnS~~~i~~AI~y  252 (500)
                      |-+-+... .-.+|...-.|+..||.-|+.--+.+..+    +..|==|.+.-. ++.+|-.+      ..+     +-.
T Consensus        56 ~ri~lt~~-~~~~p~~p~~F~~~LRK~l~g~rl~~i~q----~~~DRIv~~~f~~~~~~g~~~------~~~-----Li~  119 (288)
T 3doa_A           56 SRLQLTTK-KYDNPFNPPMFARVFRKHLEGGIIESIKQ----IGNDRRIEIDIKSKDEIGDTI------YRT-----VIL  119 (288)
T ss_dssp             CEEEEECC--------CCHHHHHHHHHHTTCEEEEEEE----STTSSEEEEEEEEECTTSCEE------EEE-----EEE
T ss_pred             CEEEECCC-CCCCCCCCCHHHHHHHHHHCCCCCCEEEE----CCCCEEEEEEEECCCCCCCCE------EEE-----EEE
T ss_conf             48997368-88888887679999999866586300397----799689999985167778741------489-----999


Q ss_pred             HHH-HHHH--HHHCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCC-CCCCCCCHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             999-9999--73139800344323375543366530356677778332778-7731269999999885302483689886
Q gi|254780979|r  253 EAR-RQIA--ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD-LLPLEIDEDFIRAIKKQIPELPDAKRER  328 (500)
Q Consensus       253 Ei~-RQ~~--ll~~G~~v~qETR~~d~~~~~T~~mR~KE~a~DYRyfPEPD-LPpi~is~e~i~~i~~~lPelP~~~~~r  328 (500)
                      |+. |+.+  ++...+.|..--|+..+...   ..|.=--...|.+-|-+. +-|..++.+-+.+   .+...+....+.
T Consensus       120 Elmgr~sNiIL~D~~~kIi~~lr~~~~~~~---~~R~i~pG~~Y~~Pp~~~~~~p~~~~~e~~~~---~l~~~~~~l~k~  193 (288)
T 3doa_A          120 EIMGKHSNLILVDENRKIIEGFKHLTPNTN---HYRTVMPGFNYEAPPTQHKINPYDITGAEVLK---YIDFNAGNIAKQ  193 (288)
T ss_dssp             ECCGGGCEEEEEETTCBEEEESSCBCC--------CCBSTTSBCCCCCCCCCBCGGGCCHHHHGG---GCCGGGCCHHHH
T ss_pred             EEECCCCEEEEECCCCCEEEEEEECCCCCC---CCEEEECCCEECCCHHHCCCCCCCCCHHHHHH---HHHHCCCCHHHH
T ss_conf             870787349999589809988874350107---73386068420178223359965489999999---875086419999


Q ss_pred             HHHHC-CCCHHHHHHHHHH
Q ss_conf             43202-6889998887641
Q gi|254780979|r  329 FIGEF-GISLYDASVLVSD  346 (500)
Q Consensus       329 l~~~y-GLs~~dA~~L~~~  346 (500)
                      |++.+ |+++..|+.++..
T Consensus       194 L~~~~~g~~~~l~~ei~~r  212 (288)
T 3doa_A          194 LLNQFEGFSPLITNEIVSR  212 (288)
T ss_dssp             HHHHBTTCCHHHHHHHHTT
T ss_pred             HHHHCCCCCHHHHHHHHHH
T ss_conf             9986389998999999997


No 36 
>3myd_A Flagellar biosynthesis protein FLHA; flagellar export, type III secretion, cytoplasmic FRAG protein transport; 2.40A {Helicobacter pylori}
Probab=24.34  E-value=28  Score=13.49  Aligned_cols=43  Identities=12%  Similarity=0.161  Sum_probs=30.4

Q ss_pred             CCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHC----CCCHHHHHH
Q ss_conf             4898999999988863873147899999999817----999889999
Q gi|254780979|r  388 PISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVE  430 (500)
Q Consensus       388 ~i~p~~laeLi~li~~g~Is~~~aK~il~~l~~~----~~~p~~iie  430 (500)
                      .++...+.+++..+-+..|+-+..+.||+.+.+.    .++|..++|
T Consensus       197 ~v~l~~i~~VLq~LL~E~VsIRdl~~IlEaLad~a~~~~~d~~~LtE  243 (365)
T 3myd_A          197 KIPTGAIRSVLQALLHEKIPIKDMLTILETITDIAPLVQNDVNILTE  243 (365)
T ss_dssp             GSCHHHHHHHHHHHHHTTCCCCCHHHHHHHHHHHGGGGTTCHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHH
T ss_conf             08899999999999976870737899999999873014699999999


No 37 
>2dbo_A D-tyrosyl-tRNA(Tyr) deacylase; D-amino acid, D-tyrosine, structural genomics, NPPSFA; 2.76A {Aquifex aeolicus VF5}
Probab=24.19  E-value=29  Score=13.47  Aligned_cols=46  Identities=22%  Similarity=0.318  Sum_probs=35.5

Q ss_pred             ECCCCCC---HHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             0365277---899999999999998642045676432201125754321376
Q gi|254780979|r  180 TKPDMRS---SLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPG  228 (500)
Q Consensus       180 T~Pd~~s---~~ea~~~~~~l~~ilr~~gisd~~meeGslR~DvNVSi~~~~  228 (500)
                      ..|+++.   |++|..+-.++-..+|..+.   ..+.|.+-.|-+||+-..|
T Consensus        89 ~rPsF~~Aa~p~~A~~ly~~f~~~l~~~~~---~v~~G~FGa~M~V~l~NdG  137 (148)
T 2dbo_A           89 RRPSFEEAEEPKRAKELYEKFVDKIKESGL---KVETGIFGAMMDVFIENWG  137 (148)
T ss_dssp             SSCBCTTBCCHHHHHHHHHHHHHHHHTTCS---CEEECCSSSCCEEEEEEEE
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHCCC---CCCCCCCCCCCEEEEEECC
T ss_conf             998733249979999999999999985599---8640667888689999879


No 38 
>1emx_A HPTX2, heteropodatoxin 2; NMR {Heteropoda venatoria} SCOP: g.3.6.2
Probab=24.13  E-value=21  Score=14.49  Aligned_cols=12  Identities=50%  Similarity=0.722  Sum_probs=9.5

Q ss_pred             CCCCCCCCCCCC
Q ss_conf             865558842468
Q gi|254780979|r   38 SKLFSGASVNFG   49 (500)
Q Consensus        38 tKlFc~c~~~~~   49 (500)
                      -||||+|.++-+
T Consensus         4 g~lfsgc~t~ad   15 (30)
T 1emx_A            4 GKLFSGCDTNAD   15 (30)
T ss_dssp             CCTTCTTCSTTC
T ss_pred             CCCCCCCCCCHH
T ss_conf             022237778632


No 39 
>1dw9_A Cyanate lyase; cyanate degradation, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: SO4; 1.65A {Escherichia coli} SCOP: a.35.1.4 d.72.1.1 PDB: 1dwk_A* 2ivq_A 2ivb_A 2iu7_A 2iv1_A 2iuo_A 2ivg_A
Probab=23.17  E-value=30  Score=13.33  Aligned_cols=38  Identities=16%  Similarity=0.166  Sum_probs=13.6

Q ss_pred             CCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             69999999885302483689886432026889998887
Q gi|254780979|r  306 IDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVL  343 (500)
Q Consensus       306 is~e~i~~i~~~lPelP~~~~~rl~~~yGLs~~dA~~L  343 (500)
                      .|+.|+..+-.-.--+|.+..+.+..-+||+++.+..|
T Consensus        38 ~S~v~vaaa~lGQ~~l~~e~A~~l~~~LgL~~e~~~~l   75 (156)
T 1dw9_A           38 LAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLL   75 (156)
T ss_dssp             SCHHHHHHHHTTSSCCCHHHHHHHHHHTTCCHHHHHHT
T ss_pred             CCHHHHHHHHHCCCCCCHHHHHHHHHHCCCCHHHHHHH
T ss_conf             79999999984577799899999998549999999997


No 40 
>1xrs_A D-lysine 5,6-aminomutase alpha subunit; TIM barrel, rossmann domain, PLP, cobalamin, 5'- deoxyadenosine, radical, adenosylcobalamin; HET: B12 PLP 5AD; 2.80A {Clostridium sticklandii} SCOP: c.1.19.4
Probab=23.04  E-value=30  Score=13.31  Aligned_cols=68  Identities=26%  Similarity=0.269  Sum_probs=32.5

Q ss_pred             CCHHHHHHHHHHHHHCCCCHHHHHHHCCCEECCCHHHHHHHHHHHHHHCHHHHHHHH--CCCCCH--HHHHHHHHHHHCC
Q ss_conf             314789999999981799988999963987618988999999999983999899752--721322--6589999997289
Q gi|254780979|r  406 ISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA--TKPNLV--SWFVGQVMKNTGG  481 (500)
Q Consensus       406 Is~~~aK~il~~l~~~~~~p~~iie~~gL~~isD~~eL~~iv~eVI~~np~~V~~~k--gk~ka~--gfLvGqVMK~tkG  481 (500)
                      ++-..||.+|..|-.       +-++.   .+...+.|..-+.+|+.+--...+++.  |=-+++  |||=|..=+..+|
T Consensus       423 ~aie~Aky~~~~~~~-------l~~~i---~~k~~G~i~~rarevl~~A~~lLeeI~~~Glf~Aie~G~F~~i~R~~dGG  492 (516)
T 1xrs_A          423 LSIENAQYIFNNMES-------ISEEI---QFKEDGLIQKRAGFVLEKANELLEEIEQLGLFDTLEKGIFGGVKRPKDGG  492 (516)
T ss_dssp             HHHHHHHHHHHHTTT-------HHHHC---CCCTTSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTTTCCCCTTCS
T ss_pred             HHHHHHHHHHHHHHH-------HHHEE---EECCCCCHHHHHHHHHHHHHHHHHHHHHCCHHHHHHCCCCCCCCCCCCCC
T ss_conf             998789999997663-------32105---35888708999999999999999999864689998535235614678788


Q ss_pred             CC
Q ss_conf             77
Q gi|254780979|r  482 KA  483 (500)
Q Consensus       482 kA  483 (500)
                      ++
T Consensus       493 kG  494 (516)
T 1xrs_A          493 KG  494 (516)
T ss_dssp             BT
T ss_pred             CC
T ss_conf             37


No 41 
>1hxs_2 Genome polyprotein, coat protein VP2; picornavirus, AB initio phase determinaion, icosahedral virus; HET: MYR PLM; 2.20A {Human poliovirus 1 mahoney} PDB: 1ar6_2* 1ar8_2* 1asj_2* 1al2_2* 1nn8_2 1po1_2* 1po2_2* 1vbd_2* 2plv_2* 1ar7_2* 1ar9_2* 3epc_2* 1dgi_2* 3iyb_4 3iyc_4 1eah_2* 1xyr_2 3epf_2* 1pvc_2* 1piv_2* ...
Probab=22.21  E-value=27  Score=13.69  Aligned_cols=24  Identities=33%  Similarity=0.231  Sum_probs=19.2

Q ss_pred             CEEEEEEEEEEECCCCCCCCCCCCC
Q ss_conf             3389899978886898655588424
Q gi|254780979|r   23 EVVIGIEVHAQLSVVSKLFSGASVN   47 (500)
Q Consensus        23 e~vIGLEiH~qL~t~tKlFc~c~~~   47 (500)
                      =.-.|.+||||.|+ ||--++|..-
T Consensus       101 L~R~G~~VhVQcNa-SkFHqG~LlV  124 (272)
T 1hxs_2          101 LGRSGYTVHVQCNA-SKFHQGALGV  124 (272)
T ss_dssp             EEEEEEEEEEECCC-CTTEEEEEEE
T ss_pred             HHCCCCEEEEEECC-CCCCCCEEEE
T ss_conf             65599589998359-8023826799


No 42 
>1vcc_A DNA topoisomerase I; DNA binding; HET: DNA; 1.60A {Vaccinia virus WR} SCOP: d.121.1.1
Probab=21.95  E-value=20  Score=14.58  Aligned_cols=11  Identities=36%  Similarity=0.896  Sum_probs=6.9

Q ss_pred             EECCCEECCCC
Q ss_conf             31132123767
Q gi|254780979|r   95 FARKNYFYPDL  105 (500)
Q Consensus        95 fdRK~YfYpDl  105 (500)
                      =-||+|||+-+
T Consensus        65 KgrkQYfYGk~   75 (77)
T 1vcc_A           65 KGRRQYFYGKM   75 (77)
T ss_dssp             TSCEEEEECTT
T ss_pred             CCCEEEEEECC
T ss_conf             88357877213


No 43 
>1of8_A Phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited; beta-alpha-barrel, lyase, synthase, synthetase; HET: PEP G3P; 1.5A {Saccharomyces cerevisiae} SCOP: c.1.10.4 PDB: 1oab_A* 1of6_A* 1hfb_A* 1ofa_A* 1ofb_A 1ofo_A 1ofp_A 1ofq_A 1ofr_A* 1og0_A*
Probab=20.81  E-value=33  Score=13.00  Aligned_cols=26  Identities=12%  Similarity=0.282  Sum_probs=20.7

Q ss_pred             EEECCC-CCCHHHHHHHHHHHHHHHHH
Q ss_conf             630365-27789999999999999864
Q gi|254780979|r  178 IVTKPD-MRSSLEAKAFLTKLRSILRY  203 (500)
Q Consensus       178 IVT~Pd-~~s~~ea~~~~~~l~~ilr~  203 (500)
                      +|..|| +|+++.|.+|+..|..+-.-
T Consensus        71 vIvGPCSIHD~~aa~eYA~rL~~l~~~   97 (370)
T 1of8_A           71 VIVGPCSIHDLEAAQEYALRLKKLSDE   97 (370)
T ss_dssp             EEEECSCCCCHHHHHHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             996278789989999999999999998


No 44 
>2pw6_A Uncharacterized protein YGID; JW3007, escherichia coli structural genomics, protein structure, riken and PSI, protein structure initiative; 2.27A {Escherichia coli K12} SCOP: c.56.6.1
Probab=20.56  E-value=13  Score=15.91  Aligned_cols=32  Identities=16%  Similarity=0.312  Sum_probs=20.2

Q ss_pred             CCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             003443233755433665303566777783327787731269
Q gi|254780979|r  266 HIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEID  307 (500)
Q Consensus       266 ~v~qETR~~d~~~~~T~~mR~KE~a~DYRyfPEPDLPpi~is  307 (500)
                      .+...+|+||-  |+.++++        .+||+.|+|.|.+|
T Consensus       111 ~~~~~~~glDH--G~wvPL~--------~m~p~~diPvVqlS  142 (271)
T 2pw6_A          111 TLDKEAWGFDH--GSWGVLI--------KMYPDADIPMVQLS  142 (271)
T ss_dssp             EEESSCCCCCH--HHHHHHH--------HHSTTCCSCEEEEE
T ss_pred             CCCCCCCCCCC--CCEEEEE--------EECCCCCCCEEEEE
T ss_conf             54687666445--6503677--------85588886569984


No 45 
>1pov_0 Poliovirus native empty capsid (type 1); picornavirus, icosahedral virus; HET: MYR SPH; 2.80A {Human poliovirus 1 mahoney} SCOP: b.121.4.1
Probab=20.30  E-value=31  Score=13.22  Aligned_cols=22  Identities=36%  Similarity=0.327  Sum_probs=16.5

Q ss_pred             EEEEEEEEEEECCCCCCCCCCCC
Q ss_conf             38989997888689865558842
Q gi|254780979|r   24 VVIGIEVHAQLSVVSKLFSGASV   46 (500)
Q Consensus        24 ~vIGLEiH~qL~t~tKlFc~c~~   46 (500)
                      .-.|.+||||.|+ ||--++|.-
T Consensus       170 ~R~G~~VhVQcNa-SkFHqG~Ll  191 (340)
T 1pov_0          170 GRSGYTVHVQCNA-SKFHQGALG  191 (340)
T ss_dssp             EEEEEEEEEECCC-CTTEEEEEE
T ss_pred             HCCCCEEEEEECC-CCCCCCEEE
T ss_conf             4389679999569-801273468


Done!