HHSEARCH alignment of GI: 254780979 and SCOP domain: d2d6fc3

Alignment
>d2d6fc3 d.128.1.5 (C:1-270,C:396-444) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE {Methanobacterium thermoautotrophicum [TaxId: 145262]}
Probab=100.00  E-value=0  Score=835.14  Aligned_cols=274  Identities=29%  Similarity=0.452  Sum_probs=260.6

Q ss_pred             CCCEE---EEEEEEEEECCCCCCCCCCCCCCC-CCCCCCCCHHHCCCCCCCCC---------------------------
Q ss_conf             80338---989997888689865558842468-98765206130268988873---------------------------
Q gi|254780979|r   21 DWEVV---IGIEVHAQLSVVSKLFSGASVNFG-AEPNTQVSFFDAAMPGMLPI---------------------------   69 (500)
Q Consensus        21 ~~e~v---IGLEiH~qL~t~tKlFc~c~~~~~-~~pNt~v~~~~~g~PG~lP~---------------------------   69 (500)
                      |||.|   |||||||||+|+|||||+|+++|+ ++||+++||+|+|+||+||+                           
T Consensus         2 d~e~v~~~IGLEiHvQL~T~tKlFc~c~~~~~~~~pN~~v~~~~~~~pg~lp~~n~~a~~~a~~~~~f~~~~~~~~~c~~   81 (319)
T d2d6fc3           2 DWEKVGLKMGLEIHQQLDTESKLFCPCRTELTDSEPDHDIVRNLRPTQSELGKFDRAAFEEAMRKLHFHYENYHEETCLV   81 (319)
T ss_dssp             CHHHHTCEEEEEEEEECCCSBCSSSCSBSSCCCSCCSEEEEEECCCC----------CTTTTGGGGEEEEEECTTTCCHH
T ss_pred             CHHHHCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             84661772777997895799778889988667789985303355677654433349999876522333223567766510


Q ss_pred             ---------CCHHHHHHHHHHHHHHCCEECCCCEEECCCEECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEE
Q ss_conf             ---------78999999999877829762442013113212376788820144544201533899970677777410379
Q gi|254780979|r   70 ---------LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE  140 (500)
Q Consensus        70 ---------lN~~av~~ai~~~~al~~~i~~~~~fdRK~YfYpDlpkgyQiTQ~~~Pi~~~G~l~~~~~~~~~~~~~~~~  140 (500)
                               +|++|+++|+++|+||||+|++.++|||||||||||||||||||+   |+.+|++++.          .++
T Consensus        82 ~~~~~~~~plN~~av~~ai~~~~aln~~i~~~~~f~RK~y~y~dlpkgyQitq~---i~~~G~i~~~----------~~~  148 (319)
T d2d6fc3          82 EADEEPPHPLNPEALEIAVTIALLLNMRVVDEFHTMRKQVIDGSNTGGFQRTGL---VATDGHLETP----------QGT  148 (319)
T ss_dssp             HHTSSCCCCCCHHHHHHHHHHHHHTTCEECSEECCEEEECTTSSSSSSEEEEEE---EEEEEEEEET----------TEE
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCEECCCCCCCCCCCCCCCCCCCCCCCCC---EECCCCCCCC----------CCC
T ss_conf             368888766488999998777775195745235422234345776665323551---2232662244----------660


Q ss_pred             EEEEEEEEEECCCCCCCCCCCCCEEEEECCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCC
Q ss_conf             84236665202310011567871488661578612576303652778999999999999986420456764322011257
Q gi|254780979|r  141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADV  220 (500)
Q Consensus       141 v~I~~i~lEED~gk~~h~~~~~~slvD~NRaGvPLiEIVT~Pd~~s~~ea~~~~~~l~~ilr~~gisd~~meeGslR~Dv  220 (500)
                      |+|+||||||||||++|+. ++.+++||||||+|||||||+|||+||+||++|+++|+++|||+|+|+|+   |||||||
T Consensus       149 I~I~rihLEEDagK~~h~~-~~~~~vD~NRaGvPLiEIVTePd~~s~~ea~~~~~~l~~il~~lgv~~~~---Gs~R~Dv  224 (319)
T d2d6fc3         149 VKIENLCLEEDAARRIRET-GDGVVFRLDRLGIPLVEITTDPSMSDPQQLREVAYQIGQILRSTRVKRGL---GTIRQDL  224 (319)
T ss_dssp             EEEEEEEEEECCCEEEEEE-TTEEEEETTSTTCEEEEEECCSCCCCHHHHHHHHHHHHHHHTTSSCCCSS---TTCEEEE
T ss_pred             EEEEEEEEECCCCCCCCCC-CCCEEECCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCC---CCCCCCC
T ss_conf             5677899860432113567-88447513446850589986145378899999999998886522202565---4322444


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCC----CCCCCCCCCCCEEEEEECCCCCCCCCCC
Q ss_conf             543213766678862223540246599999999999999731398003----4432337554336653035667777833
Q gi|254780979|r  221 NVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIR----QETRLFDPSKNETRSLRTKEDALDYRYF  296 (500)
Q Consensus       221 NVSi~~~~~~~GtRvEIKNlnS~~~i~~AI~yEi~RQ~~ll~~G~~v~----qETR~~d~~~~~T~~mR~KE~a~DYRyf  296 (500)
                      |||||+     |||||||||||||+|++||+||+.||+++++.|+.+.    ||||+||++ +.|..||+||+  |||||
T Consensus       225 NVSvr~-----GtRvEIKNlNSfr~i~~AI~yEi~RQ~~lle~g~~i~~~~~qetr~~~~~-~~t~~~R~ke~--dyRYf  296 (319)
T d2d6fc3         225 NISIRD-----GARVEVKGVQDLDLIPEIVEREVKRQLSLVEIRDTLQERGPEETRKALPD-GNTQYLRPLPT--SSRMY  296 (319)
T ss_dssp             EEECTT-----SCCEEEECCCCGGGHHHHHHHHHHHHHHHHHHHHHHHHTTCCEEEEECSS-SCEEEEEECCC--CCCEE
T ss_pred             CCCCCC-----CCEEEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC-CCEEEECCCCC--CCCCC
T ss_conf             411146-----62576036650578888888999999999985996333775420037788-98976113664--44668


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHCC
Q ss_conf             27787731269999999885302
Q gi|254780979|r  297 SEPDLLPLEIDEDFIRAIKKQIP  319 (500)
Q Consensus       297 PEPDLPpi~is~e~i~~i~~~lP  319 (500)
                      |||||||+.|+++||+.++++||
T Consensus       297 PEPDLppi~i~~~~Ie~ir~~lP  319 (319)
T d2d6fc3         297 LETDIPLFRIEDDLLEGIRRNLP  319 (319)
T ss_dssp             ECTTSCCEECCHHHHHHHHTTCC
T ss_pred             CCCCCCCEECCHHHHHHHHHHCC
T ss_conf             88997887679999999997594


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Glutamine synthetase/guanido kinase
superfamily: Glutamine synthetase/guanido kinase
family: GatB/GatE catalytic domain-like
domain: Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE
species: Methanobacterium thermoautotrophicum [TaxId: 145262]