BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780979|ref|YP_003065392.1| aspartyl/glutamyl-tRNA
amidotransferase subunit B [Candidatus Liberibacter asiaticus str.
psy62]
         (500 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780979|ref|YP_003065392.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040656|gb|ACT57452.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 500

 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/500 (100%), Positives = 500/500 (100%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD
Sbjct: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG
Sbjct: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT
Sbjct: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV
Sbjct: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD
Sbjct: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR
Sbjct: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE
Sbjct: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG
Sbjct: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANPSIVQKMLKEKLGIKE
Sbjct: 481 GKANPSIVQKMLKEKLGIKE 500


>gi|315122519|ref|YP_004063008.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495921|gb|ADR52520.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 499

 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/499 (87%), Positives = 471/499 (94%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           MVS+D HV+ S S  SG TGDWEVVIG+EVHAQLSV SKLFSGASV+FGA PNTQVSFFD
Sbjct: 1   MVSVDNHVSPSGSFISGATGDWEVVIGMEVHAQLSVRSKLFSGASVDFGAAPNTQVSFFD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLPILN  CV+QAVMTGL  NAHIN+YSVFARKNYFYPDLPQGYQISQH++PIVG
Sbjct: 61  AAMPGMLPILNSDCVRQAVMTGLSFNAHINQYSVFARKNYFYPDLPQGYQISQHNEPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGKVSVS+GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQY++VSCIDLNRSG+ALMEIVT
Sbjct: 121 EGKVSVSLGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYASVSCIDLNRSGIALMEIVT 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
            PDMRSSLEAKAFLTKLR+ILRYLGTCDGNMEEGSMRADVN+SVCRPG+++GTRCEVKNV
Sbjct: 181 NPDMRSSLEAKAFLTKLRTILRYLGTCDGNMEEGSMRADVNISVCRPGDSFGTRCEVKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRFLG AIEYEARRQIAILEDGGHI QETRLFD SKNETRSLRTKEDA DYRYF++PD
Sbjct: 241 NSIRFLGQAIEYEARRQIAILEDGGHIIQETRLFDHSKNETRSLRTKEDAHDYRYFADPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLEIDEDFIR IKKQ+PELPDAKRERFI EFGISLYDASVLVSDKSIADYFEKLAVNR
Sbjct: 301 LLPLEIDEDFIREIKKQLPELPDAKRERFITEFGISLYDASVLVSDKSIADYFEKLAVNR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           DKKI ANWVINDLLG LN+S K+IEDTPISP+QLGELIDLIIDGTISGKIAKDIFNILWE
Sbjct: 361 DKKIAANWVINDLLGGLNKSAKNIEDTPISPDQLGELIDLIIDGTISGKIAKDIFNILWE 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           KGG PK+IV++LGLRQVT++SAIE  VDEVINSNP+NVAR+A KPNLV WFVGQVMKNTG
Sbjct: 421 KGGHPKQIVDDLGLRQVTNISAIELAVDEVINSNPSNVARVAIKPNLVGWFVGQVMKNTG 480

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP IVQK++K+KLGIK
Sbjct: 481 GKANPGIVQKIVKDKLGIK 499


>gi|150396169|ref|YP_001326636.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sinorhizobium
           medicae WSM419]
 gi|166198818|sp|A6U821|GATB_SINMW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|150027684|gb|ABR59801.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sinorhizobium
           medicae WSM419]
          Length = 500

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/500 (69%), Positives = 409/500 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV+IG+EVHAQ+   SKLFSGAS  FG+EPN  VS  D
Sbjct: 1   MSIVDVRTPDPKRFIPGATGDWEVIIGMEVHAQVLSNSKLFSGASTEFGSEPNANVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S+F RKNYFYPDLPQGYQISQ+  PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAKINNRSIFDRKNYFYPDLPQGYQISQYKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ G F  +E+GIER+HLEQDAGKS+HDQ+ A+S +DLNRSGVALMEIV+
Sbjct: 121 EGKIIISVGPDRQGHFEDVEIGIERLHLEQDAGKSMHDQHPAMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EAKA+LTKLRSILRYLGTCDGNM+EGSMRADVNVSV RPGEA+GTRCE+KNV
Sbjct: 181 KPDLRSSDEAKAYLTKLRSILRYLGTCDGNMDEGSMRADVNVSVRRPGEAFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGAIDQETRLFDPGKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+K  +PELPD K+ERF+ + G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 301 LLPLEFDDAFVEALKAHLPELPDDKKERFVRDLGLSVYDASVLVSEKAIADYFEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE TP+SP QLG +IDLI DGTISGK+AKD+F I+W 
Sbjct: 361 DGKTAANWVINDLLGALNKAGKPIEGTPVSPAQLGGIIDLIKDGTISGKLAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE  G++QVTD  AIEK VDE+I +NP+ V +   KP+L  WFVGQVMK TG
Sbjct: 421 EGGDPAQIVESRGMKQVTDTGAIEKAVDEIIAANPDQVEKAKAKPSLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLG +E
Sbjct: 481 GKANPQAVQALVKSKLGFEE 500


>gi|15965067|ref|NP_385420.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sinorhizobium
           meliloti 1021]
 gi|15074246|emb|CAC45893.1| Putative glutamyl-tRNA amidotransferase subunit B [Sinorhizobium
           meliloti 1021]
          Length = 516

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/500 (69%), Positives = 412/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV+IG+EVHAQ+   SKLFS AS  FG+EPN  VS  D
Sbjct: 17  MSIVDVRTPDPKRFIPGATGDWEVIIGMEVHAQVLSNSKLFSSASTEFGSEPNANVSLVD 76

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S+F RKNYFYPDLPQGYQISQ+  PIVG
Sbjct: 77  AAMPGMLPVINEECVKQAVRTGLGLKAKINNRSIFDRKNYFYPDLPQGYQISQYKDPIVG 136

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ GQF  +E+GIER+HLEQDAGKS+HDQ+ A+S +DLNRSGVALMEIV+
Sbjct: 137 EGKIIISVGPDRQGQFEDVEIGIERLHLEQDAGKSMHDQHPAMSYVDLNRSGVALMEIVS 196

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EAKA+LTKLRSILRYLGTCDGNM+EGSMRADVNVSV RPGEA+GTRCE+KNV
Sbjct: 197 KPDLRSSDEAKAYLTKLRSILRYLGTCDGNMDEGSMRADVNVSVRRPGEAFGTRCEIKNV 256

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G +IEYEARRQIAILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PD
Sbjct: 257 NSIRFVGQSIEYEARRQIAILEDGGAIDQETRLFDANKGETRSMRSKEEAHDYRYFPDPD 316

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+K  +PELPD K+ERF+ + G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 317 LLPLEFDDAFVEALKADLPELPDDKKERFVRDLGLSVYDASVLVSEKAIADYFEAVAEGR 376

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK+IE+TP+SP QLG +IDLI DGTISGK+AKD+F ILW 
Sbjct: 377 DGKAAANWVINDLLGALNKAGKTIEETPVSPAQLGGIIDLIKDGTISGKLAKDVFEILWN 436

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VDE+I +NP+ V +   KP+L  WFVGQVMK TG
Sbjct: 437 EGGDPAEIVESRGMKQVTDTGAIEKAVDEIIAANPDQVEKAKAKPSLAGWFVGQVMKATG 496

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 497 GKANPQAVQALVKSKLGIEE 516


>gi|307301138|ref|ZP_07580907.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sinorhizobium
           meliloti BL225C]
 gi|307317871|ref|ZP_07597309.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sinorhizobium
           meliloti AK83]
 gi|24418418|sp|Q92QK5|GATB_RHIME RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|306896633|gb|EFN27381.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sinorhizobium
           meliloti AK83]
 gi|306904093|gb|EFN34679.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sinorhizobium
           meliloti BL225C]
          Length = 500

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/500 (69%), Positives = 412/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV+IG+EVHAQ+   SKLFS AS  FG+EPN  VS  D
Sbjct: 1   MSIVDVRTPDPKRFIPGATGDWEVIIGMEVHAQVLSNSKLFSSASTEFGSEPNANVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S+F RKNYFYPDLPQGYQISQ+  PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAKINNRSIFDRKNYFYPDLPQGYQISQYKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ GQF  +E+GIER+HLEQDAGKS+HDQ+ A+S +DLNRSGVALMEIV+
Sbjct: 121 EGKIIISVGPDRQGQFEDVEIGIERLHLEQDAGKSMHDQHPAMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EAKA+LTKLRSILRYLGTCDGNM+EGSMRADVNVSV RPGEA+GTRCE+KNV
Sbjct: 181 KPDLRSSDEAKAYLTKLRSILRYLGTCDGNMDEGSMRADVNVSVRRPGEAFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G +IEYEARRQIAILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQSIEYEARRQIAILEDGGAIDQETRLFDANKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+K  +PELPD K+ERF+ + G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 301 LLPLEFDDAFVEALKADLPELPDDKKERFVRDLGLSVYDASVLVSEKAIADYFEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK+IE+TP+SP QLG +IDLI DGTISGK+AKD+F ILW 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKTIEETPVSPAQLGGIIDLIKDGTISGKLAKDVFEILWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VDE+I +NP+ V +   KP+L  WFVGQVMK TG
Sbjct: 421 EGGDPAEIVESRGMKQVTDTGAIEKAVDEIIAANPDQVEKAKAKPSLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 481 GKANPQAVQALVKSKLGIEE 500


>gi|227821669|ref|YP_002825639.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sinorhizobium
           fredii NGR234]
 gi|254790962|sp|C3MAA7|GATB_RHISN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|227340668|gb|ACP24886.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Sinorhizobium fredii NGR234]
          Length = 500

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/500 (69%), Positives = 411/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV+IG+EVHAQ+   SKLFSGAS  FG  PN  VS  D
Sbjct: 1   MSIVDVRTPDPKRFIPGATGDWEVIIGLEVHAQVLSNSKLFSGASTEFGNAPNANVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN+ S+F RKNYFYPDLPQGYQISQ+  PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAKINRRSIFDRKNYFYPDLPQGYQISQYKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +SIGPD+ GQF  +E+GIER+HLEQDAGKS+HDQ+ ++S +DLNRSGVALMEIV+
Sbjct: 121 EGKIIISIGPDRQGQFEDVEIGIERLHLEQDAGKSMHDQHPSMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EAKA+LTKLRSILRYLGTCDGNM+EGSMRADVNVSV RPG A+GTRCE+KNV
Sbjct: 181 KPDLRSSDEAKAYLTKLRSILRYLGTCDGNMDEGSMRADVNVSVRRPGAAFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIGILEDGGTIDQETRLFDPNKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+K  +PELPD K++RF+ + G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 301 LLPLEFDDAFVEALKTDLPELPDDKKDRFVRDLGLSVYDASVLVSEKAIADYFEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D KI ANWVINDLLG LN++GK+IE+TP+SP QLG +IDLI  GTISGK+AKD+F ILW 
Sbjct: 361 DGKIAANWVINDLLGALNKAGKTIEETPVSPAQLGGVIDLIKAGTISGKLAKDLFEILWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VDE+I +NP+ V +   KP+L  WFVGQVMK TG
Sbjct: 421 EGGDPAEIVESRGMKQVTDTGAIEKAVDEIIAANPDQVEKAKAKPSLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 481 GKANPQAVQALVKSKLGIEE 500


>gi|163759356|ref|ZP_02166442.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Hoeflea
           phototrophica DFL-43]
 gi|162283760|gb|EDQ34045.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Hoeflea
           phototrophica DFL-43]
          Length = 501

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/498 (68%), Positives = 413/498 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     + L SG TGDWE++IG+EVHAQ++  SKLFSGAS +FG   N+ VS  D
Sbjct: 1   MSLVDTRTPDPKRLISGATGDWEIIIGLEVHAQVTSNSKLFSGASTHFGNAANSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINQECVAQAVRTGLGLKAQINNRSVFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ GQF  IE+GIER+HLEQDAGKS+HDQ+ ++S +DLNRSGVALMEIV+
Sbjct: 121 EGKIIISVGPDRQGQFEDIEIGIERLHLEQDAGKSMHDQHPSMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRS+ EAKA++TKLRSILRYLGTCDGNM+EGSMRADVNVSV +PG  +GTRCE+KNV
Sbjct: 181 KPDMRSADEAKAYVTKLRSILRYLGTCDGNMDEGSMRADVNVSVRKPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIE EARRQIAI+EDGG I QETRLFDP+K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFVGQAIESEARRQIAIIEDGGTIDQETRLFDPAKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ ++K  +PELPD K+ RF+ + G+S+YDAS+LVS+K+IADYFE++A  R
Sbjct: 301 LLPLEFDDAFVESLKADLPELPDDKKARFVADMGLSVYDASILVSEKAIADYFEEVARGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVINDLLG LN+SGK+IE+TP+SP QLG +ID+I DGTISGKIAKD+F I+WE
Sbjct: 361 DGKMAANWVINDLLGALNKSGKAIEETPVSPAQLGAIIDMIKDGTISGKIAKDLFEIIWE 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P ++VE+ G++QVTD  AIEK VDEVI +NP+ VA+   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPADVVEKRGMKQVTDTGAIEKAVDEVIAANPDQVAKAQAKPALAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  VQ ++K KLGI
Sbjct: 481 GKANPKAVQDLVKAKLGI 498


>gi|190891550|ref|YP_001978092.1| aspartyl/glutamyl-tRNA amidotransferase, B subunit [Rhizobium etli
           CIAT 652]
 gi|229486432|sp|B3PXX8|GATB_RHIE6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|190696829|gb|ACE90914.1| aspartyl/glutamyl-tRNA amidotransferase protein, B subunit
           [Rhizobium etli CIAT 652]
          Length = 500

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/500 (68%), Positives = 407/500 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV++G+EVHAQ+   SKLFSGAS  FG   N+ VS  D
Sbjct: 1   MTLVDVRTPDPKRFIPGATGDWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A INK S+F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAQINKRSLFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ GQF  IE+GIER+HLEQDAGKS+HDQ++ +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIVISLGPDRQGQFEDIEIGIERLHLEQDAGKSMHDQHATMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLRSI+RYLGTCDGNM+EGSMRADVNVSV RPGEA+GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEAFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIGILEDGGTIEQETRLFDPNKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+   +PELPD K+ERF+ E G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 301 LLPLEFDDAFVTALAADLPELPDDKKERFVRELGLSVYDASVLVSEKAIADYFEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LNR+GK IE TP+SP QLG +IDLI  GTISGKIAKD+F I+  
Sbjct: 361 DGKTAANWVINDLLGALNRTGKDIEQTPVSPAQLGAIIDLIKAGTISGKIAKDLFEIVLT 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VDE+I +NP+ V ++  KP + +WFVGQVMK TG
Sbjct: 421 EGGDPAEIVESRGMKQVTDTGAIEKAVDEIIAANPDQVEKVKAKPTMAAWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 481 GKANPQAVQALVKAKLGIEE 500


>gi|116251842|ref|YP_767680.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|166198811|sp|Q1MHI9|GATB_RHIL3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|115256490|emb|CAK07574.1| putative aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit B
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 500

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/500 (68%), Positives = 408/500 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV++G+EVHAQ+   SKLFSGAS  FG   N+ VS  D
Sbjct: 1   MTLVDVRTPDPKRFIPGATGDWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSMVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A INK S+F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAQINKRSLFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ GQF  IE+GIER+HLEQDAGKS+HDQ++ +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIVISLGPDRQGQFEDIEIGIERLHLEQDAGKSMHDQHATMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLRSI+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEDFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIGILEDGGKIDQETRLFDPNKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ FI+A++  +PELPD K+ERF+ E G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 301 LLPLEFDDAFIKALEADLPELPDDKKERFVRELGLSIYDASVLVSEKAIADYFEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LNR+GK IE TP+SP QLG +IDLI  GTISGKIAKD+F I+  
Sbjct: 361 DGKTAANWVINDLLGALNRTGKDIEQTPVSPAQLGAIIDLIKAGTISGKIAKDLFEIVLA 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VDE+I +NP+ V ++  KP + +WFVGQVMK TG
Sbjct: 421 EGGDPAEIVEARGMKQVTDTGAIEKAVDEIIAANPDQVEKVKAKPTMAAWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 481 GKANPQAVQALVKAKLGIEE 500


>gi|86357488|ref|YP_469380.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhizobium etli
           CFN 42]
 gi|109892054|sp|Q2K933|GATB_RHIEC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|86281590|gb|ABC90653.1| glutamyl-tRNA amidotransferase subunit B protein [Rhizobium etli
           CFN 42]
          Length = 500

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/500 (68%), Positives = 407/500 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV++G+EVHAQ+   SKLFSGAS  FG   N+ VS  D
Sbjct: 1   MTLVDVRTPDPKRFIPGATGDWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A INK SVF RKNYFYPDLPQGYQISQ+  PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAEINKRSVFDRKNYFYPDLPQGYQISQYKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG++ +S+GPD+ GQF  IE+GIER+HLEQDAGKS+HDQ++ +S +DLNRSGVALMEIV+
Sbjct: 121 EGRIVISLGPDRQGQFEDIEIGIERLHLEQDAGKSMHDQHATMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLRSI+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEPFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIGILEDGGEIEQETRLFDPNKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ FI+ ++  +PELPD K+ERF+ E G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 301 LLPLEFDDAFIKTLEADLPELPDDKKERFVRELGLSVYDASVLVSEKAIADYFEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LNR+GK IE TP+SP QLG +IDLI  GTISGKIAKD+F I+  
Sbjct: 361 DGKTAANWVINDLLGALNRTGKDIEQTPVSPAQLGAIIDLIKAGTISGKIAKDLFEIVLT 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VDE+I +NP  V ++  KP + +WFVGQVMK TG
Sbjct: 421 EGGDPAEIVELRGMKQVTDTGAIEKAVDEIIAANPEQVEKVKAKPTMAAWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 481 GKANPQAVQALVKAKLGIEE 500


>gi|327193635|gb|EGE60518.1| aspartyl/glutamyl-tRNA amidotransferase protein, B subunit
           [Rhizobium etli CNPAF512]
          Length = 500

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/500 (68%), Positives = 406/500 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV++G+EVHAQ+   SKLFSGAS  FG   N+ VS  D
Sbjct: 1   MTLVDVRTPDPKRFIPGATGDWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A INK S+F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAQINKRSLFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ GQF  IE+GIER+HLEQDAGKS+HDQ++ +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIVISLGPDRQGQFEDIEIGIERLHLEQDAGKSMHDQHATMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLRSI+RYLGTCDGNM+EGSMRADVNVSV RPGEA+GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEAFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIGILEDGGTIEQETRLFDPNKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+   +PELPD K+ERF+ E G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 301 LLPLEFDDAFVTALAADLPELPDDKKERFVRELGLSVYDASVLVSEKAIADYFEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LNR+GK IE TP+SP QLG +IDLI  GTISGKIAKD+F I+  
Sbjct: 361 DGKTAANWVINDLLGALNRTGKDIEQTPVSPAQLGAIIDLIKAGTISGKIAKDLFEIVLT 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P  IVE  G++QVTD  AIEK VDE+I +NP+ V ++  KP + +WFVGQVMK TG
Sbjct: 421 EGGDPAAIVESRGMKQVTDTGAIEKAVDEIIAANPDQVEKVKAKPTMAAWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 481 GKANPQAVQALVKAKLGIEE 500


>gi|239831778|ref|ZP_04680107.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Ochrobactrum intermedium LMG 3301]
 gi|239824045|gb|EEQ95613.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Ochrobactrum intermedium LMG 3301]
          Length = 511

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/500 (68%), Positives = 413/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS +FGAEPN+ VS  D
Sbjct: 12  MTLIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTSFGAEPNSNVSLVD 71

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 72  AAMPGMLPVINLECVKQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 131

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 132 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 191

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 192 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 251

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 252 NSIRFVGQAIEYEARRQIAILEDGGSIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 311

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 312 LLPLEFDQAFVDALAAELPELPDVKKQRLVETQGISVYDASILVTEKAIADYYEAVAAGR 371

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LNR+GK IE++PI+P+QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 372 DGKAAANWVINDLLGALNRAGKDIEESPITPDQLGAIIDLIKEGTISGKIAKDLFEIVWN 431

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP  V +   KP L  WFVGQVMK TG
Sbjct: 432 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPEKVEQAKAKPTLAGWFVGQVMKATG 491

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 492 GKANPQSVNELVKAKLGIEE 511


>gi|209549127|ref|YP_002281044.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|229486433|sp|B5ZMJ6|GATB_RHILW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|209534883|gb|ACI54818.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 500

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/500 (68%), Positives = 406/500 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV++G+EVHAQ+   SKLFSGAS  FG   N+ VS  D
Sbjct: 1   MTLVDVRTPDPKRFIPGATGDWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A INK S+F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVRQAVRTGLGLKAQINKRSLFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ GQF  IE+GIER+HLEQDAGKS+HDQ++ +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIVISLGPDRQGQFEDIEIGIERLHLEQDAGKSLHDQHATMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLRSI+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEGFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIGILEDGGTIEQETRLFDPNKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+   +PELPD K+ERF+ E G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 301 LLPLEFDDAFVSALAVDLPELPDDKKERFVRELGLSIYDASVLVSEKAIADYFEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LNR+GK IE TP+SP QLG +IDLI  GTISGKIAKD+F I+  
Sbjct: 361 DGKTAANWVINDLLGALNRTGKDIEQTPVSPAQLGAIIDLIKAGTISGKIAKDLFEIVLT 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIV+  G++QVTD  AIEK VDE+I +NP+ V ++  KP L +WFVGQVMK TG
Sbjct: 421 EGGDPAEIVDARGMKQVTDTGAIEKAVDEIIAANPDQVEKVKAKPTLAAWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 481 GKANPQAVQALVKAKLGIEE 500


>gi|306840394|ref|ZP_07473159.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella sp. BO2]
 gi|306289632|gb|EFM60836.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella sp. BO2]
          Length = 500

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/500 (68%), Positives = 412/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGMIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAELPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|306843798|ref|ZP_07476396.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella sp. BO1]
 gi|306275876|gb|EFM57592.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella sp. BO1]
          Length = 500

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/500 (68%), Positives = 412/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAELPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|222148326|ref|YP_002549283.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Agrobacterium
           vitis S4]
 gi|254790413|sp|B9JVJ7|GATB_AGRVS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|221735314|gb|ACM36277.1| glutamyl-tRNA amidotransferase subunit B [Agrobacterium vitis S4]
          Length = 500

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/500 (68%), Positives = 408/500 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     + L  G TGDWE+VIG+EVHAQ+   SKLFSGAS  FG  PN  VS  D
Sbjct: 1   MTLVDTRTPDPKRLIPGATGDWEIVIGMEVHAQVLSQSKLFSGASTTFGNAPNDNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A INK S+F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVRQAVRTGLGLKAKINKRSIFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ G F  IE+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIIISLGPDRQGNFEDIEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLRSI+RYLGTCDGNM+EGSMRADVNVSV +PG  +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRKPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEDGGSIDQETRLFDPGKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F++A+KK +PELPD K+ RF+   G+S+YDASVLVS+K+IADY+E +A  R
Sbjct: 301 LLPLEFDDAFVQALKKDLPELPDDKKARFVASLGLSVYDASVLVSEKAIADYYEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D KI ANWVINDLLG LN++GK IE+TP+SP QLG +IDLI   TISGKIAKD+F I++ 
Sbjct: 361 DGKIAANWVINDLLGALNKAGKGIEETPVSPAQLGGIIDLIKAETISGKIAKDLFEIVFN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE  G++QVTD  AIEK VDE+I +NP+ VA++  KP L  WFVGQVMK TG
Sbjct: 421 EGGDPADIVESRGMKQVTDTGAIEKAVDEIIAANPDQVAKVLAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLG++E
Sbjct: 481 GKANPQAVQALVKAKLGLEE 500


>gi|153009609|ref|YP_001370824.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ochrobactrum
           anthropi ATCC 49188]
 gi|166198798|sp|A6X191|GATB_OCHA4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|151561497|gb|ABS14995.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Ochrobactrum
           anthropi ATCC 49188]
          Length = 500

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/500 (68%), Positives = 413/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT +   +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS +FGAEPN+ VS  D
Sbjct: 1   MSLIDTRIPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTSFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVKQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGSIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+   +PELPD K++R + + GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAVDLPELPDVKKQRLVEKQGISIYDASILVTEKAIADYYESVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++P+SP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPVSPEQLGAVIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP  V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPEKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQSVNELVKAKLGIEE 500


>gi|17987351|ref|NP_539985.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           melitensis bv. 1 str. 16M]
 gi|23501785|ref|NP_697912.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella suis
           1330]
 gi|62289844|ref|YP_221637.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           bv. 1 str. 9-941]
 gi|82699769|ref|YP_414343.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           melitensis biovar Abortus 2308]
 gi|161618859|ref|YP_001592746.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella canis
           ATCC 23365]
 gi|189024085|ref|YP_001934853.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           S19]
 gi|225627389|ref|ZP_03785426.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Brucella ceti str.
           Cudo]
 gi|225852412|ref|YP_002732645.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           melitensis ATCC 23457]
 gi|237815331|ref|ZP_04594329.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella abortus str. 2308 A]
 gi|254689150|ref|ZP_05152404.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           bv. 6 str. 870]
 gi|254693633|ref|ZP_05155461.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           bv. 3 str. Tulya]
 gi|254697284|ref|ZP_05159112.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254704208|ref|ZP_05166036.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella suis
           bv. 3 str. 686]
 gi|254706891|ref|ZP_05168719.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           pinnipedialis M163/99/10]
 gi|254710002|ref|ZP_05171813.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           pinnipedialis B2/94]
 gi|254730183|ref|ZP_05188761.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           bv. 4 str. 292]
 gi|256031496|ref|ZP_05445110.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           pinnipedialis M292/94/1]
 gi|256113447|ref|ZP_05454288.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           melitensis bv. 3 str. Ether]
 gi|256159622|ref|ZP_05457384.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella ceti
           M490/95/1]
 gi|256254902|ref|ZP_05460438.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella ceti
           B1/94]
 gi|256257400|ref|ZP_05462936.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           bv. 9 str. C68]
 gi|256264090|ref|ZP_05466622.1| glutamyl-tRNA(Gln) amidotransferase B subunit [Brucella melitensis
           bv. 2 str. 63/9]
 gi|260168630|ref|ZP_05755441.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella sp.
           F5/99]
 gi|260545409|ref|ZP_05821150.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           NCTC 8038]
 gi|260563925|ref|ZP_05834411.1| aspartyl/glutamyl tRNA amidotransferase subunit B [Brucella
           melitensis bv. 1 str. 16M]
 gi|260566544|ref|ZP_05837014.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella suis
           bv. 4 str. 40]
 gi|260754649|ref|ZP_05866997.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 6 str. 870]
 gi|260757872|ref|ZP_05870220.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 4 str. 292]
 gi|260761695|ref|ZP_05874038.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883675|ref|ZP_05895289.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 9 str. C68]
 gi|261213899|ref|ZP_05928180.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 3 str. Tulya]
 gi|261222084|ref|ZP_05936365.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella ceti B1/94]
 gi|261314355|ref|ZP_05953552.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella pinnipedialis M163/99/10]
 gi|261317550|ref|ZP_05956747.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella pinnipedialis B2/94]
 gi|261754876|ref|ZP_05998585.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella suis bv. 3 str. 686]
 gi|261758103|ref|ZP_06001812.1| glutamyl-tRNA(Gln) amidotransferase B subunit [Brucella sp. F5/99]
 gi|265988584|ref|ZP_06101141.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella pinnipedialis M292/94/1]
 gi|265994835|ref|ZP_06107392.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella melitensis bv. 3 str. Ether]
 gi|265998049|ref|ZP_06110606.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella ceti M490/95/1]
 gi|294852255|ref|ZP_06792928.1| aspartyl-tRNA(Asn)/glutamyl-tRNA amidotransferase subunit B
           [Brucella sp. NVSL 07-0026]
 gi|297248249|ref|ZP_06931967.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Brucella abortus bv. 5 str. B3196]
 gi|54037154|sp|P64198|GATB_BRUSU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|54041286|sp|P64197|GATB_BRUME RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|75496904|sp|Q57DK8|GATB_BRUAB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|109892008|sp|Q2YNL2|GATB_BRUA2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|189045270|sp|A9MAS2|GATB_BRUC2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|229486045|sp|B2S5D2|GATB_BRUA1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|254790945|sp|C0RIN3|GATB_BRUMB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|17983035|gb|AAL52249.1| glutamyl-tRNA(gln) amidotransferase subunit b [Brucella melitensis
           bv. 1 str. 16M]
 gi|23347716|gb|AAN29827.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Brucella suis 1330]
 gi|62195976|gb|AAX74276.1| GatB, glutamyl-tRNA(Gln) amidotransferase, B subunit [Brucella
           abortus bv. 1 str. 9-941]
 gi|82615870|emb|CAJ10874.1| GatB/Yqey:Glutamyl-tRNA(Gln) amidotransferase B subunit:GatB
           N-terminal region:GatB central domain [Brucella
           melitensis biovar Abortus 2308]
 gi|161335670|gb|ABX61975.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella canis ATCC 23365]
 gi|189019657|gb|ACD72379.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Brucella abortus
           S19]
 gi|225617394|gb|EEH14439.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Brucella ceti str.
           Cudo]
 gi|225640777|gb|ACO00691.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Brucella melitensis
           ATCC 23457]
 gi|237790168|gb|EEP64378.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella abortus str. 2308 A]
 gi|260096816|gb|EEW80691.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           NCTC 8038]
 gi|260153941|gb|EEW89033.1| aspartyl/glutamyl tRNA amidotransferase subunit B [Brucella
           melitensis bv. 1 str. 16M]
 gi|260156062|gb|EEW91142.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella suis
           bv. 4 str. 40]
 gi|260668190|gb|EEX55130.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 4 str. 292]
 gi|260672127|gb|EEX58948.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674757|gb|EEX61578.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 6 str. 870]
 gi|260873203|gb|EEX80272.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 9 str. C68]
 gi|260915506|gb|EEX82367.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 3 str. Tulya]
 gi|260920668|gb|EEX87321.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella ceti B1/94]
 gi|261296773|gb|EEY00270.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella pinnipedialis B2/94]
 gi|261303381|gb|EEY06878.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella pinnipedialis M163/99/10]
 gi|261738087|gb|EEY26083.1| glutamyl-tRNA(Gln) amidotransferase B subunit [Brucella sp. F5/99]
 gi|261744629|gb|EEY32555.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella suis bv. 3 str. 686]
 gi|262552517|gb|EEZ08507.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella ceti M490/95/1]
 gi|262765948|gb|EEZ11737.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella melitensis bv. 3 str. Ether]
 gi|263094293|gb|EEZ18154.1| glutamyl-tRNA(Gln) amidotransferase B subunit [Brucella melitensis
           bv. 2 str. 63/9]
 gi|264660781|gb|EEZ31042.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella pinnipedialis M292/94/1]
 gi|294820844|gb|EFG37843.1| aspartyl-tRNA(Asn)/glutamyl-tRNA amidotransferase subunit B
           [Brucella sp. NVSL 07-0026]
 gi|297175418|gb|EFH34765.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Brucella abortus bv. 5 str. B3196]
 gi|326408920|gb|ADZ65985.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Brucella melitensis
           M28]
 gi|326538637|gb|ADZ86852.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Brucella melitensis
           M5-90]
          Length = 500

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/500 (68%), Positives = 412/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAKLPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|254701664|ref|ZP_05163492.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella suis
           bv. 5 str. 513]
 gi|261752217|ref|ZP_05995926.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella suis bv. 5 str. 513]
 gi|261741970|gb|EEY29896.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella suis bv. 5 str. 513]
          Length = 500

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/500 (68%), Positives = 412/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAKLPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDRVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|241204451|ref|YP_002975547.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240858341|gb|ACS56008.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 500

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/500 (68%), Positives = 408/500 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV++G+EVHAQ+   SKLFSGAS  FG   N+ VS  D
Sbjct: 1   MTLVDVRTPDPKRFIPGATGDWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A INK S+F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVRQAVRTGLGLKAQINKRSLFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ GQF  IE+GIER+HLEQDAGKS+HDQ++ +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIVISLGPDRQGQFEDIEIGIERLHLEQDAGKSMHDQHATMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLRSI+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEDFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILE+GG I QETRLFDP K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIGILEEGGKIDQETRLFDPGKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ FI+A++  +PELPD K+ERF+ E G+S+YDASVLVS+K+IADY+E +A  R
Sbjct: 301 LLPLEFDDAFIKALEVHLPELPDDKKERFVRELGLSIYDASVLVSEKAIADYYEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVINDLLG LNR+GK IE TP+SP QLG +IDLI   TISGKIAKD+F I+  
Sbjct: 361 DGKMAANWVINDLLGALNRTGKDIEQTPVSPAQLGAIIDLIKAETISGKIAKDLFEIVLT 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VDE+I +NP+ V ++ TKP + +WFVGQVMK TG
Sbjct: 421 EGGDPAEIVEARGMKQVTDTGAIEKAVDEIIAANPDQVEKVKTKPTMAAWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 481 GKANPQAVQALVKAKLGIEE 500


>gi|256369327|ref|YP_003106835.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella microti
           CCM 4915]
 gi|255999487|gb|ACU47886.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella microti
           CCM 4915]
          Length = 500

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/500 (68%), Positives = 412/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   G+S+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAKLPELPDVKKQRLVETLGVSVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|254714003|ref|ZP_05175814.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella ceti
           M644/93/1]
 gi|254716938|ref|ZP_05178749.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella ceti
           M13/05/1]
 gi|261218744|ref|ZP_05933025.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella ceti M13/05/1]
 gi|261321757|ref|ZP_05960954.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella ceti M644/93/1]
 gi|260923833|gb|EEX90401.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella ceti M13/05/1]
 gi|261294447|gb|EEX97943.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella ceti M644/93/1]
          Length = 500

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/500 (68%), Positives = 412/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  C++QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECMRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAKLPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|254719004|ref|ZP_05180815.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella sp.
           83/13]
 gi|265983994|ref|ZP_06096729.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella sp. 83/13]
 gi|306840109|ref|ZP_07472895.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella sp. NF 2653]
 gi|264662586|gb|EEZ32847.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella sp. 83/13]
 gi|306404837|gb|EFM61130.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella sp. NF 2653]
          Length = 500

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/500 (68%), Positives = 410/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K+ R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAELPELPDVKKRRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK +VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKTLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|163843171|ref|YP_001627575.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella suis
           ATCC 23445]
 gi|189045271|sp|B0CLM5|GATB_BRUSI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|163673894|gb|ABY38005.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella suis ATCC 23445]
          Length = 502

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/502 (68%), Positives = 413/502 (82%), Gaps = 2/502 (0%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAKLPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNV--ARIATKPNLVSWFVGQVMKN 478
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V  A+   KP L  WFVGQVMK 
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKAKPTLAGWFVGQVMKA 480

Query: 479 TGGKANPSIVQKMLKEKLGIKE 500
           TGGKANP  V +++K KLGI+E
Sbjct: 481 TGGKANPQAVNELVKSKLGIEE 502


>gi|256044574|ref|ZP_05447478.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265990998|ref|ZP_06103555.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|263001782|gb|EEZ14357.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella melitensis bv. 1 str. Rev.1]
          Length = 500

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/500 (68%), Positives = 411/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+L KLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLIKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAKLPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|163868077|ref|YP_001609281.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bartonella
           tribocorum CIP 105476]
 gi|189045269|sp|A9ISC3|GATB_BART1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|161017728|emb|CAK01286.1| glutamyl-tRNA amidotransferase subunit B [Bartonella tribocorum CIP
           105476]
          Length = 499

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/498 (68%), Positives = 410/498 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT    S+   SG TGDWEV+IG+EVHAQ+   SKLFSGAS  FGAEPN  VS  D
Sbjct: 1   MSIIDTRTPDSKHFISGVTGDWEVIIGMEVHAQIISNSKLFSGASAKFGAEPNNHVSLID 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP+LN  CV+QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVLNEECVRQAVRTGLGLKARINLKSVFDRKNYFYPDLPQGYQISQFHYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD +GQF  IEVGIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIIISVGPDSNGQFEDIEVGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGEDFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEDGGVIEQETRLFDATKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ ++   +PELPDA + RF+ E G+++YDAS+LV++K+IADYFE++A  R
Sbjct: 301 LLPLEFDQAFVDSLAADLPELPDAIKARFVKEMGLTVYDASILVTEKAIADYFEEVAYGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D KIVANWVINDLLG LN+  + IE++P+SPNQLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKIVANWVINDLLGALNKDNREIEESPVSPNQLGSIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P++IVEE  ++QVTD  AIE+ VDE++ +N + VA+   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPRQIVEERSMKQVTDTKAIERAVDEIVANNADKVAQAKQKPALAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V +++K KLGI
Sbjct: 481 GKANPQTVNELVKMKLGI 498


>gi|148560303|ref|YP_001258878.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella ovis
           ATCC 25840]
 gi|166217737|sp|A5VQ81|GATB_BRUO2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|148371560|gb|ABQ61539.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Brucella ovis ATCC
           25840]
          Length = 500

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/500 (67%), Positives = 411/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVHRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE ++ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFNQAFVDALAAKLPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK  G
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKAMG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|325292683|ref|YP_004278547.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Agrobacterium
           sp. H13-3]
 gi|325060536|gb|ADY64227.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Agrobacterium
           sp. H13-3]
          Length = 501

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/500 (68%), Positives = 404/500 (80%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWE+VIG+EVHAQ+   SKLFSGAS  FG  PN+ VS  D
Sbjct: 1   MTLVDVRTPDPKRFIPGATGDWEIVIGLEVHAQVLSNSKLFSGASTTFGNAPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S+F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAKINNRSIFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG +++S+GPD+ G F  IE+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGIITISLGPDRQGNFEDIEIGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA+LTKLRSI+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYLTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEGFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPGKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+K  +PELPD K+ RF+ + G+S+YDAS+LVS+K+IADY+E +A  R
Sbjct: 301 LLPLEFDDAFVDALKVDLPELPDDKKARFVADLGLSVYDASILVSEKAIADYYESVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN+SGK IE TP+SP+QLG +IDLI   TISGKIAKD+F I+W 
Sbjct: 361 DPKAAANWVINDLLGALNKSGKDIETTPVSPDQLGGIIDLIKSETISGKIAKDVFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VDE+I +NP+ V ++  KP L  WFVGQVMK TG
Sbjct: 421 EGGNPAEIVETRGMKQVTDTGAIEKAVDEIIAANPDQVEKVKAKPALAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI++
Sbjct: 481 GKANPQAVQALVKAKLGIED 500


>gi|260460725|ref|ZP_05808975.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Mesorhizobium
           opportunistum WSM2075]
 gi|259033302|gb|EEW34563.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Mesorhizobium
           opportunistum WSM2075]
          Length = 499

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/499 (67%), Positives = 408/499 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT    ++ L  G TGDWE++IG+EVHAQ++  +KLFSGAS  FGA PN  VS  D
Sbjct: 1   MTLIDTRTPDAKRLIPGATGDWEIIIGLEVHAQVTSEAKLFSGASTTFGAAPNANVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAIRTGLGLKAQINHKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG V VS+GPD+ G+F  IEVGIER+HLEQDAGKS+HDQ++ +S +DLNRSGVALMEIV+
Sbjct: 121 EGTVIVSVGPDRQGEFEDIEVGIERLHLEQDAGKSMHDQHATMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRS+ EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVNVSV +PG  +GTRCE+KNV
Sbjct: 181 KPDMRSADEAKAYVTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRKPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AI+YEARRQIAILEDGG I QETRLFD  K ETRS+RTKE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIDYEARRQIAILEDGGKIDQETRLFDAVKGETRSMRTKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ ++ A+ K++PELPDAK+ R I   G+S YDAS+LVS+K IADYFEK+A  R
Sbjct: 301 LLPLEFDQAYVDALAKELPELPDAKKARLIASLGLSTYDASILVSEKPIADYFEKVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVINDLLG LN++G+ IE+ P+SP+QLG +IDLI DGTISGKIAKD+F I+W 
Sbjct: 361 DGKLAANWVINDLLGQLNKAGQGIENAPVSPDQLGAVIDLIKDGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P+++VE  G++QVTD  AIEK VDEVI +NP+ V +   KP +  WFVGQVMK TG
Sbjct: 421 EGGDPRQLVESRGMKQVTDTGAIEKAVDEVIAANPDKVEQARAKPTMAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  ++K KLGI+
Sbjct: 481 GKANPQAVNDLVKAKLGIE 499


>gi|319783241|ref|YP_004142717.1| glutamyl-tRNA(Gln) amidotransferase, subunit beta [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317169129|gb|ADV12667.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 499

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/499 (67%), Positives = 411/499 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT    ++ L SG TGDWE++IG+EVHAQ++  +KLFSGAS  FGA PN  VS  D
Sbjct: 1   MSLIDTRTPDAKRLVSGATGDWEIIIGLEVHAQITSEAKLFSGASTAFGAAPNANVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAIRTGLGLKAQINHKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG V VS+GPD+ G+F  IEVGIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGTVIVSVGPDRQGEFEDIEVGIERLHLEQDAGKSMHDQHVTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRS+ EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVNVSV +PG  +GTRCE+KNV
Sbjct: 181 KPDMRSADEAKAYVTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRKPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AI+YEARRQIAILEDGG I QETRLFD +K+ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIDYEARRQIAILEDGGKIEQETRLFDAAKSETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ ++ A+ K++PELPD K+ R I   G+S+YDAS+LVS+K IADYFEK+A  R
Sbjct: 301 LLPLEFDQAYVDALAKELPELPDDKKARLIASLGLSVYDASILVSEKPIADYFEKVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVINDLLG LN++GK IE+ P+SP+QLG +IDLI DGTISGKIAKD+F I+W 
Sbjct: 361 DGKLAANWVINDLLGQLNKAGKDIENAPVSPDQLGAVIDLIKDGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P+++VE  G++QVTD  AIEK VDEVI +NP+ V +   KP++  WFVGQVMK TG
Sbjct: 421 EGGDPRQLVESRGMKQVTDTGAIEKAVDEVIAANPDKVEQARAKPSMAGWFVGQVMKVTG 480

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  ++K KLGI+
Sbjct: 481 GKANPQAVNDLVKTKLGIE 499


>gi|256061006|ref|ZP_05451163.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           neotomae 5K33]
 gi|261325006|ref|ZP_05964203.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella neotomae 5K33]
 gi|261300986|gb|EEY04483.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella neotomae 5K33]
          Length = 500

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/500 (68%), Positives = 411/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PEL D K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAKLPELLDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|110634072|ref|YP_674280.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mesorhizobium
           sp. BNC1]
 gi|123162278|sp|Q11HL0|GATB_MESSB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|110285056|gb|ABG63115.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Chelativorans sp. BNC1]
          Length = 499

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/499 (68%), Positives = 403/499 (80%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     + L  G TGDWEV+IG+E+HAQ++  +KLFSGAS  FGAEPN  VS  D
Sbjct: 1   MTIIDTRTPDPKRLIPGATGDWEVIIGMEIHAQVTSRAKLFSGASTEFGAEPNANVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+ +PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAIRTGLGLKAQINHRSVFDRKNYFYPDLPQGYQISQYKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG V VS+GP K G F  I+VGIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGIVIVSVGPAKDGSFEEIQVGIERLHLEQDAGKSLHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRS+ EAKAFLTKLRSILRYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSADEAKAFLTKLRSILRYLGTCDGNMDEGSMRADVNVSVRRPGEPFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIE EARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIESEARRQIAILEDGGAIDQETRLFDPGKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           L+PL  D+ ++ A+  ++PELPD K+ RF+  FG+S YDASVLV++++ A YFEK+A  R
Sbjct: 301 LVPLVFDQAYVDALAAELPELPDEKKARFMASFGLSEYDASVLVAERATAAYFEKVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LNR+GK IEDTP+SP+ LG +IDLI DGTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNRTGKDIEDTPVSPDHLGTIIDLIKDGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P  IVEE GL+QVTD  AIEK VDEVI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPVRIVEERGLKQVTDTGAIEKAVDEVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  ++ +KLGI+
Sbjct: 481 GKANPQAVNALVNQKLGIE 499


>gi|240850280|ref|YP_002971673.1| glutamyl-tRNA amidotransferase subunit B [Bartonella grahamii
           as4aup]
 gi|240267403|gb|ACS50991.1| glutamyl-tRNA amidotransferase subunit B [Bartonella grahamii
           as4aup]
          Length = 499

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/498 (68%), Positives = 410/498 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT    S+   SG TGDWEV+IG+EVHAQ+   SKLFSGAS  FGAEPN  VS  D
Sbjct: 1   MSIIDTRTPDSKRFISGVTGDWEVIIGMEVHAQIISNSKLFSGASTKFGAEPNNHVSLID 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP+LN  CV+QAV TGLGL AHIN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVLNQECVRQAVRTGLGLKAHINLKSVFDRKNYFYPDLPQGYQISQFRYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+++S+GPD +GQF  IEVGIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKITISVGPDSNGQFEDIEVGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGENFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILE+GG I QETRLFD +K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEEGGVIDQETRLFDAAKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+   +PELPDA + RF+ E G+++YDAS+LV++K+IADYFE++A  R
Sbjct: 301 LLPLEFDQAFVDALAADLPELPDAIKARFVKEMGLTVYDASILVTEKAIADYFEEVARGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D KIVANWVINDLLG LN+  + IE++P+SPNQLG +IDLI +G ISGKIAKD+F I+W 
Sbjct: 361 DGKIVANWVINDLLGALNKDNREIEESPVSPNQLGSIIDLIKEGVISGKIAKDLFEIIWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG  ++IVEE  ++QVTD  AIE+ VDE+I +N + VA+   KP L  WFVGQVMK TG
Sbjct: 421 EGGDARQIVEERNMKQVTDTKAIERAVDEIIANNSDKVAQAKQKPALSGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V +++K KLGI
Sbjct: 481 GKANPQTVNELVKIKLGI 498


>gi|159184713|ref|NP_354330.2| aspartyl/glutamyl-tRNA amidotransferase subunit B [Agrobacterium
           tumefaciens str. C58]
 gi|24418412|sp|Q8UFS3|GATB_AGRT5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|159140001|gb|AAK87115.2| glutamyl-tRNA amidotransferase subunit B [Agrobacterium tumefaciens
           str. C58]
          Length = 501

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/500 (67%), Positives = 402/500 (80%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWE+VIG+EVHAQ+   SKLFSGAS  FG  PN+ VS  D
Sbjct: 1   MTLVDVRTPDPKRFIPGATGDWEIVIGLEVHAQVLSNSKLFSGASTTFGNAPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S+F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAKINNRSIFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG +++S+GPD+ G F  IE+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGTITISLGPDRQGNFEDIEIGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAK +LTKLRSI+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKGYLTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEGFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQ+AILEDGG I QETRLFDP K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQVAILEDGGVIDQETRLFDPGKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+K  +PELPD K+ RF+ + G+S+YDAS+LVS+K+IADY+E +A  R
Sbjct: 301 LLPLEFDDAFVEALKVDLPELPDDKKARFVADLGLSVYDASILVSEKAIADYYEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN+ GK IE TP+SP+QLG +IDLI   TISGKIAKD+F I+W 
Sbjct: 361 DAKTAANWVINDLLGALNKFGKDIETTPVSPDQLGGIIDLIKAETISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VD++I +NP+ V ++  KP L  WFVGQVMK TG
Sbjct: 421 EGGNPAEIVEARGMKQVTDTGAIEKAVDDIIAANPDQVEKVKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI++
Sbjct: 481 GKANPQAVQALVKAKLGIED 500


>gi|49475386|ref|YP_033427.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bartonella
           henselae str. Houston-1]
 gi|81648033|sp|Q6G3Y7|GATB_BARHE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|49238192|emb|CAF27402.1| Glutamyl-tRNA amidotransferase subunit b [Bartonella henselae str.
           Houston-1]
          Length = 499

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/498 (68%), Positives = 409/498 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT    S+   SG TGDWEV+IG+EVHAQ+   SKLFSGAS  FGAEPN  VS  D
Sbjct: 1   MEIVDTRTPNSKRFISGVTGDWEVIIGMEVHAQIISNSKLFSGASTKFGAEPNNHVSLID 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP+LN  CV+QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVLNQECVRQAVRTGLGLKARINLRSVFDRKNYFYPDLPQGYQISQFRYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +SIGPD +GQF  IEVGIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIIISIGPDSNGQFEDIEVGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRS+ EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPGE++GTRCE+KNV
Sbjct: 181 KPDMRSADEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGESFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEDGGVIDQETRLFDAAKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD  + RFI E G++ YDAS+LV++K+IA+YFEK+A  R
Sbjct: 301 LLPLEFDQAFVDALAAELPELPDDIKIRFINEMGLTAYDASILVTEKAIANYFEKVAHGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K VANWVINDLLG LN+  + IE+TP+SP+QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKTVANWVINDLLGALNKDNREIEETPVSPDQLGSIIDLIKEGTISGKIAKDLFEIIWH 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P++IVEE  ++QVTD  AIE+ VDE++ +N + VA+   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPRQIVEERNMKQVTDTKAIERAVDEIMANNSDKVAQAKQKPALAGWFVGQVMKTTG 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V +++K KLGI
Sbjct: 481 GKANPQTVNELVKLKLGI 498


>gi|49474319|ref|YP_032361.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bartonella
           quintana str. Toulouse]
 gi|81647008|sp|Q6FZK7|GATB_BARQU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|49239823|emb|CAF26214.1| Glutamyl-tRNA amidotransferase subunit b [Bartonella quintana str.
           Toulouse]
          Length = 499

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/495 (67%), Positives = 413/495 (83%)

Query: 4   LDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAM 63
           +DT +  S+   SG TGDWEV+IG+EVHAQ+   SKLFSGAS  FGAEPN  VS  DAAM
Sbjct: 4   IDTRIPDSKRFISGVTGDWEVIIGMEVHAQIISNSKLFSGASTKFGAEPNNHVSLIDAAM 63

Query: 64  PGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGK 123
           PGMLP++N  CV+QAV TGLGL AHIN  SVF RKNYFYPDLPQGYQISQ   P+VGEGK
Sbjct: 64  PGMLPVINQECVRQAVRTGLGLKAHINLKSVFDRKNYFYPDLPQGYQISQFRYPVVGEGK 123

Query: 124 VSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPD 183
           +++SIGPD +GQF  IE+GIER+HLEQDAGKSIHDQ+  +S +DLNRSGVALMEIV+KPD
Sbjct: 124 ITISIGPDPNGQFEDIEIGIERLHLEQDAGKSIHDQHPTMSFVDLNRSGVALMEIVSKPD 183

Query: 184 MRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSI 243
           MRSS EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNVNSI
Sbjct: 184 MRSSDEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGENFGTRCEIKNVNSI 243

Query: 244 RFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLP 303
           RF+G AIEYEARRQIAILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PDLLP
Sbjct: 244 RFIGQAIEYEARRQIAILEDGGVIDQETRLFDAAKGETRSMRSKEEAHDYRYFPDPDLLP 303

Query: 304 LEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKK 363
           LE D+ F+ A+  ++PELPD  + RFI + G++ YDAS+LV++++IADYFE++A  RD K
Sbjct: 304 LEFDQAFVDALAVELPELPDDIKARFINKMGLTPYDASILVAERAIADYFEEVACGRDGK 363

Query: 364 IVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG 423
           + ANWVINDLLG LN+   +IE+TP++P+QLG +IDLI +GTISGKIAKD+F I+W +GG
Sbjct: 364 MAANWVINDLLGALNKDNCAIEETPVAPSQLGAIIDLIKEGTISGKIAKDLFEIIWNEGG 423

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKA 483
            P+++VEE  ++QVTD+ AIE+ VDE++++N + VA+   KP L+ WFVGQVMK TGGKA
Sbjct: 424 DPRQVVEERNMKQVTDIKAIERAVDEIVSNNSDKVAQAKQKPTLIGWFVGQVMKATGGKA 483

Query: 484 NPSIVQKMLKEKLGI 498
           NP  V +++K KLGI
Sbjct: 484 NPQTVNELVKVKLGI 498


>gi|319407119|emb|CBI80756.1| glutamyl-tRNA amidotransferase subunit B [Bartonella sp. 1-1C]
          Length = 499

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/498 (68%), Positives = 408/498 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT +   +   SGTTGDWEV+IG+EVHAQ+   SKLFSGAS  FGAEPN  VS  D
Sbjct: 1   MEIVDTRLPDPKRFISGTTGDWEVIIGMEVHAQVISNSKLFSGASTKFGAEPNNHVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  C++QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINQACIRQAVRTGLGLKAKINLKSVFDRKNYFYPDLPQGYQISQFQYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGKV VS GPD +GQF  IE+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKVVVSTGPDSNGQFEDIEIGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVN+SV RPG  +GTRCEVKNV
Sbjct: 181 KPDMRSSEEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNISVRRPGGPFGTRCEVKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEDGGVIDQETRLFDATKGETRSMRSKEEAYDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE+D+ F+  +  ++PELPD  + RFI E G++ YDAS+LV++K+IADYFE++A  R
Sbjct: 301 LLPLELDQVFVDTLASELPELPDDIKARFINEMGLTAYDASILVTEKAIADYFEEVAHGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+VANWVINDLLG LN+  + IEDTPI+ NQLG +IDLI DGTISGKIAKD+F I+W 
Sbjct: 361 DGKMVANWVINDLLGALNKDNRDIEDTPITANQLGAIIDLIKDGTISGKIAKDLFEIIWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE+ G++QVTD   IE+VVDE+I +NP+ V++   KP L+ WFVGQVMK T 
Sbjct: 421 EGGDPHQIVEKRGMKQVTDAGVIERVVDEIIINNPDKVSQAREKPALIGWFVGQVMKATE 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V K++K KLG+
Sbjct: 481 GKANPQTVNKLVKSKLGV 498


>gi|319408370|emb|CBI82023.1| glutamyl-tRNA amidotransferase subunit B [Bartonella
           schoenbuchensis R1]
          Length = 499

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/498 (67%), Positives = 406/498 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT         SG TGDWEV+IG+EVHAQ++  SKLFSGAS  FGAEPN  VSF D
Sbjct: 1   MEIVDTRTPDPRCFISGATGDWEVIIGMEVHAQITSDSKLFSGASTKFGAEPNNHVSFID 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINQECVRQAIRTGLGLKAKINLRSVFDRKNYFYPDLPQGYQISQFQYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGKV VS+GPD +GQF  IE+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKVVVSVGPDSNGQFEDIEIGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGEVFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFD +K ETRS+R KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEDGGVIDQETRLFDAAKGETRSMRLKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PE PD  + RFI E G++ YDAS+LV++K+IADYFE++A  R
Sbjct: 301 LLPLEFDQAFVDALAAELPEFPDDIKLRFINEMGLTAYDASILVTEKAIADYFEEVARGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D KIVANWVINDLLG LN+  + IEDTP++P+QLG +IDLI +G ISGKIAKD+F I+W 
Sbjct: 361 DGKIVANWVINDLLGALNKDNREIEDTPVTPDQLGAIIDLIKEGVISGKIAKDLFEIIWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P+++VEE G++QVTD   I+ VVDE+I +N + VA+   KP L+ WFVGQVMK TG
Sbjct: 421 EGGDPRQVVEERGMKQVTDTEVIKGVVDEIIANNSDKVAQAREKPALIGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V +++K KL I
Sbjct: 481 GKANPQAVNELVKTKLKI 498


>gi|319405548|emb|CBI79167.1| glutamyl-tRNA amidotransferase subunit B [Bartonella sp. AR 15-3]
          Length = 499

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/498 (67%), Positives = 410/498 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D+ +   +   SG TG+WEV+IG+EVHAQ+   SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MKIVDSRLPDPKRFISGVTGEWEVIIGMEVHAQVISNSKLFSGASTKFGAEPNSHVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  C++QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINQACIRQAVRTGLGLKAKINLKSVFDRKNYFYPDLPQGYQISQFQYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGKV +SIGPD +GQF  IE+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKVVISIGPDSNGQFEDIEIGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVN+SV RPGE +GTRCEVKNV
Sbjct: 181 KPDMRSSEEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNISVRRPGEPFGTRCEVKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEDGGIIDQETRLFDAIKGETRSMRSKEEAYDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE+D++F+  +  ++PELPD  R RFI E G++ YDAS+LV++K+IADYFE++A  R
Sbjct: 301 LLPLELDQEFVDTLALELPELPDDIRARFINEMGLTAYDASILVTEKAIADYFEEVAHGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+VANWVINDLLG LN+  + IEDTPI+ NQLG +IDLI DGTISGKIAKD+F I+W 
Sbjct: 361 DGKMVANWVINDLLGALNKDNRVIEDTPITANQLGAIIDLIKDGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE+ G++QVTD   IE+ V+E++ +NP+ V+++  KP LV WFVGQVMK T 
Sbjct: 421 EGGDPYQIVEKRGMKQVTDAGVIERAVNEIVINNPDKVSQVREKPALVGWFVGQVMKATE 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V K++K KLGI
Sbjct: 481 GKANPQTVNKLVKIKLGI 498


>gi|13470473|ref|NP_102042.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mesorhizobium
           loti MAFF303099]
 gi|24418429|sp|Q98ND3|GATB_RHILO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|14021215|dbj|BAB47828.1| Glu-tRNA(Gln) amidotransferase subunit [Mesorhizobium loti
           MAFF303099]
          Length = 499

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/499 (66%), Positives = 403/499 (80%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT    ++ L  G TGDWE++IG+EVHAQ+   +KLFSGAS  FGA PN  VS  D
Sbjct: 1   MTIIDTRTPDAKRLIPGATGDWEIIIGLEVHAQVISEAKLFSGASTAFGAAPNANVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAIRTGLGLKAQINHKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG V VS+GPD+ G+F  IEVGIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGTVIVSVGPDRQGEFEDIEVGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RS  EAKA++TKLR+I+RYLGTCDGNM+EGS+RADVNVSV RPG  +GTRCE+KN+
Sbjct: 181 KPDLRSGDEAKAYVTKLRTIMRYLGTCDGNMDEGSLRADVNVSVRRPGGEFGTRCEIKNM 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AI+YEARRQIAILEDGG I QETRL+D  K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIDYEARRQIAILEDGGKIDQETRLYDAVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ ++ A+ K++PELPD K+ R I   G+S YDAS+LVS+KS+ADYFEK+A  R
Sbjct: 301 LLPLEFDQAYVDALAKELPELPDDKKARLITSLGLSTYDASILVSEKSVADYFEKVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVINDLLG LN+ GK IE+ P+SP+QLG +IDLI DGTISGKIAKD+F I+W 
Sbjct: 361 DGKLAANWVINDLLGQLNKVGKDIENAPVSPDQLGAIIDLIKDGTISGKIAKDLFEIVWS 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P+ +VE  G++QVTD  AIEK VDEVI +NP+ V +   KP +  WFVGQVMK TG
Sbjct: 421 EGGDPRALVESRGMKQVTDTGAIEKAVDEVIAANPDKVEQARAKPTMAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  ++K KLGI+
Sbjct: 481 GKANPQAVNDLVKAKLGIE 499


>gi|319404105|emb|CBI77695.1| glutamyl-tRNA amidotransferase subunit B [Bartonella rochalimae
           ATCC BAA-1498]
          Length = 499

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/498 (67%), Positives = 405/498 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D  +   +   SG TGDWEV+IG+EVHAQ+   SKLFSGAS  FGAEPN  VS  D
Sbjct: 1   MKIVDARLPDPKRFISGATGDWEVIIGMEVHAQVISNSKLFSGASTKFGAEPNNHVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  C++QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINQACIRQAVRTGLGLKAKINLKSVFDRKNYFYPDLPQGYQISQFQYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGKV VSIGPD +GQF  IE+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKVVVSIGPDSNGQFEDIEIGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVN+SV RPG  +GTRCEVKNV
Sbjct: 181 KPDMRSSEEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNISVRRPGGPFGTRCEVKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEDGGVIDQETRLFDATKGETRSMRSKEEAYDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE+D+ F+  +  ++PELPD  + RFI E G++ YDAS+LV++K+IADYFE++A  R
Sbjct: 301 LLPLELDQVFVDTLASELPELPDDIKARFINEMGLTAYDASILVTEKAIADYFEEVAHGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+VANWVINDLLG LN+  + IEDTPI+ NQLG +IDLI  GTISGKIAKD+F I+W 
Sbjct: 361 DGKMVANWVINDLLGALNKDNRDIEDTPITANQLGAIIDLIKVGTISGKIAKDLFEIIWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE+ G++QVTD   IE+ VDE+I +NP+ V++   KP L+ WFVGQVMK T 
Sbjct: 421 EGGDPHQIVEKRGMKQVTDAGVIERAVDEIIINNPDKVSQAREKPALIGWFVGQVMKATE 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V K++K KLGI
Sbjct: 481 GKANPQTVNKLVKSKLGI 498


>gi|114704674|ref|ZP_01437582.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Fulvimarina
           pelagi HTCC2506]
 gi|114539459|gb|EAU42579.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Fulvimarina
           pelagi HTCC2506]
          Length = 499

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/499 (66%), Positives = 408/499 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +S   G TGDWE++IG+EVHAQ+   SKLFSGAS +FGAE N+ VS  D
Sbjct: 1   MTIVDTRDPNPKSFIPGATGDWEIIIGMEVHAQVLSDSKLFSGASTDFGAEANSHVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A INK SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVRQAVRTGLGLKAQINKRSVFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG V+VS+GP+  G+F  IEVGIER+HLEQDAGKS+HDQ+ ++S +DLNRSGVALMEIV+
Sbjct: 121 EGTVTVSVGPNNQGEFEDIEVGIERLHLEQDAGKSMHDQHPSMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRS+ EAKA+LTKLR+ILRYLGTC+GNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDMRSADEAKAYLTKLRTILRYLGTCNGNMDEGSMRADVNVSVRRPGGPFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIE EARRQIA++EDGG + QETRLFDPSK ETR++R KEDA DYRYF +PD
Sbjct: 241 NSIRFVGQAIESEARRQIALIEDGGMVEQETRLFDPSKGETRAMRNKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ +I A+  ++PELPD K+ RFI E G+S YDAS+LVS+K+IAD++E++A  R
Sbjct: 301 LLPLEFDQAYIDALLSELPELPDDKKNRFIEEGGLSTYDASILVSEKAIADFYEEVAKGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN+ GKSIE+TP+S  QLG ++DLI +GTISGKIAKD+F I+W 
Sbjct: 361 DAKQAANWVINDLLGALNKDGKSIEETPVSAAQLGAILDLIREGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK IVE+ G++QVTD  AIEK VD+V+ +N + V +   KP++  WFVGQVMK TG
Sbjct: 421 EGGDPKRIVEDRGMKQVTDTGAIEKAVDDVMAANSDKVEQAKAKPSMAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  ++K+KLG++
Sbjct: 481 GKANPQAVNALVKDKLGVE 499


>gi|121602274|ref|YP_988867.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bartonella
           bacilliformis KC583]
 gi|166217735|sp|A1USB4|GATB_BARBK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|120614451|gb|ABM45052.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Bartonella bacilliformis KC583]
          Length = 499

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/498 (66%), Positives = 402/498 (80%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D          SG+TGDWEVVIG+EVHAQ+   SKLFSGAS  FGAEPN  VS  D
Sbjct: 1   MQMIDIRPPDPRHFISGSTGDWEVVIGMEVHAQIVSDSKLFSGASTKFGAEPNNHVSLID 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  C++QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVVNQECIRQAIRTGLGLKAQINLKSVFDRKNYFYPDLPQGYQISQFHYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGKV++SIGPD +GQF  +E+GIER+HLEQDAGKSIHDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKVTISIGPDSNGQFEDVEIGIERLHLEQDAGKSIHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLR ILRYLGTCDGNM+EGS+RADVNVSV RPGE  GTRCE+KNV
Sbjct: 181 KPDMRSSEEAKAYITKLRMILRYLGTCDGNMDEGSIRADVNVSVRRPGEPLGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIA+LEDGG I  ETRLFD +K ETRS+R KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAVLEDGGVIDPETRLFDAAKCETRSIRLKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD  + RFI + G+++YDAS+L+++K IADYF+K+A  R
Sbjct: 301 LLPLEFDQAFVDALASELPELPDDIKARFINDMGLTVYDASILITEKEIADYFQKVARGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+VANWVINDLLG LN++   IEDTP+ P+QLG +IDLI +G ISGKIAKD+F I+W 
Sbjct: 361 DGKMVANWVINDLLGALNKNNCKIEDTPVKPDQLGAIIDLIEEGIISGKIAKDLFEIIWH 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG  ++IVEE G++QVTD  AI+  VDE++ +NP+ V++   KP LV WFVGQVMK TG
Sbjct: 421 EGGDLRQIVEERGMKQVTDTGAIQSAVDEIMANNPDKVSQAKEKPALVGWFVGQVMKETG 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V K++K KL I
Sbjct: 481 GKANPQTVNKLVKMKLEI 498


>gi|222085631|ref|YP_002544161.1| glutamyl-tRNA amidotransferase subunit B protein [Agrobacterium
           radiobacter K84]
 gi|221723079|gb|ACM26235.1| glutamyl-tRNA amidotransferase subunit B protein [Agrobacterium
           radiobacter K84]
          Length = 474

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/473 (69%), Positives = 390/473 (82%)

Query: 28  IEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNA 87
           +EVHAQ+   SKLFSGAS  FG   N+ VS  DAAMPGMLP++N  CV+QAV TGLGL A
Sbjct: 1   MEVHAQVLSKSKLFSGASTEFGKPQNSNVSLVDAAMPGMLPVINEECVKQAVRTGLGLKA 60

Query: 88  HINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIH 147
            IN  S+F RKNYFYPDLPQGYQISQ   PIVGEGK+ +S+GPD+ GQF  IE+GIER+H
Sbjct: 61  QINNRSIFDRKNYFYPDLPQGYQISQFKDPIVGEGKIVISLGPDRQGQFEDIEIGIERLH 120

Query: 148 LEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTC 207
           LEQDAGKS+HDQ++ +S +DLNRSGVALMEIV+KPDMRSS EAKA++TKLRSI+RYLGTC
Sbjct: 121 LEQDAGKSLHDQHATMSYVDLNRSGVALMEIVSKPDMRSSDEAKAYMTKLRSIVRYLGTC 180

Query: 208 DGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHI 267
           DGNM+EGSMRADVNVSV RPG  +GTRCE+KNVNSIRF+G AIEYEARRQIAILEDGG I
Sbjct: 181 DGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNVNSIRFIGQAIEYEARRQIAILEDGGSI 240

Query: 268 RQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRE 327
            QETRLFDP K ETRS+R+KEDA DYRYF +PDLLPLE D+ F+  +   +PELPD K+E
Sbjct: 241 DQETRLFDPGKGETRSMRSKEDAHDYRYFPDPDLLPLEFDDAFVTELAAHLPELPDDKKE 300

Query: 328 RFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDT 387
           RF+ + G+S+YDASVLVS+K+IADYFE +A  RD K+ ANWVINDLLG LNR+GK IE+T
Sbjct: 301 RFVRDLGLSIYDASVLVSEKAIADYFETVAAGRDGKMAANWVINDLLGALNRTGKDIEET 360

Query: 388 PISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVV 447
           P+S  QLG +IDLI   TISGKIAKD+F I+  +GG P EIVE  G++QVTD  AIEK V
Sbjct: 361 PVSSAQLGAIIDLIKAETISGKIAKDLFEIVLTEGGDPTEIVEARGMKQVTDTGAIEKAV 420

Query: 448 DEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLGIKE 500
           DE+I +NP+ VA++  KP L  WFVGQVMK+TGGKANP  VQ ++K KLGI+E
Sbjct: 421 DEIIAANPDQVAKVKAKPTLAGWFVGQVMKSTGGKANPQAVQALVKAKLGIEE 473


>gi|319898783|ref|YP_004158876.1| glutamyl-tRNA amidotransferase subunit B [Bartonella clarridgeiae
           73]
 gi|319402747|emb|CBI76294.1| glutamyl-tRNA amidotransferase subunit B [Bartonella clarridgeiae
           73]
          Length = 499

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/498 (66%), Positives = 402/498 (80%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT +   +   SG TGDWEV+IG+E+HAQ+   SKLFSGAS  FGAEPN  VS  D
Sbjct: 1   MKIVDTRLPNPKRFISGVTGDWEVIIGMEIHAQVISDSKLFSGASTKFGAEPNNHVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  C+ QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINQACICQAIRTGLGLKAKINLRSVFDRKNYFYPDLPQGYQISQFQYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGKV VSIGPD +GQF  IE+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKVLVSIGPDSNGQFEDIEIGIERLHLEQDAGKSMHDQHPTMSFLDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVN+SV RPG  +GTRCE+KNV
Sbjct: 181 KPDMRSSEEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNISVRRPGGPFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEDGGVIDQETRLFDAIKGETRSMRSKEEAYDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+  +  ++PELPD  + RFI E G++ YDAS+LV++K+IADYFE++A  R
Sbjct: 301 LLPLEFDQAFVDTLAAELPELPDDIKARFINEMGLTAYDASILVTEKAIADYFEEVAHGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVINDLLG LN+  + IE+TPI+  QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKMAANWVINDLLGALNKDNRDIENTPITAKQLGAIIDLIKEGTISGKIAKDLFEIIWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE+ G++QVTD   IE+ VD++I +NP+ VA+   KP LV WF+GQVMK T 
Sbjct: 421 EGGDPHQIVEKRGMKQVTDAGVIERAVDKIIINNPDKVAQAREKPVLVGWFIGQVMKATE 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V K++K KLGI
Sbjct: 481 GKANPQTVNKLVKIKLGI 498


>gi|90417717|ref|ZP_01225629.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337389|gb|EAS51040.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 499

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/499 (64%), Positives = 400/499 (80%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     ++  SG TGDWE+V+G+EVHAQ++  +KLFSGAS +FG  PN  VS  D
Sbjct: 1   MTLVDTRTPDPKNFISGATGDWEIVVGMEVHAQVTSEAKLFSGASTDFGGAPNDHVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A I   SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVRQAVRTGLGLKAEIKHRSVFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG VSVS+GPD  G+F  I VG+ER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGIVSVSVGPDSKGEFEEIAVGVERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRS+ EAKA+LTKLR+ILRYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDMRSADEAKAYLTKLRTILRYLGTCDGNMDEGSMRADVNVSVRRPGGDFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G  IE EARRQ+AILEDGG I QETRL+DP+K ETR++R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQCIEAEARRQVAILEDGGAIDQETRLYDPAKGETRAMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ ++ A+ + +PELPDAK+ R I + G+S YDAS+LVS+K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAYVDALLEGLPELPDAKKNRLIRDAGLSAYDASILVSEKAIADYYEAVAKGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK I +TP++  QLG ++D+I   TISGKIAKD+F I+W 
Sbjct: 361 DAKQAANWVINDLLGALNKAGKDIGETPVAAEQLGAILDMIRAETISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P++IV+E G++QVTD  AIE  VDEVI +NP+ V +   KP +  WFVGQVMK TG
Sbjct: 421 EGGDPEKIVDERGMKQVTDTGAIETAVDEVIAANPDKVEQARAKPTMAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  ++K+KLG++
Sbjct: 481 GKANPQAVNALVKQKLGLE 499


>gi|170742458|ref|YP_001771113.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           sp. 4-46]
 gi|229486441|sp|B0UHC4|GATB_METS4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|168196732|gb|ACA18679.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           sp. 4-46]
          Length = 490

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/488 (66%), Positives = 396/488 (81%), Gaps = 5/488 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
           + L  G  GDWEVVIG+E+HAQ++  SKLFSGAS  FGAEPN  VS  DAAMPGMLP++N
Sbjct: 8   KKLIKGALGDWEVVIGMEIHAQVTSRSKLFSGASTAFGAEPNAHVSLVDAAMPGMLPVIN 67

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V + PD
Sbjct: 68  RECVAQAVRTGLGLKAQINHRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGEVLVDL-PD 126

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
                 TI VGIER+HLEQDAGKS+HDQ+ ++S +DLNRSGVALMEIV+KPD+RSS EAK
Sbjct: 127 GE----TIRVGIERLHLEQDAGKSLHDQHPSLSFVDLNRSGVALMEIVSKPDLRSSEEAK 182

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A++TKLR+ILRYLGTCDG+ME+G++RADVNVSV RPGE +GTRCE+KNVNSIRF+G AIE
Sbjct: 183 AYVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRRPGEPFGTRCEIKNVNSIRFIGQAIE 242

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
            EARRQIAILEDGG I QETRL+DP++NETRS+R+KE+A DYRYF +PDLLPLEI++ FI
Sbjct: 243 TEARRQIAILEDGGWIEQETRLYDPNRNETRSMRSKEEAHDYRYFPDPDLLPLEIEQAFI 302

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
             ++ ++PELPDAK+ RF+ E+G+S YDA+VLV++++ ADYFE +A  RD K  ANWVIN
Sbjct: 303 DGLRTELPELPDAKKARFVAEYGLSAYDATVLVAERASADYFEAVAKGRDGKAAANWVIN 362

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           +L G LN+ G  IE +P+S  QLG +IDLI DGTISGKIAKD+F I+W +GG P+ IVE 
Sbjct: 363 ELFGRLNKEGHGIEGSPVSAAQLGAIIDLIADGTISGKIAKDLFEIVWGEGGDPRAIVES 422

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
            GL+QVTD  AIE  VD++I +NP+ VA+   KP L+ WFVGQ MK TGGKANP+ V  +
Sbjct: 423 RGLKQVTDTGAIEAAVDQIIAANPDKVAQAKAKPTLLGWFVGQTMKATGGKANPAAVNAL 482

Query: 492 LKEKLGIK 499
           LK KLGI+
Sbjct: 483 LKTKLGIE 490


>gi|220923244|ref|YP_002498546.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Methylobacterium
           nodulans ORS 2060]
 gi|254790957|sp|B8IL55|GATB_METNO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|219947851|gb|ACL58243.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           nodulans ORS 2060]
          Length = 490

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/488 (66%), Positives = 392/488 (80%), Gaps = 5/488 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
           + L  G  GDWEVVIG+E+HAQ++  SKLFSGAS  FGAEPN  VS  DAAMPGMLP++N
Sbjct: 8   KKLIKGALGDWEVVIGMEIHAQVTSRSKLFSGASTAFGAEPNDNVSLVDAAMPGMLPVIN 67

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V +   
Sbjct: 68  RECVAQAVRTGLGLKAQINHRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGEVLVDLP-- 125

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
              +  TI VGIER+HLEQDAGKS+HDQ+ ++S +DLNRSGVALMEIV+KPD+RS+ EAK
Sbjct: 126 ---EGETIRVGIERLHLEQDAGKSLHDQHPSLSFVDLNRSGVALMEIVSKPDLRSAEEAK 182

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A++TKLR+ILRYLGTCDG+ME+G++RADVNVSV RPGE  GTRCE+KNVNSIRF+G AIE
Sbjct: 183 AYVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRRPGEFLGTRCEIKNVNSIRFIGQAIE 242

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
            EARRQIAILEDGG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLPLEID+ FI
Sbjct: 243 AEARRQIAILEDGGVIEQETRLFDPNKGETRSMRSKEEAHDYRYFPDPDLLPLEIDDAFI 302

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
             +K ++PELPD K+ RF+ E+G+S YDA+VLV++++ ADYFE +A  RD K  ANWVIN
Sbjct: 303 DELKTELPELPDTKKARFVAEYGLSAYDATVLVAERASADYFEAVARGRDGKAAANWVIN 362

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           +L G LN+ G  IED+P+S  QLG +IDLI DGTISGKIAKD+F I+W +GG P+ IVE 
Sbjct: 363 ELFGRLNKEGHGIEDSPVSAEQLGAIIDLIADGTISGKIAKDLFEIVWSEGGDPRAIVES 422

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
            GLRQVTD  AIE  VD++I +NP+ V +   KP L+ WFVGQ MK TGGKANP+ V  +
Sbjct: 423 RGLRQVTDTGAIEAAVDQIIAANPDKVVQAQAKPTLLGWFVGQTMKATGGKANPAAVNAL 482

Query: 492 LKEKLGIK 499
           LK KLGI+
Sbjct: 483 LKAKLGIE 490


>gi|118587807|ref|ZP_01545217.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Stappia
           aggregata IAM 12614]
 gi|118439429|gb|EAV46060.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Stappia
           aggregata IAM 12614]
          Length = 493

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/499 (62%), Positives = 395/499 (79%), Gaps = 6/499 (1%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWE+VIG+EVHAQ++  +KLFSGAS  FG +PN  VS  D
Sbjct: 1   MTIVDVRTPDPKKFIKGATGDWEIVIGMEVHAQVTSEAKLFSGASTEFGKDPNDNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINEECVRQAIRTGLGLKAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ + + PD+      +E+G+ER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKILLDM-PDEQ-----VEIGVERLHLEQDAGKSLHDQHPTMSFVDLNRSGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EAKA+LTKLR+ILRYLGTCDGNM++GSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 175 KPDLRSSDEAKAYLTKLRTILRYLGTCDGNMDQGSMRADVNVSVRRPGGEFGTRCEIKNV 234

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQ+AILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PD
Sbjct: 235 NSIRFVGQAIEYEARRQVAILEDGGSIDQETRLFDAVKGETRSMRSKEEAHDYRYFPDPD 294

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE  ++F+  + + +PELPD K+ RF+ ++G++ YDA +L+++K  AD+FE++A  R
Sbjct: 295 LLPLEFTQEFVDELAQHLPELPDDKKNRFMSDYGLTAYDAEILIAEKVSADFFEEVAKGR 354

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVIN+L G LN+ GK + ++P+S  QLG ++DLI DG ISGKIAKD+F I+W 
Sbjct: 355 DAKLAANWVINELFGRLNKEGKDLSNSPVSAAQLGGIVDLIKDGVISGKIAKDLFEIVWT 414

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVEE G++QVTDL AIE +VDE+I +NP+ V +   KP L+ WFVGQVMK + 
Sbjct: 415 EGGDPAQIVEERGMKQVTDLGAIEAIVDEIIAANPDKVQQAIAKPGLLGWFVGQVMKQSQ 474

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  MLK+K+G++
Sbjct: 475 GKANPQAVSDMLKQKIGLE 493


>gi|254505081|ref|ZP_05117232.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Labrenzia alexandrii DFL-11]
 gi|222441152|gb|EEE47831.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Labrenzia alexandrii DFL-11]
          Length = 493

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/499 (62%), Positives = 396/499 (79%), Gaps = 6/499 (1%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWE+VIG+EVHAQ++  +KLFSGAS  FG +PN  VS  D
Sbjct: 1   MTIVDARTPDPKKFIKGATGDWEIVIGMEVHAQVTSDAKLFSGASTEFGQDPNNNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINEECVRQAIRTGLGLKAEINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG++ + + PD+      +E+G+ER+HLEQDAGKS+HDQ+ ++S +DLNRSGVALMEIV+
Sbjct: 121 EGEILLDM-PDEQ-----VEIGVERLHLEQDAGKSLHDQHPSMSFVDLNRSGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RS+ EAKA+LTKLR+ILRYLGTCDGNM++GSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 175 KPDLRSADEAKAYLTKLRTILRYLGTCDGNMDQGSMRADVNVSVRRPGGEFGTRCEIKNV 234

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQ+AILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PD
Sbjct: 235 NSIRFVGQAIEYEARRQMAILEDGGSIDQETRLFDSVKGETRSMRSKEEAHDYRYFPDPD 294

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE  + F+  +   +PELPD K+ RF+ +FG++ YDA VLV++K+ AD+FE++A  R
Sbjct: 295 LLPLEFTQSFVDELAADLPELPDDKKARFVKDFGLTAYDADVLVAEKASADFFEEVAKGR 354

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANW+IN+L G LN+ GK +E +P+S  QLG +IDLI  GTISGKIAKD+F I+W 
Sbjct: 355 DAKLAANWLINELFGRLNKEGKDLETSPVSAAQLGGIIDLIKAGTISGKIAKDVFEIVWT 414

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE+ G++QVTDL AIE +VDE+I +NP+ V +   KPNLV WFVGQVMK + 
Sbjct: 415 EGGDPAQIVEDRGMKQVTDLGAIEAIVDEIITANPDKVEQAKDKPNLVGWFVGQVMKASK 474

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  +LK+K+G++
Sbjct: 475 GKANPQAVNDLLKQKIGLE 493


>gi|218531237|ref|YP_002422053.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Methylobacterium
           chloromethanicum CM4]
 gi|254790956|sp|B7KTR5|GATB_METC4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|218523540|gb|ACK84125.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           chloromethanicum CM4]
          Length = 490

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/488 (65%), Positives = 385/488 (78%), Gaps = 5/488 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
           + L  G   DWEVVIG+E+HAQ++  SKLFSGAS  FG EPN  VS  DAAMPGMLP++N
Sbjct: 8   KKLIKGGLHDWEVVIGMEIHAQVTSRSKLFSGASTEFGGEPNDHVSLVDAAMPGMLPVIN 67

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V +   
Sbjct: 68  EECVAQAVRTGLGLKAQINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEVLVDLPEG 127

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
           +S     I VGIER+HLEQDAGKS+HDQ    S +DLNRSGVALMEIV++PD+RSS EA+
Sbjct: 128 ES-----ITVGIERLHLEQDAGKSLHDQDPTKSFVDLNRSGVALMEIVSRPDLRSSEEAR 182

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A++TKLR+ILRYLGTCDG+ME+GS+RADVNVSV RPGE  GTRCE+KNVNSIRF+G AIE
Sbjct: 183 AYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRFIGQAIE 242

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
            EARRQIAILEDGG I QETRL+DP K ETRS+R+KE+A DYRYF +PDLLPLE D+ ++
Sbjct: 243 TEARRQIAILEDGGKIDQETRLYDPGKGETRSMRSKEEAHDYRYFPDPDLLPLEFDQAYV 302

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
            A+   +PELPDAK+ RFI +FG+S YDA VLV++++ ADYFE +A  RD K  ANWVIN
Sbjct: 303 DALASGLPELPDAKKARFIKDFGLSAYDAGVLVAERASADYFEAVARGRDGKAAANWVIN 362

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           +L G LN+ G+SIEDTP+S  QLG ++DLI DG ISGKIAKD+F I+W +GG P+ IVE 
Sbjct: 363 ELFGRLNKEGRSIEDTPVSAEQLGTIVDLIGDGVISGKIAKDLFEIVWSEGGDPRAIVEA 422

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
            G++QVTD  AIE  VD +I +NP+ V +   KP L+ WFVGQ MK TGGKANP+ V  +
Sbjct: 423 RGMKQVTDTGAIEAAVDAIIAANPDKVEQAKAKPTLLGWFVGQTMKATGGKANPAAVNAL 482

Query: 492 LKEKLGIK 499
           LK+KLGI+
Sbjct: 483 LKDKLGIE 490


>gi|240139817|ref|YP_002964294.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Methylobacterium extorquens
           AM1]
 gi|240009791|gb|ACS41017.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Methylobacterium extorquens
           AM1]
          Length = 490

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/488 (65%), Positives = 385/488 (78%), Gaps = 5/488 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
           + L  G   DWEVVIG+E+HAQ++  SKLFSGAS  FG EPN  VS  DAAMPGMLP++N
Sbjct: 8   KKLIKGGLYDWEVVIGMEIHAQVTSRSKLFSGASTEFGGEPNDHVSLVDAAMPGMLPVIN 67

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V +   
Sbjct: 68  EECVAQAVRTGLGLKAQINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEVLVDLPEG 127

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
           +S     I VGIER+HLEQDAGKS+HDQ    S +DLNRSGVALMEIV++PD+RSS EA+
Sbjct: 128 ES-----ITVGIERLHLEQDAGKSLHDQDPTKSFVDLNRSGVALMEIVSRPDLRSSEEAR 182

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A++TKLR+ILRYLGTCDG+ME+GS+RADVNVSV RPGE  GTRCE+KNVNSIRF+G AIE
Sbjct: 183 AYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRFIGQAIE 242

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
            EARRQIAILEDGG I QETRL+DP K ETRS+R+KE+A DYRYF +PDLLPLE D+ ++
Sbjct: 243 TEARRQIAILEDGGKIDQETRLYDPGKGETRSMRSKEEAHDYRYFPDPDLLPLEFDQAYV 302

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
            A+   +PELPDAK+ RFI +FG+S YDA VLV++++ ADYFE +A  RD K  ANWVIN
Sbjct: 303 DALASGLPELPDAKKARFIKDFGLSAYDAGVLVAERASADYFEAVARGRDGKAAANWVIN 362

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           +L G LN+ G+SIEDTP+S  QLG ++DLI DG ISGKIAKD+F I+W +GG P+ IVE 
Sbjct: 363 ELFGRLNKEGRSIEDTPVSAEQLGSIVDLIGDGVISGKIAKDLFEIVWSEGGDPRAIVEA 422

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
            G++QVTD  AIE  VD +I +NP+ V +   KP L+ WFVGQ MK TGGKANP+ V  +
Sbjct: 423 RGMKQVTDTGAIEAAVDAIIAANPDKVEQAKAKPTLLGWFVGQTMKATGGKANPAAVNAL 482

Query: 492 LKEKLGIK 499
           LK+KLGI+
Sbjct: 483 LKDKLGIE 490


>gi|254562233|ref|YP_003069328.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Methylobacterium extorquens DM4]
 gi|254269511|emb|CAX25477.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Methylobacterium extorquens
           DM4]
          Length = 490

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/488 (65%), Positives = 385/488 (78%), Gaps = 5/488 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
           + L  G   DWEVVIG+E+HAQ++  SKLFSGAS  FG EPN  VS  DAAMPGMLP++N
Sbjct: 8   KKLIKGGLHDWEVVIGMEIHAQVTSRSKLFSGASTEFGGEPNDHVSLVDAAMPGMLPVIN 67

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V +   
Sbjct: 68  EECVAQAVRTGLGLKAQINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEVLVDLPEG 127

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
           +S     I VGIER+HLEQDAGKS+HDQ    S +DLNRSGVALMEIV++PD+RSS EA+
Sbjct: 128 ES-----ITVGIERLHLEQDAGKSLHDQDPTKSFVDLNRSGVALMEIVSRPDLRSSEEAR 182

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A++TKLR+ILRYLGTCDG+ME+GS+RADVNVSV RPGE  GTRCE+KNVNSIRF+G AIE
Sbjct: 183 AYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRFIGQAIE 242

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
            EARRQIAILEDGG I QETRL+DP K ETRS+R+KE+A DYRYF +PDLLPLE D+ ++
Sbjct: 243 TEARRQIAILEDGGKIDQETRLYDPGKGETRSMRSKEEAHDYRYFPDPDLLPLEFDQAYV 302

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
            A+   +PELPDAK+ RFI +FG+S YDA VLV++++ ADYFE +A  RD K  ANWVIN
Sbjct: 303 DALASGLPELPDAKKARFIKDFGLSAYDAGVLVAERASADYFEAVARGRDGKAAANWVIN 362

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           +L G LN+ G+SIEDTP+S  QLG ++DLI DG ISGKIAKD+F I+W +GG P+ IVE 
Sbjct: 363 ELFGRLNKEGRSIEDTPVSAEQLGTIVDLIGDGVISGKIAKDLFEIVWSEGGDPRAIVEA 422

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
            G++QVTD  AIE  VD +I +NP+ V +   KP L+ WFVGQ MK TGGKANP+ V  +
Sbjct: 423 RGMKQVTDTGAIETAVDAIIAANPDKVEQAKAKPTLLGWFVGQTMKATGGKANPAAVNAL 482

Query: 492 LKEKLGIK 499
           LK+KLGI+
Sbjct: 483 LKDKLGIE 490


>gi|163852481|ref|YP_001640524.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           extorquens PA1]
 gi|229486436|sp|A9VWZ8|GATB_METEP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|163664086|gb|ABY31453.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           extorquens PA1]
          Length = 490

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/488 (65%), Positives = 385/488 (78%), Gaps = 5/488 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
           + L  G   DWEVVIG+E+HAQ++  SKLFSGAS  FG EPN  VS  DAAMPGMLP++N
Sbjct: 8   KKLIKGGLHDWEVVIGMEIHAQVTSRSKLFSGASTEFGGEPNDHVSLVDAAMPGMLPVIN 67

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V +   
Sbjct: 68  EECVAQAVRTGLGLKAQINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEVLVDLPEG 127

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
           +S     + VGIER+HLEQDAGKS+HDQ    S +DLNRSGVALMEIV++PD+RSS EA+
Sbjct: 128 ES-----MTVGIERLHLEQDAGKSLHDQDPTKSFVDLNRSGVALMEIVSRPDLRSSEEAR 182

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A++TKLR+ILRYLGTCDG+ME+GS+RADVNVSV RPGE  GTRCE+KNVNSIRF+G AIE
Sbjct: 183 AYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRFIGQAIE 242

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
            EARRQIAILEDGG I QETRL+DP K ETRS+R+KE+A DYRYF +PDLLPLE D+ ++
Sbjct: 243 TEARRQIAILEDGGKIDQETRLYDPGKGETRSMRSKEEAHDYRYFPDPDLLPLEFDQAYV 302

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
            A+   +PELPDAK+ RFI +FG+S YDA VLV++++ ADYFE +A  RD K  ANWVIN
Sbjct: 303 DALASGLPELPDAKKARFIKDFGLSAYDAGVLVAERASADYFEAVARGRDGKAAANWVIN 362

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           +L G LN+ G+SIEDTP+S  QLG ++DLI DG ISGKIAKD+F I+W +GG P+ IVE 
Sbjct: 363 ELFGRLNKEGRSIEDTPVSAEQLGTIVDLIGDGVISGKIAKDLFEIVWSEGGDPRAIVEA 422

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
            G++QVTD  AIE  VD +I +NP+ V +   KP L+ WFVGQ MK TGGKANP+ V  +
Sbjct: 423 RGMKQVTDTGAIEAAVDAIIAANPDKVEQAKAKPTLLGWFVGQTMKATGGKANPAAVNAL 482

Query: 492 LKEKLGIK 499
           LK+KLGI+
Sbjct: 483 LKDKLGIE 490


>gi|188582503|ref|YP_001925948.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           populi BJ001]
 gi|229486439|sp|B1ZIK6|GATB_METPB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|179346001|gb|ACB81413.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           populi BJ001]
          Length = 490

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/488 (65%), Positives = 385/488 (78%), Gaps = 5/488 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
           + L  G   DWEVVIG+E+HAQ++  SKLFSGAS  FG EPN  VS  DAAMPGMLP++N
Sbjct: 8   KKLIKGGLHDWEVVIGMEIHAQVTSRSKLFSGASTAFGGEPNDHVSLVDAAMPGMLPVIN 67

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             C+ QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V + PD
Sbjct: 68  EECIAQAVRTGLGLKAQINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEVLVDL-PD 126

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
                 +I VGIER+HLEQDAGKS+HDQ    S +DLNRSGVALMEIV++PD+RSS EAK
Sbjct: 127 GE----SITVGIERLHLEQDAGKSLHDQDPTKSFVDLNRSGVALMEIVSRPDLRSSEEAK 182

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A++TKLR+ILRYLGTCDG+ME+GS+RADVNVSV RPGE  GTRCE+KNVNSIRF+G AIE
Sbjct: 183 AYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRFIGQAIE 242

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
            EARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PDLLPLE D+ ++
Sbjct: 243 TEARRQIAILEDGGKIDQETRLFDPGKGETRSMRSKEEAHDYRYFPDPDLLPLEFDQAYV 302

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
             +   +PELPDAK+ RFI +FG+S YDA VLV++++ ADYFE +A  RD K  ANWVIN
Sbjct: 303 DGLASGLPELPDAKKARFIKDFGLSAYDAGVLVAERASADYFEAVARGRDGKAAANWVIN 362

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           +L G LN+ G+SIEDTP+S  QLG ++DLI +G ISGKIAKD+F I+W +GG P+ IVE 
Sbjct: 363 ELFGRLNKEGRSIEDTPVSAEQLGTIVDLIGEGVISGKIAKDLFEIVWSEGGDPRAIVES 422

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
            G++QVTD  AIE  VD +I +NP+ V +   KP L+ WFVGQ MK TGGKANP+ V  +
Sbjct: 423 RGMKQVTDTGAIEAAVDAIIAANPDKVEQAKAKPTLLGWFVGQTMKATGGKANPAAVNAL 482

Query: 492 LKEKLGIK 499
           LK+KLGI+
Sbjct: 483 LKDKLGIE 490


>gi|300022174|ref|YP_003754785.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299523995|gb|ADJ22464.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 493

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/490 (63%), Positives = 392/490 (80%), Gaps = 6/490 (1%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           ++  +L +G TGDWEV+IG+EVHAQ++  +KLFSGAS  FGAEPN+ VS  DAAMPGMLP
Sbjct: 10  SKPNNLIAGATGDWEVIIGMEVHAQVASNAKLFSGASTAFGAEPNSHVSLVDAAMPGMLP 69

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           ++N  CV QA+ TGLG+ A IN  SVF RKNYFYPDLPQGYQISQ+ +P+VGEG+V +  
Sbjct: 70  VINKECVAQAIRTGLGIKAEINLKSVFDRKNYFYPDLPQGYQISQYKQPVVGEGEVEI-- 127

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
             D  G+  T+++GIER+HLEQDAGKS+HDQ+   S +DLNRSGVALMEIV+KPD+RSS 
Sbjct: 128 --DADGE--TLKIGIERLHLEQDAGKSLHDQHPDYSYVDLNRSGVALMEIVSKPDLRSSK 183

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           +A+A++TKLR+ILRYLGTCDG+ME+G++RADVNVSV +PG+  GTRCE+KNVNSIRF+G 
Sbjct: 184 QAQAYVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRKPGDELGTRCEIKNVNSIRFIGQ 243

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AIE EARRQI I+EDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PDLLPLE+ +
Sbjct: 244 AIEVEARRQIDIIEDGGKIDQETRLFDSVKGETRSMRSKEEAHDYRYFPDPDLLPLELTQ 303

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANW 368
           D++  +K ++PELPD KR RFI  FG+S YDA VLV+++S ADYFE +A  RD K+ ANW
Sbjct: 304 DYVDDLKSKLPELPDEKRARFIKSFGLSAYDADVLVAERSSADYFESVANGRDGKLAANW 363

Query: 369 VINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEI 428
           VIN+L G LN+ GK IE  P+S  QLG ++DLI    ISGKIAKD+F I+W +GG P EI
Sbjct: 364 VINELFGRLNKEGKDIETCPVSAQQLGAIVDLIASNAISGKIAKDLFEIVWTEGGDPAEI 423

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIV 488
           VE+ G++QVTD  AIEK VD +I SNP+ V +   KP+++ WFVGQVMK TGGKANP+ V
Sbjct: 424 VEKRGMKQVTDTGAIEKAVDAIIASNPDKVEQAKAKPSMLGWFVGQVMKATGGKANPAAV 483

Query: 489 QKMLKEKLGI 498
             +LK KLGI
Sbjct: 484 NDILKAKLGI 493


>gi|170746915|ref|YP_001753175.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|229486440|sp|B1LUB2|GATB_METRJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|170653437|gb|ACB22492.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 490

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/488 (65%), Positives = 386/488 (79%), Gaps = 5/488 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
           + L  G   DWEV++G+E+HAQ+S  +KLFSGAS  FGAEPN  VS  DAAMPGMLP++N
Sbjct: 8   KKLIKGGLHDWEVIVGMEIHAQVSSRAKLFSGASTEFGAEPNDHVSLVDAAMPGMLPVIN 67

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V +   
Sbjct: 68  AECVAQAVRTGLGLKAKINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEVLVDLADG 127

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
            S     I VGIER+HLEQDAGKS+HDQ    S +DLNRSGVALMEIV++PD+RSS EAK
Sbjct: 128 AS-----ITVGIERLHLEQDAGKSLHDQDPTRSFVDLNRSGVALMEIVSRPDLRSSEEAK 182

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A++TKLR+ILRYLGTCDG+ME+GS+RADVNVSV RPGE  GTRCE+KNVNSIRF+G AIE
Sbjct: 183 AYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRFIGQAIE 242

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
            EARRQIAILEDGG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLPLE D+ ++
Sbjct: 243 TEARRQIAILEDGGTIDQETRLFDPTKGETRSMRSKEEAHDYRYFPDPDLLPLEFDQAYV 302

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
            A+ + +PELPDAK+ RF+  FG+S YDA VLV++++ ADY+E +A  RD K  ANWVIN
Sbjct: 303 DALAEGLPELPDAKKARFVSAFGLSPYDAGVLVAERASADYYEAVAKGRDGKAAANWVIN 362

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           +L G LN+ G SIE TP+S +QLG +IDLI +G ISGKIAKD+F I+W +GG P+ +VE 
Sbjct: 363 ELFGRLNKEGLSIEATPVSADQLGTIIDLIGEGVISGKIAKDLFEIVWTEGGDPRVVVES 422

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
            G++QVTD  AIE  VD++I +NP+ VA+   KP L+ WFVGQ MK TGGKANP+ V  +
Sbjct: 423 RGMKQVTDTGAIEAAVDQIIAANPDKVAQAKEKPTLLGWFVGQTMKATGGKANPAAVNAL 482

Query: 492 LKEKLGIK 499
           LK KLGI+
Sbjct: 483 LKAKLGIE 490


>gi|298291520|ref|YP_003693459.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Starkeya novella
           DSM 506]
 gi|296928031|gb|ADH88840.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Starkeya novella
           DSM 506]
          Length = 492

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/498 (63%), Positives = 389/498 (78%), Gaps = 6/498 (1%)

Query: 2   VSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDA 61
           +++    A  + L  G TGDWEVVIG+E+HAQ++  SKLFSGAS  FG EPN+ VS  DA
Sbjct: 1   MNMHARPADPKKLIKGATGDWEVVIGMEIHAQVTSNSKLFSGASTAFGGEPNSHVSLVDA 60

Query: 62  AMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGE 121
           AMPGMLP++N  CV+QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGE
Sbjct: 61  AMPGMLPVINEECVKQAVRTGLGLKAQINNRSVFDRKNYFYPDLPQGYQISQYKSPIVGE 120

Query: 122 GKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTK 181
           G V V +   +      IEVGIER+HLEQDAGKSIHD +   S +DLNRSGVALMEIV+K
Sbjct: 121 GVVLVDMSEGR------IEVGIERLHLEQDAGKSIHDLHPTQSLVDLNRSGVALMEIVSK 174

Query: 182 PDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVN 241
           PD+RSS EAKAF+TKLR+ILRYLGTCDG+ME+G++RADVNVSV +PG+ +GTRCE+KNVN
Sbjct: 175 PDLRSSEEAKAFVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRKPGDDFGTRCEIKNVN 234

Query: 242 SIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDL 301
           SIRF+G AIE EARRQI I+EDGG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDL
Sbjct: 235 SIRFIGQAIETEARRQIGIIEDGGTIDQETRLFDPNKGETRSMRSKEEAHDYRYFPDPDL 294

Query: 302 LPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRD 361
           LPLE D+ F+  +   +PELPD K+ RF+  +G+S YDA VLV++K  ADY+E +A  RD
Sbjct: 295 LPLEFDDAFVTELAAHLPELPDEKKARFVSAYGLSAYDADVLVAEKDTADYYEAVAKGRD 354

Query: 362 KKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK 421
            K  AN+VIN+L G LN+ GK I  +P+S  Q+G ++DLI DGTISGKIAKD+F+I + +
Sbjct: 355 AKAAANFVINELFGRLNKEGKDIASSPVSAAQIGAIVDLIADGTISGKIAKDLFDICFTE 414

Query: 422 GGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGG 481
           GG P+EIVE  G++QVTD  AIE  VD +I +NP+ V ++  KP ++ WFVGQVMK TGG
Sbjct: 415 GGEPREIVEARGMKQVTDTGAIEAAVDAIIAANPDKVEQVKAKPTMLGWFVGQVMKQTGG 474

Query: 482 KANPSIVQKMLKEKLGIK 499
           KANP  V ++LK KLGI+
Sbjct: 475 KANPQAVNELLKGKLGIE 492


>gi|328544225|ref|YP_004304334.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [polymorphum gilvum SL003B-26A1]
 gi|326413967|gb|ADZ71030.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Polymorphum gilvum SL003B-26A1]
          Length = 493

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/488 (64%), Positives = 387/488 (79%), Gaps = 6/488 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
           +    G TGDWEVVIG+EVHAQ++  +KLFSGAS  FG +PN  VSF DAAMPGMLP++N
Sbjct: 12  KKFIKGATGDWEVVIGMEVHAQVTSEAKLFSGASTEFGKDPNANVSFVDAAMPGMLPVIN 71

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ  +PIVGEG + + + PD
Sbjct: 72  EECVRQAIRTGLGLKARINLKSVFDRKNYFYPDLPQGYQISQFKQPIVGEGTIVLDM-PD 130

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
           +      +E+G+ER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+KPD+RSS EAK
Sbjct: 131 ER-----VEIGVERLHLEQDAGKSLHDQHPTMSFVDLNRSGVALMEIVSKPDLRSSDEAK 185

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A+LTKLR+ILRYLGTCDGNM++GSMRADVNVSV RPGE +GTRCE+KNVNSIRF+G AIE
Sbjct: 186 AYLTKLRTILRYLGTCDGNMDQGSMRADVNVSVRRPGEPFGTRCEIKNVNSIRFVGQAIE 245

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
           YEARRQI ILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PDLLPLE  + ++
Sbjct: 246 YEARRQIGILEDGGTIDQETRLFDAVKGETRSMRSKEEAHDYRYFPDPDLLPLEFTQAYV 305

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
             +   +PELPD K+ RF+ ++G++ YDA VLV++K  AD+FE++A  RD K+ ANWVIN
Sbjct: 306 DDLAAHLPELPDDKKGRFVADYGLTAYDADVLVAEKVSADFFEQVAQGRDAKVAANWVIN 365

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           +L G LN+ G  +  +P+S  QLG +IDLI  GTISGKIAKD+F I+W +GG P  IVE 
Sbjct: 366 ELFGRLNKEGLDVSTSPVSAAQLGAIIDLIRAGTISGKIAKDLFEIVWSEGGDPAAIVEA 425

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
            G++QVTDL AIEKVVDE+I +NP+ VA+   KP L+ WFVGQVMK + GKANP  V  +
Sbjct: 426 RGMKQVTDLGAIEKVVDEIIAANPDKVAQAKEKPTLLGWFVGQVMKASQGKANPQAVNDL 485

Query: 492 LKEKLGIK 499
           LK K+GI+
Sbjct: 486 LKAKIGIE 493


>gi|307946463|ref|ZP_07661798.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Roseibium sp. TrichSKD4]
 gi|307770127|gb|EFO29353.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Roseibium sp. TrichSKD4]
          Length = 505

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/499 (61%), Positives = 393/499 (78%), Gaps = 6/499 (1%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  ++      +    G TGDWE+VIG+EVHAQ++  +KLFSGAS  FG +PN  VS  D
Sbjct: 13  MTLVEARTPDPKKFIKGATGDWEIVIGMEVHAQVTSEAKLFSGASTEFGKDPNDNVSLVD 72

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLG+ A IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 73  AAMPGMLPVINEECVRQAIRTGLGMKAEINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 132

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG + + +   +      +E+G+ER+HLEQDAGKS+HDQ+ ++S +DLNRSGVALMEIV+
Sbjct: 133 EGIILLDMEEGR------VEIGVERLHLEQDAGKSLHDQHPSMSFVDLNRSGVALMEIVS 186

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EAKA+LTKLR+ILRYLGTCDGNM++GSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 187 KPDLRSSDEAKAYLTKLRTILRYLGTCDGNMDQGSMRADVNVSVRRPGEGFGTRCEIKNV 246

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQ++ILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PD
Sbjct: 247 NSIRFVGQAIEYEARRQVSILEDGGSIDQETRLFDAVKGETRSMRSKEEAHDYRYFPDPD 306

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE  + ++  + + +PELPD K+ RF+ ++G++ YDA VL+ +K  AD+FE++A  R
Sbjct: 307 LLPLEFSQAYVDELAQHLPELPDDKKARFVKDYGLTEYDADVLIIEKVSADFFEEVAKGR 366

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVIN+L G LN+ GK +E +P+S  QLG +IDLI  GTISGKIAKD+F I+W 
Sbjct: 367 DAKLAANWVINELFGRLNKEGKDVETSPMSAAQLGAIIDLIKAGTISGKIAKDLFEIVWT 426

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE+ G++QVTDL AIE +VDE++ +NP+ V +   KPNLV WFVGQVMK + 
Sbjct: 427 EGGDPAQIVEDRGMKQVTDLGAIEAIVDEIMAANPDKVQQAKEKPNLVGWFVGQVMKASK 486

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  +LK+K+G++
Sbjct: 487 GKANPQAVNDLLKQKIGVE 505


>gi|209884934|ref|YP_002288791.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Oligotropha carboxidovorans
           OM5]
 gi|229486425|sp|B6JFW6|GATB_OLICO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|209873130|gb|ACI92926.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Oligotropha carboxidovorans
           OM5]
          Length = 494

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/492 (64%), Positives = 389/492 (79%), Gaps = 10/492 (2%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
           + L  G TGDWEVVIG+E+HAQ++  +KLFSGA+  FG  PN  VS  DAAMPGMLP++N
Sbjct: 8   KKLIKGATGDWEVVIGLEIHAQVTSNAKLFSGAATAFGGAPNEHVSLVDAAMPGMLPVIN 67

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QA+ TGLGL A IN  S F RKNYFYPDLPQGYQISQ+ +PIVGEG V V IG  
Sbjct: 68  AECVAQAIRTGLGLKAQINLKSTFDRKNYFYPDLPQGYQISQYKQPIVGEGVVIVDIGDG 127

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
           +S     IEVGIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+KPDMRS+ EAK
Sbjct: 128 ES-----IEVGIERLHLEQDAGKSLHDQHPTMSFVDLNRSGVALMEIVSKPDMRSADEAK 182

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A++TKLR+ILRYLGTCDG+ME+G++RADVNVSV  PGE +GTRCE+KNVNSIRF+G AI+
Sbjct: 183 AYVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRHPGEPFGTRCEIKNVNSIRFIGQAID 242

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
           YEARRQI ILEDGG I QETRL+DP+K ETRS+R+KE+A DYRYF +PDLLPLE    ++
Sbjct: 243 YEARRQIGILEDGGTIDQETRLYDPNKGETRSMRSKEEAHDYRYFPDPDLLPLEFTAGYV 302

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLA-VNRDKKIVA 366
             +K ++PELPD KR RFI +FG++ YDA VLVS++  AD++E    KLA   RD K  A
Sbjct: 303 EELKAKLPELPDEKRARFIADFGLTPYDAGVLVSERESADFYEAVLAKLADGTRDGKQAA 362

Query: 367 NWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK 426
           NWVIN+L G LN+ G +I+ +P+S +QL  ++DLI +GTISGKI KD+F I+W KGG PK
Sbjct: 363 NWVINELFGRLNKEGVAIDASPVSADQLAAIVDLIGEGTISGKIGKDLFEIVWTKGGDPK 422

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPS 486
            +VE LGL+QVTDL AIEK+VD+++ +NP+ VA+   KP L+ WFVGQVMK +GGK NP 
Sbjct: 423 ALVESLGLKQVTDLGAIEKMVDDIVAANPDKVAQARAKPQLIGWFVGQVMKLSGGKVNPQ 482

Query: 487 IVQKMLKEKLGI 498
            V  +LK KLGI
Sbjct: 483 AVNDLLKSKLGI 494


>gi|299135126|ref|ZP_07028317.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Afipia sp. 1NLS2]
 gi|298590103|gb|EFI50307.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Afipia sp. 1NLS2]
          Length = 494

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/490 (64%), Positives = 381/490 (77%), Gaps = 10/490 (2%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           L  G TGDWEVVIG+EVHAQ++  SKLFSGAS  FG  PN  VS  DAAMPGMLP++N  
Sbjct: 10  LIKGVTGDWEVVIGLEVHAQVTSNSKLFSGASTEFGGAPNEHVSLVDAAMPGMLPVINEE 69

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV QA+ TGLGL A IN  S F RKNYFYPDLPQGYQISQ+  PI+GEG V +   PD S
Sbjct: 70  CVAQAIRTGLGLKAQINLKSTFDRKNYFYPDLPQGYQISQYKSPIIGEGTVLIDT-PDGS 128

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
               T  VGIER+HLEQDAGK +HDQ+ A+S +DLNRSGVALMEIV+KPDMRSS EAKA+
Sbjct: 129 ----TASVGIERLHLEQDAGKLLHDQHPAMSYVDLNRSGVALMEIVSKPDMRSSEEAKAY 184

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYE 253
           + KLRSILRYLGTCDG+ME+G++RADVNVSV RPGE +GTRCE+KNVNSIRF+G AIE+E
Sbjct: 185 VAKLRSILRYLGTCDGDMEKGNLRADVNVSVRRPGEPFGTRCEIKNVNSIRFIGQAIEFE 244

Query: 254 ARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRA 313
           ARRQI I+EDGG I QETRL+DP+K ETRS+R+KE+A DYRYF +PDLLPLE    ++  
Sbjct: 245 ARRQIEIIEDGGTIEQETRLYDPNKGETRSMRSKEEAHDYRYFPDPDLLPLEFTAAYVEE 304

Query: 314 IKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-----VNRDKKIVANW 368
           +K  +PELPD KR RFI  FG++ YDA VLV+++  AD++E +        RD K+ ANW
Sbjct: 305 LKSHLPELPDEKRTRFIESFGLTPYDAGVLVAERESADFYEAVLAGLGNAGRDGKLAANW 364

Query: 369 VINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEI 428
           VIN+L G LN+ G+ I  +P+S  QL  ++DLI +GTISGKIAKD+F I+W KGG PK +
Sbjct: 365 VINELFGRLNKEGQEIAASPVSTAQLAAIVDLIGEGTISGKIAKDLFEIVWTKGGDPKAL 424

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIV 488
           VE LGL+QVTDL AIEKVVDE+I +NP+ V +   KP L+ WFVGQVMK++GGK NP  V
Sbjct: 425 VESLGLKQVTDLGAIEKVVDEIIAANPDKVEQARAKPQLIGWFVGQVMKSSGGKVNPQAV 484

Query: 489 QKMLKEKLGI 498
             +LK KLGI
Sbjct: 485 NDLLKSKLGI 494


>gi|85716415|ref|ZP_01047387.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrobacter sp.
           Nb-311A]
 gi|85696772|gb|EAQ34658.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrobacter sp.
           Nb-311A]
          Length = 494

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/494 (62%), Positives = 392/494 (79%), Gaps = 10/494 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +  +L  G TGDWE+VIGIEVHAQ++  +KLFSGAS  FG  PN+ VSF DAAMPGMLP+
Sbjct: 6   KPSNLIKGATGDWEMVIGIEVHAQVTSNAKLFSGASTAFGGNPNSHVSFVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +NG CV+QAV TGLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V + 
Sbjct: 66  INGECVRQAVRTGLGLNARINLRSVFDRKNYFYPDLPQGYQISQYQSPIVGEGEVVVDLA 125

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
              S       VGIER+HLEQDAGKS+HDQ++ +S IDLNRSGVALMEIV+KPD+RSS +
Sbjct: 126 DGTS-----FTVGIERLHLEQDAGKSLHDQHADMSAIDLNRSGVALMEIVSKPDLRSSEQ 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA++TKLR+ILRYLGTCDG+ME+G++RADVNVSV RPGE +GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRRPGEPFGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IE+EARRQI ILEDG  I QETRLFDP K ETR++R+KE+A DYRYF +PDLLPLE  + 
Sbjct: 241 IEHEARRQIGILEDGDSIDQETRLFDPDKGETRAMRSKEEAHDYRYFPDPDLLPLEFSQS 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-----VNRDKKI 364
           F+ A++  +PELPD K+ RFI + G++ YDA+VLVS+   A+++E +        RD K+
Sbjct: 301 FVEALRADLPELPDQKKARFIADLGLTPYDAAVLVSEHECANFYESVLGGLADARRDGKV 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN+ G SI  +P+S +QL  +IDLI +GTISGKIAKD+F I+W +GG 
Sbjct: 361 AANWVINELFGRLNKEGLSIAASPVSASQLAAIIDLIGEGTISGKIAKDLFEIVWTEGGD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P+ +V+E G++QVTD+ AIEK+V +++++NP+ VA++  KP ++ WFVGQVMK +GGK N
Sbjct: 421 PRVLVDERGMKQVTDMGAIEKLVADIVDANPDKVAQVRAKPQMIGWFVGQVMKASGGKVN 480

Query: 485 PSIVQKMLKEKLGI 498
           P  V  +LK KLG+
Sbjct: 481 PQAVNDLLKTKLGL 494


>gi|92117794|ref|YP_577523.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrobacter
           hamburgensis X14]
 gi|122417652|sp|Q1QL34|GATB_NITHX RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|91800688|gb|ABE63063.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Nitrobacter hamburgensis X14]
          Length = 494

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/494 (62%), Positives = 389/494 (78%), Gaps = 10/494 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +  +L  G TGDWE+VIG+EVHAQ++  +KLFSGAS  FG EPN+ VS  DAAMPGMLP+
Sbjct: 6   KPSNLIKGATGDWEMVIGLEVHAQVTSNAKLFSGASTAFGGEPNSHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QAV TGLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG++ V + 
Sbjct: 66  INEECVRQAVRTGLGLNAQINLRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGEIVVDLA 125

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
              S     I VGIER+HLEQDAGKS+HDQ++ +S IDLNRSGVALMEIV+KPD+RSS +
Sbjct: 126 DGAS-----IAVGIERLHLEQDAGKSLHDQHADMSAIDLNRSGVALMEIVSKPDLRSSEQ 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA++TKLR+ILRYLGTCDG+ME+GS+RADVNVSV RPG A GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGAALGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IE+EARRQI ILEDGG I QETRLFDP K ETR++R+KE+A DYRYF +PDLLPLE  + 
Sbjct: 241 IEHEARRQIGILEDGGSIDQETRLFDPDKGETRAMRSKEEAHDYRYFPDPDLLPLEFSQG 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-----RDKKI 364
           F+ A+K  +PELPD K+ RFIG+FG++ YDA+VLV +   A+++E +        RD K+
Sbjct: 301 FVEALKADLPELPDQKKTRFIGDFGLTPYDAAVLVGEHESANFYEAVLAGLANGRRDGKL 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN+  + I  +P+S +QL  ++DLI + TISGKIAKD+F I+W +GG 
Sbjct: 361 AANWVINELFGRLNKESRGIAASPVSASQLAAIVDLIGEETISGKIAKDLFEIVWTEGGD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P+ +VE  G++QVTD+ AIEK VD+++ +NP+  A++  KP ++ WFVGQVMK +GGKAN
Sbjct: 421 PRTLVEARGMKQVTDMGAIEKAVDDIVAANPDKAAQVRAKPQMIGWFVGQVMKASGGKAN 480

Query: 485 PSIVQKMLKEKLGI 498
           P  V  +LK KLG+
Sbjct: 481 PQAVNDLLKTKLGL 494


>gi|75676187|ref|YP_318608.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrobacter
           winogradskyi Nb-255]
 gi|109892041|sp|Q3SR35|GATB_NITWN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|74421057|gb|ABA05256.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Nitrobacter winogradskyi Nb-255]
          Length = 494

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/494 (62%), Positives = 390/494 (78%), Gaps = 10/494 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +   L  G TG+WE+VIGIEVHAQ++  +KLFSGAS  FG +PN+ VS  DAAMPGMLP+
Sbjct: 6   KPSHLIKGATGEWEMVIGIEVHAQVTSNAKLFSGASTAFGGDPNSHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QAV TGLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V + 
Sbjct: 66  INEECVRQAVRTGLGLNARINLRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGEVVVDLA 125

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
              S       VGIER+HLEQDAGKS+HDQ++ +S IDLNRSGVALMEIV++PDMRSS +
Sbjct: 126 DGTS-----FVVGIERLHLEQDAGKSLHDQHADMSAIDLNRSGVALMEIVSRPDMRSSEQ 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           A+A++TKLR+ILRYLGTCDG+ME+G++RADVNVSV RPGE +GTRCE+KNVNSIRF+G A
Sbjct: 181 ARAYVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRRPGEPFGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IEYEARRQI ILEDGG I QETRLFDP K ETR++R+KE+A DYRYF +PDLLPLE  + 
Sbjct: 241 IEYEARRQIGILEDGGGIDQETRLFDPDKGETRAMRSKEEAHDYRYFPDPDLLPLEFSQG 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-----RDKKI 364
            + A+K  +PELPD K+ RF+ + G++ YDA+VLVS+   A+++E +  +     RD K 
Sbjct: 301 LVDALKADLPELPDQKKARFVTDLGLTSYDAAVLVSEHESANFYESVLADLADARRDGKA 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN+ G SIE +P+S +QL  +IDLI +GTISGKIAKD+F I+W +GG 
Sbjct: 361 AANWVINELFGRLNKQGLSIEASPVSASQLAAIIDLIGEGTISGKIAKDLFEIVWSEGGD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P+ +VE  G++QVTD+ AIEKVVD+++ +NP+ VA++  KP ++ WFVGQVMK +GGK N
Sbjct: 421 PRALVEARGMKQVTDVGAIEKVVDDIVAANPDKVAQVRAKPQMIGWFVGQVMKASGGKVN 480

Query: 485 PSIVQKMLKEKLGI 498
           P  V  +LK KLG+
Sbjct: 481 PQAVNDLLKAKLGL 494


>gi|304391694|ref|ZP_07373636.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ahrensia sp. R2A130]
 gi|303295923|gb|EFL90281.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ahrensia sp. R2A130]
          Length = 500

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/494 (63%), Positives = 388/494 (78%), Gaps = 1/494 (0%)

Query: 4   LDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAM 63
           +DT          G    WE+VIG+EVHAQ++  +KLFSG+S  FGAE N+ VS  DAAM
Sbjct: 7   VDTRTPNEAHFFPGEDHPWELVIGLEVHAQVTSEAKLFSGSSTGFGAEQNSHVSLVDAAM 66

Query: 64  PGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGK 123
           PGMLP++N  CV+QAV TGLGLNA INK S F RKNYFYPDLPQGYQISQ   PIVGEG 
Sbjct: 67  PGMLPVINEHCVRQAVKTGLGLNAQINKKSAFDRKNYFYPDLPQGYQISQLYHPIVGEGV 126

Query: 124 VSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPD 183
           V V +GPDK G F ++E+G+ER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+KPD
Sbjct: 127 VQVQVGPDKKGDFESVEIGVERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVSKPD 186

Query: 184 MRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSI 243
           +RS  EAKA++TKLRSILRYLGTCDGNM++GSMRADVNVSV +PG  +GTRCE+KNVNSI
Sbjct: 187 IRSIDEAKAYVTKLRSILRYLGTCDGNMDQGSMRADVNVSVRKPGGEFGTRCEIKNVNSI 246

Query: 244 RFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLP 303
           RF+G AI+YEARRQI ILE+GG I QETRLFDP K ETRS+R+KE+A DYRYF +PDLLP
Sbjct: 247 RFMGQAIDYEARRQIDILEEGGKIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPDLLP 306

Query: 304 LEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKK 363
           LE D+ ++  I+ ++PELPD KR RF    G+S YDAS+LV+DK++ DY+E++A  RD K
Sbjct: 307 LEFDDAYVETIRAELPELPDEKRARFQAN-GLSEYDASILVADKAVGDYYEQVAEGRDAK 365

Query: 364 IVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG 423
           + ANW INDLLG LN++G  + D+P+S  QLG +IDLI   TISGKIAKD+F I+W +GG
Sbjct: 366 LAANWTINDLLGALNKAGTDLADSPVSAAQLGGIIDLIKADTISGKIAKDVFEIIWNEGG 425

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKA 483
            P +IVE+ G+ QVTD  AIE  VDE+I +NP  VA+   KP ++ WFVGQVMK TGGKA
Sbjct: 426 DPAKIVEDRGMAQVTDTGAIEAAVDEIIAANPEKVAQAKEKPAMLGWFVGQVMKATGGKA 485

Query: 484 NPSIVQKMLKEKLG 497
           NP  V  +L+ K+G
Sbjct: 486 NPKAVNDLLRAKIG 499


>gi|316933663|ref|YP_004108645.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Rhodopseudomonas
           palustris DX-1]
 gi|315601377|gb|ADU43912.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Rhodopseudomonas
           palustris DX-1]
          Length = 494

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/490 (63%), Positives = 394/490 (80%), Gaps = 10/490 (2%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           L  G TGDWEVVIG+E+HAQ+S  +KLFSGA+  FG E N+ VS  DAAMPGMLP++N  
Sbjct: 10  LIKGATGDWEVVIGLEIHAQVSSHAKLFSGAATAFGGEQNSHVSLVDAAMPGMLPVINEE 69

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QA+ +GLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V + PD  
Sbjct: 70  CVRQAIRSGLGLNAKINLRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGEVVVDL-PDGD 128

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
               +I VGIER+HLEQDAGK +HDQ+   + +DLNRSGVALMEIV+KPD+RSS +AKA+
Sbjct: 129 ----SITVGIERLHLEQDAGKLLHDQHPTSTFVDLNRSGVALMEIVSKPDIRSSEQAKAY 184

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYE 253
           ++KLR+ILRYLGTCDG+ME+GS+RADVNVSV RPGE +GTRCE+KNVNSIRF+G AIEYE
Sbjct: 185 VSKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGEPYGTRCEIKNVNSIRFIGQAIEYE 244

Query: 254 ARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRA 313
           ARRQI ILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PDLLPLE  + ++  
Sbjct: 245 ARRQIGILEDGGTIDQETRLFDANKGETRSMRSKEEAHDYRYFPDPDLLPLEFSQAYVDE 304

Query: 314 IKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-----RDKKIVANW 368
           +K  +PELPDAK+ RFI +FG+S  DA VLVS++  A+++E +        RD K+ ANW
Sbjct: 305 LKSGLPELPDAKKARFIRDFGLSAEDAGVLVSERESAEFYEAVLERLGDQARDGKLAANW 364

Query: 369 VINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEI 428
           VIN+L G LN+ G+SIE +P+S  QL  +++LI +GTISGKIAK++F I+W +GG P+ +
Sbjct: 365 VINELFGRLNKDGQSIESSPVSAAQLAAIVELIGEGTISGKIAKELFEIVWTEGGDPRTL 424

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIV 488
           VE+ G++QVTDLSAIEKVVD+++ +NP+ VA++A KP ++ WFVGQVMK++GGKANP  V
Sbjct: 425 VEQRGMKQVTDLSAIEKVVDDIVAANPDKVAQVAAKPAMLGWFVGQVMKSSGGKANPQAV 484

Query: 489 QKMLKEKLGI 498
             +LK KLG+
Sbjct: 485 NDLLKRKLGL 494


>gi|91977482|ref|YP_570141.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodopseudomonas
           palustris BisB5]
 gi|123762648|sp|Q135J9|GATB_RHOPS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|91683938|gb|ABE40240.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodopseudomonas palustris BisB5]
          Length = 494

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/494 (62%), Positives = 393/494 (79%), Gaps = 10/494 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +   L  G TGDWEVVIG+E+HAQ+S  +KLFSGA+  FG +PN+ VS  DAAMPGMLP+
Sbjct: 6   KPSQLIKGATGDWEVVIGLEIHAQVSSNAKLFSGAATAFGGDPNSHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QA+ +GLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG V V + 
Sbjct: 66  INEECVKQAIRSGLGLNAQINLRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGIVVVDL- 124

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
           P+      +I VGIER+HLEQDAGK +HDQ+  ++ +DLNRSGVALMEIV+KPD+RSS +
Sbjct: 125 PNGD----SITVGIERLHLEQDAGKLLHDQHPTMTFVDLNRSGVALMEIVSKPDLRSSEQ 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA+++KLR+ILRYLGTCDG+ME+GS+RADVNVSV +PGE +GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVSKLRTILRYLGTCDGDMEKGSLRADVNVSVRKPGEPYGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IEYEARRQI ILEDGG I QETRL+DP K ETRS+R+KE+A DYRYF +PDLLPLE  + 
Sbjct: 241 IEYEARRQIGILEDGGSIDQETRLYDPDKAETRSMRSKEEAHDYRYFPDPDLLPLEFSQA 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-----RDKKI 364
           ++  +K  +PELPD K+ RFIG FG+S  DA VLVS++  AD++E +        RD K+
Sbjct: 301 YVDELKTGLPELPDQKKSRFIGTFGLSSDDAGVLVSERESADFYEAVLAKLSDAARDGKL 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN+ G++I+ +P+S  QL  ++DLI +GTISGKIAK++F I+W +GG 
Sbjct: 361 AANWVINELFGRLNKDGQNIDTSPVSAAQLAAIVDLIGEGTISGKIAKELFEIVWREGGD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P+E+VE  G++QVTDL+AIEKVVD+++ SNP+ VA+   KP ++ WFVGQVMK++GGKAN
Sbjct: 421 PRELVEARGMKQVTDLTAIEKVVDDIVASNPDKVAQAIAKPAMLGWFVGQVMKSSGGKAN 480

Query: 485 PSIVQKMLKEKLGI 498
           P  V  +LK KLG+
Sbjct: 481 PQAVNDLLKRKLGL 494


>gi|90423772|ref|YP_532142.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodopseudomonas
           palustris BisB18]
 gi|109892057|sp|Q215W3|GATB_RHOPB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|90105786|gb|ABD87823.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodopseudomonas palustris BisB18]
          Length = 494

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/494 (63%), Positives = 388/494 (78%), Gaps = 10/494 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +   L  G TGDWE+VIG+EVHAQ+S  SKLFSGAS  FG +PN  VS  DAAMPGMLP+
Sbjct: 6   KPSKLIKGATGDWEIVIGLEVHAQVSSKSKLFSGASTEFGGDPNAHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QAV +GLGLNA IN  S F RKNYFYPDLPQGYQISQ   PIVGEG+V V + 
Sbjct: 66  INEECVKQAVRSGLGLNAQINLRSTFDRKNYFYPDLPQGYQISQFKSPIVGEGEVQVDVA 125

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
            D  G    + VGIER+HLEQDAGK +HDQ   +S +DLNRSGVALMEIV+KPD+RS+ +
Sbjct: 126 -DGDG----VTVGIERLHLEQDAGKLLHDQNPTMSLVDLNRSGVALMEIVSKPDIRSADQ 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA++TKLR+ILRYLGTCDG+ME+GS+RADVNVSV +PG   GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRKPGAPLGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           I+YEARRQI ILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PDLLPL+ D+ 
Sbjct: 241 IDYEARRQIGILEDGGSIDQETRLFDAGKGETRSMRSKEEAHDYRYFPDPDLLPLQFDQA 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLA-VNRDKKI 364
           F+ A+K ++PELPDAK+ RFI +FG+S  DA VLVS++  A+++E    KLA   RD K+
Sbjct: 301 FVDALKAELPELPDAKKARFIADFGLSADDAGVLVSERESAEFYETVLSKLADAGRDGKL 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN+ G +IE +P+S  QL  ++DLI + TISGKIAK++F I+W++GG 
Sbjct: 361 AANWVINELFGRLNKEGVAIEASPVSTAQLAAIVDLIGEATISGKIAKELFEIVWQEGGD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P+  VE  G+RQVTD  AIEKVVD+++N+NP+ VA+   KP L+ WFVGQVMK++GGKAN
Sbjct: 421 PRATVEARGMRQVTDTGAIEKVVDDIVNANPDKVAQAQAKPALIGWFVGQVMKSSGGKAN 480

Query: 485 PSIVQKMLKEKLGI 498
           P  V  +LK KLG+
Sbjct: 481 PQTVNDLLKSKLGL 494


>gi|323136216|ref|ZP_08071298.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylocystis sp.
           ATCC 49242]
 gi|322398290|gb|EFY00810.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylocystis sp.
           ATCC 49242]
          Length = 490

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/485 (63%), Positives = 376/485 (77%), Gaps = 5/485 (1%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           L  G TGDWEVVIG+E+HAQ++  +KLFSGAS  +G  PN  VS  DAAMPGMLP++N  
Sbjct: 11  LIKGATGDWEVVIGMEIHAQVTSKAKLFSGASAEYGGAPNDHVSLVDAAMPGMLPVINEE 70

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QA+ TGLGL A IN  S+F RKNYFYPDLPQGYQISQ+  PIVGEG V V + P + 
Sbjct: 71  CVKQAIRTGLGLEAQINLRSIFDRKNYFYPDLPQGYQISQYKYPIVGEGAVIVDVSPTER 130

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
                I VG+ER+HLEQDAGKS+HD  +  S +DLNRSGVALMEIV+KPDMRS+ EA+A+
Sbjct: 131 -----ITVGVERLHLEQDAGKSLHDLSATESHVDLNRSGVALMEIVSKPDMRSAEEARAY 185

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYE 253
           +TKLR++LRY+G+CDGNME+GS+RADVNVSV RPGE  GTRCE+KNVNSIRF+G AIE E
Sbjct: 186 VTKLRALLRYIGSCDGNMEQGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRFIGQAIEVE 245

Query: 254 ARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRA 313
           ARRQI ILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PDLLPLE D+ ++ A
Sbjct: 246 ARRQIGILEDGGKIDQETRLFDPGKGETRSMRSKEEAHDYRYFPDPDLLPLEFDQAYVDA 305

Query: 314 IKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDL 373
           +K  +PELPDAKR RFI ++G+  YDA VLV +++ AD+FE+ A  RD K+ ANWVIN+L
Sbjct: 306 LKAGLPELPDAKRARFIEQYGLPPYDAGVLVMERASADFFEETAKGRDAKLAANWVINEL 365

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
            G LN+ G  +  +P+S   LG +++LI    ISGKIAKD+F I+W +GG PKEIVE  G
Sbjct: 366 FGRLNKEGLDVTRSPVSAQALGAIVELISSNVISGKIAKDLFEIVWSEGGDPKEIVEARG 425

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           ++QVTD  AIE  VD VI +NP+ V +   KP ++ WFVGQVMK TGGKANP  V  +LK
Sbjct: 426 MKQVTDTGAIEAAVDAVIAANPDKVKQAKAKPTMLGWFVGQVMKQTGGKANPQAVNDLLK 485

Query: 494 EKLGI 498
            KLGI
Sbjct: 486 SKLGI 490


>gi|312114336|ref|YP_004011932.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219465|gb|ADP70833.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 491

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/491 (63%), Positives = 383/491 (78%), Gaps = 6/491 (1%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           R E+L  G TG WEV++G+EVHAQ+   +KLFSGAS  FG EPN+ VS  DAAMPGMLP+
Sbjct: 5   RKENLIDGATGPWEVIVGMEVHAQVLSNAKLFSGASAAFGGEPNSHVSLVDAAMPGMLPV 64

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QA+ TGLGL A IN+ SVF RKNYFYPDLPQGYQISQ   PIVGEG V+V + 
Sbjct: 65  INVECVKQAIRTGLGLKAQINRRSVFDRKNYFYPDLPQGYQISQFKFPIVGEGIVTVDL- 123

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
                +  + +VGIER+HLEQDAGKS+HDQ    S +DLNRSGVALMEIV+KPD+RSS E
Sbjct: 124 -----KEYSFDVGIERLHLEQDAGKSLHDQDPDHSYVDLNRSGVALMEIVSKPDIRSSEE 178

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA++TKLR+ILRYLGTCDGNMEEGS+RADVNVSV + G   GTRCE+KNVNSIRF+G A
Sbjct: 179 AKAYITKLRTILRYLGTCDGNMEEGSLRADVNVSVRKLGAPLGTRCEIKNVNSIRFIGQA 238

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IEYEARRQI ++EDGG I+QETRLFD    +TR +R+KE+A DYRYF +PDLLPLE+ E 
Sbjct: 239 IEYEARRQIDVIEDGGTIKQETRLFDAKSGKTRPMRSKEEAHDYRYFPDPDLLPLEVSEA 298

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWV 369
           F+  +KK +PELPD KR RF+ E+ +S YDA VL+ D++ AD++E +A  RD K+ ANW+
Sbjct: 299 FVEDLKKVLPELPDEKRARFMSEYALSAYDAGVLILDRASADFYETVARGRDPKLAANWM 358

Query: 370 INDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIV 429
           + D    LN++GK I ++PIS  QLGELIDLI    ISG+IAK++F I+ +KGGTP  IV
Sbjct: 359 MGDFFAALNKTGKDITESPISAAQLGELIDLISSDVISGRIAKEVFEIMLDKGGTPGAIV 418

Query: 430 EELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
           EE GL+QVTD  AIEKVVDE+I +NP  V ++ TKP  +SWFVGQVM+ TGGKANP  V 
Sbjct: 419 EERGLKQVTDTGAIEKVVDEIIAANPKQVEQVQTKPKTLSWFVGQVMRATGGKANPDAVN 478

Query: 490 KMLKEKLGIKE 500
            +L++KL + E
Sbjct: 479 ALLRQKLQVPE 489


>gi|254474153|ref|ZP_05087544.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Pseudovibrio sp. JE062]
 gi|211956683|gb|EEA91892.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Pseudovibrio sp. JE062]
          Length = 494

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/499 (61%), Positives = 388/499 (77%), Gaps = 5/499 (1%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +    G TGDWE+VIG+EVHAQ++  +KLFSGAS +FG++PN  VS  D
Sbjct: 1   MTLVDTRTPDPKKFIKGATGDWEIVIGMEVHAQVTSEAKLFSGASTSFGSDPNNNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINEECVRQAIRTGLGLKAEINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG + + +   K G+   +EVG+ER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGTIHLDM---KDGE--QVEVGVERLHLEQDAGKSLHDQHPTMSFVDLNRSGVALMEIVS 175

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RS+ EAKA+LTKLR+ILRYLGTCDGNM++GSMRADVNVSV +PG  +GTRCE+KNV
Sbjct: 176 KPDIRSADEAKAYLTKLRTILRYLGTCDGNMDQGSMRADVNVSVRKPGGEFGTRCEIKNV 235

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PD
Sbjct: 236 NSIRFVGQAIEYEARRQIGILEDGGEIDQETRLFDSVKGETRSMRSKEEAHDYRYFPDPD 295

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE  ++ +  +   +PELPD K+ R+I EFG++ YDA +LV+++   D+FE++A  R
Sbjct: 296 LLPLEFSQELVDEMAANLPELPDEKKARYINEFGLTPYDADILVAERVSCDFFEEVAKGR 355

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVIND  G LN+ G  +  +PIS  QLG++IDLI  GTISGKIAKD+F I+W 
Sbjct: 356 DAKLAANWVINDTFGRLNKEGLDVTSSPISSEQLGKIIDLIKAGTISGKIAKDLFEIVWT 415

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE+ G++QVTDL AIE +VDE++ +N +   +   KP ++ WFVGQVMK + 
Sbjct: 416 EGGDPAQIVEDRGMKQVTDLGAIEGIVDEILAANTDKAEQAKEKPGMLGWFVGQVMKASK 475

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  MLK K+G++
Sbjct: 476 GKANPQAVSDMLKVKIGLE 494


>gi|39936167|ref|NP_948443.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodopseudomonas
           palustris CGA009]
 gi|47115635|sp|P61347|GATB_RHOPA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|39650022|emb|CAE28545.1| Glu-tRNA(Gln) amidotransferase subunit B [Rhodopseudomonas
           palustris CGA009]
          Length = 494

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/494 (61%), Positives = 396/494 (80%), Gaps = 10/494 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +   L  G TGDWEVVIG+E+HAQ+S  +KLFSGA+  FG + NT VS  DAAMPGMLP+
Sbjct: 6   KPSKLIKGATGDWEVVIGLEIHAQVSSNAKLFSGAATAFGGDQNTHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QA+ +GLGLNA I+  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V + 
Sbjct: 66  INEECVRQAIRSGLGLNAKIHLRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGEVVVDL- 124

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
           PD      +I VGIER+HLEQDAGK +HDQ+   + +DLNRSGVALMEIV+KPD+RSS +
Sbjct: 125 PDGD----SITVGIERLHLEQDAGKLLHDQHPTSTFVDLNRSGVALMEIVSKPDLRSSEQ 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA+++KLR+I+RYLGTCDG+ME+GS+RADVNVSV RPGE +GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVSKLRTIMRYLGTCDGDMEKGSLRADVNVSVRRPGEPYGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IEYEARRQI ILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PDLLPLE  + 
Sbjct: 241 IEYEARRQIGILEDGGTIDQETRLFDANKGETRSMRSKEEAHDYRYFPDPDLLPLEFTQA 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-----RDKKI 364
           ++  +K  +PELPDAK+ERF+ +FG+S+ DA VLVS++  A+++E +        RD K+
Sbjct: 301 YVDDLKAGLPELPDAKKERFVHDFGLSVEDAGVLVSERESAEFYEAVLAQLKDQGRDGKL 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN+ G+SI+ +P+S  QL  +++LI +GTISGKIAK++F I+W +GG 
Sbjct: 361 AANWVINELFGRLNKDGQSIDASPVSAAQLAAIVELIGEGTISGKIAKELFEIVWTEGGD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P+ +VE+ G++QVTDLSAIEKVVD+++ +NP+ VA++  KP ++ WFVGQVMK++GGKAN
Sbjct: 421 PRTLVEQRGMKQVTDLSAIEKVVDDIVAANPDKVAQVVAKPAMLGWFVGQVMKSSGGKAN 480

Query: 485 PSIVQKMLKEKLGI 498
           P  V  +LK KLG+
Sbjct: 481 PQAVNDLLKRKLGL 494


>gi|158424471|ref|YP_001525763.1| glutamyl-tRNA(Gln) amidotransferase B subunit [Azorhizobium
           caulinodans ORS 571]
 gi|229486037|sp|A8ICV0|GATB_AZOC5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|158331360|dbj|BAF88845.1| glutamyl-tRNA(Gln) amidotransferase B subunit [Azorhizobium
           caulinodans ORS 571]
          Length = 492

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/488 (63%), Positives = 383/488 (78%), Gaps = 5/488 (1%)

Query: 11  SESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPIL 70
           ++ L  G TG+WEVVIG+E+HAQ+S  +KLFSGAS  FG  PN  VS  DAAMPGMLP++
Sbjct: 10  AKKLIKGATGNWEVVIGMEIHAQVSSNAKLFSGASTAFGGPPNDHVSLVDAAMPGMLPVI 69

Query: 71  NGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP 130
           N  CV QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ+  PIVGEG+V V +  
Sbjct: 70  NKECVAQAVRTGLGLRAQINLRSTFDRKNYFYPDLPQGYQISQYKSPIVGEGEVIVDLLD 129

Query: 131 DKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEA 190
            +S       VGIER+HLEQDAGKSIHD    +S +DLNRSGVALMEIV++PD+RSS EA
Sbjct: 130 GES-----FVVGIERLHLEQDAGKSIHDLSPTLSFVDLNRSGVALMEIVSRPDLRSSEEA 184

Query: 191 KAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAI 250
           +A++TKLRSILRYLGTCDG+ME+G++RADVNVSV RPGE  GTRCE+KNVNSIRF+G AI
Sbjct: 185 RAYVTKLRSILRYLGTCDGDMEKGNLRADVNVSVRRPGEPLGTRCEIKNVNSIRFIGQAI 244

Query: 251 EYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDF 310
           E EARRQI ILEDGG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLPL +  DF
Sbjct: 245 EVEARRQIEILEDGGVIDQETRLFDPNKGETRSMRSKEEAHDYRYFPDPDLLPLVLHADF 304

Query: 311 IRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVI 370
           +  +K  +PELPD K+ RFI ++G+S YDASVLV+++  ADYFE++A  RD K  AN+VI
Sbjct: 305 VEELKSHLPELPDEKKARFIADYGLSPYDASVLVAERDTADYFEQVAKGRDGKAAANFVI 364

Query: 371 NDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVE 430
           N+L G LN+ GK +  +P+SP Q+  ++DLI +G IS KIAKD+F I++ +GG P+ +VE
Sbjct: 365 NELFGRLNKDGKDVITSPVSPAQVAAIVDLIGEGVISSKIAKDLFEIVYTEGGDPRVLVE 424

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQK 490
           E GL+QVTD  AIEKVVDE+I +NP+ VA++  KP ++ WFVGQ MK +GGKANP  +  
Sbjct: 425 ERGLKQVTDTGAIEKVVDEIIAANPDKVAQVQAKPTMLGWFVGQAMKASGGKANPQALND 484

Query: 491 MLKEKLGI 498
           +LK KLGI
Sbjct: 485 ILKRKLGI 492


>gi|86749560|ref|YP_486056.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodopseudomonas
           palustris HaA2]
 gi|109892056|sp|Q2IXB5|GATB_RHOP2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|86572588|gb|ABD07145.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodopseudomonas palustris HaA2]
          Length = 494

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/494 (62%), Positives = 387/494 (78%), Gaps = 10/494 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +   L  G TGDWEVVIG+E+HAQ+S  +KLFSGA+  FG +PN+ VS  DAAMPGMLP+
Sbjct: 6   KPSQLIKGATGDWEVVIGLEIHAQVSSNAKLFSGAATEFGGDPNSHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QA+ +GLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V + 
Sbjct: 66  INEECVKQAIRSGLGLNAQINLRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGEVVVDL- 124

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
           PD      +  VGIER+HLEQDAGK +HDQ    + +DLNRSGVALMEIV+KPD+RSS +
Sbjct: 125 PDGD----STTVGIERLHLEQDAGKLLHDQDPTSTFVDLNRSGVALMEIVSKPDLRSSEQ 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA+++KLR+ILRYLGTCDG+ME+GS+RADVNVSV +PGE +GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVSKLRTILRYLGTCDGDMEKGSLRADVNVSVRKPGEPYGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IEYEARRQI +LEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PDLLPLE  + 
Sbjct: 241 IEYEARRQIGVLEDGGAIVQETRLFDAGKGETRSMRSKEEAHDYRYFPDPDLLPLEFSQA 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-----KLAVNRDKKI 364
           ++  +K  +PELPD K+ RFIG FG+S  DA VLVS++  AD++E          RD K+
Sbjct: 301 YVDELKAGLPELPDQKKARFIGSFGLSPDDAGVLVSERESADFYEAVLAALADAARDGKL 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN+ G+SIE +P+S  QL  ++DLI +GTISGKIAK++F I+W +GG 
Sbjct: 361 AANWVINELFGRLNKDGQSIEVSPVSAAQLAAIVDLIGEGTISGKIAKELFEIVWTEGGD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P+ +VE  G++QVTDLSAIEKVVDE+I  NP+ VA+   KP ++ WFVGQVMK++GGKAN
Sbjct: 421 PRVLVEARGMKQVTDLSAIEKVVDEIIAGNPDKVAQAIAKPAMLGWFVGQVMKSSGGKAN 480

Query: 485 PSIVQKMLKEKLGI 498
           P  V  +LK KLG+
Sbjct: 481 PQAVNDLLKRKLGL 494


>gi|296445893|ref|ZP_06887844.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylosinus
           trichosporium OB3b]
 gi|296256561|gb|EFH03637.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylosinus
           trichosporium OB3b]
          Length = 490

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/485 (63%), Positives = 385/485 (79%), Gaps = 5/485 (1%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           L  G TGDWEVV+G+E+HAQ+S  +KLFSGAS  +G EPN  VS  DAAMPGMLP++N  
Sbjct: 11  LIKGATGDWEVVVGMEIHAQVSSKAKLFSGASAEYGGEPNDHVSLVDAAMPGMLPVINEE 70

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V + P + 
Sbjct: 71  CVRQAIRTGLGLQAQINLRSVFDRKNYFYPDLPQGYQISQYKHPIVGEGEVVVDVTPTER 130

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
                I VGIER+HLEQDAGKS+HD     S +DLNRSGVALMEIV+KPD+RS+ EA+A+
Sbjct: 131 -----ITVGIERLHLEQDAGKSMHDLSPTESHVDLNRSGVALMEIVSKPDIRSAEEARAY 185

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYE 253
           ++KLR+ILRY+G+CDGNME+GS+RADVNVSV +PG  +GTRCE+KNVNSIRF+G AIE E
Sbjct: 186 VSKLRTILRYIGSCDGNMEQGSLRADVNVSVRKPGAPYGTRCEIKNVNSIRFIGQAIEVE 245

Query: 254 ARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRA 313
           ARRQI ILEDGG IRQETRLFDP K ETRS+R+KE+A DYRYF +PDLLPLE D+ ++ A
Sbjct: 246 ARRQIGILEDGGVIRQETRLFDPGKGETRSMRSKEEAHDYRYFPDPDLLPLEFDQTYVDA 305

Query: 314 IKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDL 373
           +K ++PELPD KR RFI E+G+  YDA VLV++++ AD+FE+ A  RD K+VANWVIN+L
Sbjct: 306 LKAELPELPDDKRARFIAEYGLPPYDAGVLVAERASADFFEEAATGRDAKLVANWVINEL 365

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
            G LN+ G  I  +P+S   +G ++DLI  G ISGKI KD+F I+W++GG P++IVE  G
Sbjct: 366 FGRLNKEGLDITRSPVSAAAIGAIVDLISQGVISGKIGKDVFEIVWQEGGDPRDIVETRG 425

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           L+QVTD  AIEK +DE+I +NP+ VA+   KP ++ WFVGQVMK TGGKANP  V ++LK
Sbjct: 426 LKQVTDTGAIEKAIDEIIAANPDKVAQAKAKPTMLGWFVGQVMKGTGGKANPQAVNELLK 485

Query: 494 EKLGI 498
            +LGI
Sbjct: 486 SRLGI 490


>gi|182678844|ref|YP_001832990.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|229486039|sp|B2IEA3|GATB_BEII9 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|182634727|gb|ACB95501.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 495

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/501 (62%), Positives = 381/501 (76%), Gaps = 12/501 (2%)

Query: 4   LDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAM 63
           ++THV  S+ L  G TGDWE++IG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  DAAM
Sbjct: 1   MNTHVKPSK-LIKGATGDWEIIIGLEVHAQVTSRSKLFSGASTQFGAEPNSNVSLVDAAM 59

Query: 64  PGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGK 123
           PGMLP++N  CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG 
Sbjct: 60  PGMLPVINEECVAQAVRTGLGLKAQINLRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGI 119

Query: 124 VSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPD 183
           V V + P +      IEVGIER+HLEQDAGKS+HDQ +  S +DLNRSGVALMEIV+KPD
Sbjct: 120 VIVDVSPTEQ-----IEVGIERLHLEQDAGKSLHDQSATDSFVDLNRSGVALMEIVSKPD 174

Query: 184 MRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSI 243
           MRS+ EA+A+++KLR+ILRYLGTCDGNME+GS+RADVNVSV RPGE +GTRCE+KNVNSI
Sbjct: 175 MRSADEARAYVSKLRTILRYLGTCDGNMEQGSLRADVNVSVRRPGEPFGTRCEIKNVNSI 234

Query: 244 RFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLP 303
           RF+G AIE EARRQI ILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PDLLP
Sbjct: 235 RFIGQAIETEARRQIGILEDGGVIDQETRLFDPGKGETRSMRSKEEAHDYRYFPDPDLLP 294

Query: 304 LEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL----AVN 359
           LE D+ ++  +   +PELPDAK+ RF+ ++G+  YDA VLV+DK  ADY+E       V 
Sbjct: 295 LEFDQAYVDGLASALPELPDAKKARFMNDYGLPAYDAGVLVADKETADYYETTVNYNGVK 354

Query: 360 RDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW 419
           RD K+VANWV  D+    N  G  +  T ++P Q+  L+DLI +  ISGKIAKD+  IL 
Sbjct: 355 RDPKLVANWVTGDVAAYANSVGLPVSQTHLTPAQIATLVDLISEEVISGKIAKDVLAILI 414

Query: 420 --EKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMK 477
             +K G P+ IVE  GL+QVTD  AIE  VD +I +NP+ VA+   KP ++ WFVGQVMK
Sbjct: 415 NEDKAGDPRTIVEARGLKQVTDTGAIEAAVDAIIAANPDKVAQAQAKPTMLGWFVGQVMK 474

Query: 478 NTGGKANPSIVQKMLKEKLGI 498
            TGGKANP  V ++LK KLGI
Sbjct: 475 QTGGKANPQAVNEILKAKLGI 495


>gi|154247851|ref|YP_001418809.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Xanthobacter
           autotrophicus Py2]
 gi|229487480|sp|A7IMA9|GATB_XANP2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|154161936|gb|ABS69152.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Xanthobacter
           autotrophicus Py2]
          Length = 496

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/501 (61%), Positives = 392/501 (78%), Gaps = 9/501 (1%)

Query: 2   VSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDA 61
           ++L      ++ L SG TGDWEVVIG+EVHAQ++  +KLFSGAS  FG  PN  VS  DA
Sbjct: 1   MTLHVRPTDTKKLISGATGDWEVVIGLEVHAQVASNAKLFSGASTAFGGPPNDHVSLVDA 60

Query: 62  AMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGE 121
           AMPGMLP++N  CV QAV TGLGL A I+  SVF RKNYFYPDLPQGYQISQ+ +P+VGE
Sbjct: 61  AMPGMLPVINQECVAQAVRTGLGLKAQIHLTSVFDRKNYFYPDLPQGYQISQYKQPVVGE 120

Query: 122 GKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTK 181
           G+V V + PD      +I VGIER+HLEQDAGKSIHD     S +DLNRSGVALMEIV++
Sbjct: 121 GEVIVDL-PDGE----SIPVGIERLHLEQDAGKSIHDLSPTQSFVDLNRSGVALMEIVSR 175

Query: 182 PDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVN 241
           PD+RS+ EAKA++TKLR+ILRYLGTCDG+ME+G++RADVNVSV RPGE +GTRCE+KNVN
Sbjct: 176 PDLRSAEEAKAYVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRRPGEPFGTRCEIKNVN 235

Query: 242 SIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDL 301
           SIRF+G AIE EARRQI ILEDGG I QETRLFDP++ ETRS+R+KE+A DYRYF +PDL
Sbjct: 236 SIRFIGQAIETEARRQIEILEDGGSISQETRLFDPTRGETRSMRSKEEAHDYRYFPDPDL 295

Query: 302 LPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA---- 357
           LPL +  +++  +K  +PELPD K+ RFI ++G+S YDA VLV+++  A YFE++A    
Sbjct: 296 LPLVLKPEWVEELKSGLPELPDEKKARFIADYGLSPYDAGVLVAERETAAYFEQVADGGG 355

Query: 358 VNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNI 417
           V RD K  AN+VIN+L G LN+ GK +  +P++P+Q+G ++DLI +GTIS KIAKD+F I
Sbjct: 356 VKRDGKAAANFVINELFGRLNKEGKDVTSSPVTPHQIGAILDLIAEGTISSKIAKDLFEI 415

Query: 418 LWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMK 477
           ++ +GG P+ +VE  GL+QVTDL AIEKVVDE+I  NP+ VA++  KP ++ WFVGQ MK
Sbjct: 416 IFTEGGDPRVVVEARGLKQVTDLGAIEKVVDEIIAKNPDKVAQVLAKPTMLGWFVGQAMK 475

Query: 478 NTGGKANPSIVQKMLKEKLGI 498
            +GGKANP  +  +LK KLGI
Sbjct: 476 ASGGKANPQALNDILKAKLGI 496


>gi|148256057|ref|YP_001240642.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bradyrhizobium
           sp. BTAi1]
 gi|166217736|sp|A5EKP2|GATB_BRASB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|146408230|gb|ABQ36736.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Bradyrhizobium sp. BTAi1]
          Length = 492

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/496 (62%), Positives = 382/496 (77%), Gaps = 10/496 (2%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
            A S  L  G TGDWEVVIG+E+HAQ++  SKLFSGAS  FG +PN+ VS  D AMPGML
Sbjct: 2   TATSGKLMKGATGDWEVVIGMEIHAQVTSKSKLFSGASTAFGGDPNSHVSLVDVAMPGML 61

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P++N  CV+QAV TGLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V+V 
Sbjct: 62  PVINEECVRQAVRTGLGLNAKINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEVTVE 121

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
           +   K     T  +GIER+HLEQD GK +HDQ  ++S ID NR GVALMEIV+KPD+R +
Sbjct: 122 LDGGK-----TATIGIERLHLEQDPGKMLHDQSPSLSYIDYNRCGVALMEIVSKPDIRDA 176

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLG 247
            +AKA++TKLRSILRYLGTCDG+ME+GS+RADVNVSV +PG   GTRCE+KN+NSI F+G
Sbjct: 177 EQAKAYVTKLRSILRYLGTCDGDMEKGSLRADVNVSVRKPGGPLGTRCEIKNINSISFIG 236

Query: 248 LAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEID 307
            A+E EARRQI I+EDGG I QETR FDP K ETRS+R+KE+A DYRYF +PDLLPLE D
Sbjct: 237 QAVEAEARRQIEIIEDGGTIEQETRRFDPDKGETRSMRSKEEAHDYRYFPDPDLLPLEFD 296

Query: 308 EDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-----VNRDK 362
           + F+ A+K  +PELPD K+ RFI +FG+S YDASVLV+++  A ++E +        RD 
Sbjct: 297 QAFVDALKAALPELPDQKKARFIADFGLSPYDASVLVAERESAAFYESVLEALSDRGRDG 356

Query: 363 KIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG 422
           K+ ANWVIN+L G LN+ G+ I  +P+S  QL  ++ LI +GTISGKIAKD+F I+W +G
Sbjct: 357 KLAANWVINELFGRLNKEGRDIASSPVSSAQLAAIVALIGEGTISGKIAKDLFEIVWSEG 416

Query: 423 GTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGK 482
           G P+E+VE  G++QVTDL AIEKVVDE+I +NP+ VA+   KP L  WFVGQVMK++GGK
Sbjct: 417 GDPRELVESRGMKQVTDLGAIEKVVDEIIAANPDKVAQAKAKPQLAGWFVGQVMKSSGGK 476

Query: 483 ANPSIVQKMLKEKLGI 498
           ANP  V  +LK KLGI
Sbjct: 477 ANPQAVNDLLKSKLGI 492


>gi|154253284|ref|YP_001414108.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Parvibaculum
           lavamentivorans DS-1]
 gi|154157234|gb|ABS64451.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Parvibaculum
           lavamentivorans DS-1]
          Length = 505

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/490 (64%), Positives = 389/490 (79%), Gaps = 5/490 (1%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           AR E L  G TGDWE+++G+EVHAQ++  +KLFS +S  FGAE NTQVSF DAAMPGMLP
Sbjct: 17  ARPEDLIKGQTGDWEIILGLEVHAQVTSNAKLFSASSTKFGAEQNTQVSFVDAAMPGMLP 76

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           ++N  CV+QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V + +
Sbjct: 77  VINRYCVEQAVRTGLGLKAQINLRSVFDRKNYFYPDLPQGYQISQYKHPIVGEGEVVLDM 136

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
              K G  RT+ VGIER+HLEQDAGKS+HDQ+ A+S +DLNRSGVALMEIV+KPDMRS+ 
Sbjct: 137 ---KDG--RTVIVGIERLHLEQDAGKSLHDQHPAMSFVDLNRSGVALMEIVSKPDMRSAD 191

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           EA+A++TKLR+ILRYLGTCDGNMEEGS+RADVNVSV + G   GTRCE+KNVNSIRF+G 
Sbjct: 192 EARAYVTKLRTILRYLGTCDGNMEEGSLRADVNVSVRKVGAPLGTRCEIKNVNSIRFIGQ 251

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AIEYEARRQI ILE+GG I QETRLFDP   ETRS+R+KE+A DYRYF +PDLLPLE+ +
Sbjct: 252 AIEYEARRQIEILEEGGKIDQETRLFDPKTGETRSMRSKEEAHDYRYFPDPDLLPLELLQ 311

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANW 368
           D + AI+  +PELPD K+ R I ++G+S YDA+VLVS+ + AD+FE +A  RD K+ ANW
Sbjct: 312 DDVDAIRTSLPELPDEKKARLISDYGLSPYDATVLVSEGARADFFEAVAKGRDAKLAANW 371

Query: 369 VINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEI 428
           V  D  G LNR G SIEDTP++  QLGELIDLI DGTISG+IAK +F+ +++ G  P +I
Sbjct: 372 VTGDFFGALNREGHSIEDTPVTAKQLGELIDLISDGTISGRIAKQVFDSMYKTGRDPAKI 431

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIV 488
           VE+ GL+QVTD   IE  +D VI +NP+ V +   KP L +WFVGQ+MK+T GKANP +V
Sbjct: 432 VEDEGLQQVTDFGEIEAAIDAVIAANPDKVEQTKVKPQLAAWFVGQIMKSTSGKANPRVV 491

Query: 489 QKMLKEKLGI 498
            ++L  KLG+
Sbjct: 492 NEILARKLGL 501


>gi|146341396|ref|YP_001206444.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bradyrhizobium
           sp. ORS278]
 gi|146194202|emb|CAL78224.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Bradyrhizobium sp. ORS278]
          Length = 505

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/495 (62%), Positives = 382/495 (77%), Gaps = 10/495 (2%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           A    L  G TGDWE VIG+E+HAQ++  SKLFSGAS  FG +PNT VS  DAAMPGMLP
Sbjct: 16  ATPHKLIKGATGDWETVIGMEIHAQVTSKSKLFSGASTAFGGDPNTHVSLVDAAMPGMLP 75

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           ++N  CV+QAV TGLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V+V +
Sbjct: 76  VINEECVRQAVRTGLGLNAKINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEVTVEL 135

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
              K     T  +GIER+HLEQD GK +HDQ  ++S ID NR GVALMEIV+KPD+R + 
Sbjct: 136 DGGK-----TATIGIERLHLEQDPGKMLHDQSPSLSYIDFNRCGVALMEIVSKPDIRDAE 190

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           +AKA++TKLRSI+RYLGTCDG+ME+GS+RADVNVSV +PG   GTRCE+KN+NSI F+G 
Sbjct: 191 QAKAYVTKLRSIMRYLGTCDGDMEKGSLRADVNVSVRKPGGPLGTRCEIKNINSISFIGQ 250

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           A+E EARRQI ILEDGG I QETR FDP K ETRS+R+KE+A DYRYF +PDLLPLE D+
Sbjct: 251 AVEAEARRQIEILEDGGVIEQETRRFDPDKGETRSMRSKEEAHDYRYFPDPDLLPLEFDQ 310

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL--AVN---RDKK 363
            F+  +K  +PELPD K+ RFI +FG+S YDASVLV+++  A ++E +  A++   RD K
Sbjct: 311 AFVDELKAALPELPDQKKARFIADFGLSPYDASVLVAERESAAFYEAVLDALSERVRDGK 370

Query: 364 IVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG 423
           + ANWVIN+L G LN+ G+ I  +P+S  QL  ++ LI +G ISGKIAKD+F I+W +GG
Sbjct: 371 LAANWVINELFGRLNKEGRDIAFSPVSAAQLASIVALIGEGIISGKIAKDLFEIVWSEGG 430

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKA 483
            P+E+VE  G++QVTDL AIEKVVDE+I +NP+ VA+   KP L  WFVGQVMK++GGKA
Sbjct: 431 DPRELVESRGMKQVTDLGAIEKVVDEIIAANPDKVAQAKAKPQLAGWFVGQVMKSSGGKA 490

Query: 484 NPSIVQKMLKEKLGI 498
           NP  V  +LK KLGI
Sbjct: 491 NPQAVNDLLKSKLGI 505


>gi|27380198|ref|NP_771727.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bradyrhizobium
           japonicum USDA 110]
 gi|47115785|sp|Q89K31|GATB_BRAJA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|27353352|dbj|BAC50352.1| glutamyl-tRNA amidotransferase subunit B [Bradyrhizobium japonicum
           USDA 110]
          Length = 492

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/493 (61%), Positives = 384/493 (77%), Gaps = 10/493 (2%)

Query: 11  SESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPIL 70
           +  L  G TGDWE+VIG+E+HAQ++  SKLFSGAS  FG EPN+ VS  D AMPGMLP++
Sbjct: 5   THKLLKGATGDWEMVIGMEIHAQVTSNSKLFSGASTAFGGEPNSHVSLVDVAMPGMLPVI 64

Query: 71  NGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP 130
           N  CV+QAV TGLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  P+VGEG+V V +  
Sbjct: 65  NEECVRQAVRTGLGLNAKINLRSVFDRKNYFYPDLPQGYQISQYKSPVVGEGEVLVELDG 124

Query: 131 DKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEA 190
                 R++ VGIER+H+EQD GK +HDQ  ++S ID NR GVALMEIV+KPD+R + +A
Sbjct: 125 G-----RSVTVGIERLHIEQDPGKMLHDQSPSLSLIDFNRCGVALMEIVSKPDIRDAEQA 179

Query: 191 KAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAI 250
           KA++TKLRSI+RYLGTCDG+ME+G++RADVNVSV +PG   GTRCE+KN+NSI F+G AI
Sbjct: 180 KAYVTKLRSIMRYLGTCDGDMEKGNLRADVNVSVRKPGGPLGTRCEIKNMNSINFIGQAI 239

Query: 251 EYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDF 310
           EYEARRQI ILEDGG I QETR FDP K ETRS+R+KE+A DYRYF +PDLLPLE  ++F
Sbjct: 240 EYEARRQIEILEDGGQIEQETRRFDPDKGETRSMRSKEEAHDYRYFPDPDLLPLEFSQEF 299

Query: 311 IRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-----RDKKIV 365
           +  +K ++PELPD K+ RF+ +FG+S YDASVLV+++  A ++E +        RD K+ 
Sbjct: 300 VDELKAKLPELPDQKKTRFVADFGLSAYDASVLVAERESAVFYETVLDKLGDRARDGKMA 359

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ANWVIN+L G LN+ G+ I  +P++  QL  +IDLI +GTISGKIAKD+F I+W++GG P
Sbjct: 360 ANWVINELFGRLNKEGRDITGSPVTAEQLAAIIDLIGEGTISGKIAKDLFEIVWQEGGDP 419

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANP 485
           + +VE  G++QVTDLSAIEKVVD++I +NP+  A++  KP  + WFVGQVMK +GGKANP
Sbjct: 420 RALVESRGMKQVTDLSAIEKVVDDIIAANPDKAAQVKDKPQSLGWFVGQVMKASGGKANP 479

Query: 486 SIVQKMLKEKLGI 498
             V ++LK KLGI
Sbjct: 480 QSVNELLKSKLGI 492


>gi|115525357|ref|YP_782268.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodopseudomonas
           palustris BisA53]
 gi|122295584|sp|Q07L96|GATB_RHOP5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|115519304|gb|ABJ07288.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodopseudomonas palustris BisA53]
          Length = 494

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/494 (63%), Positives = 388/494 (78%), Gaps = 10/494 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +   L  G TGDWEVVIG+EVHAQ++  +KLFSGAS  FG  PN  VS  DAAMPGMLP+
Sbjct: 6   KPSKLIKGATGDWEVVIGLEVHAQVASNAKLFSGASTEFGGAPNAHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV QAV TGLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  P+VGEG V V + 
Sbjct: 66  INEECVAQAVRTGLGLNAQINLRSVFDRKNYFYPDLPQGYQISQYKSPVVGEGVVEVDL- 124

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
           PD  G    I VGIER+HLEQDAGK +HDQ+   + +DLNRSGVALMEIV+KPD+RSS +
Sbjct: 125 PDGEG----ISVGIERLHLEQDAGKLLHDQHPTSTFVDLNRSGVALMEIVSKPDIRSSEQ 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA+++KLR+ILRYLGTCDG+ME+GS+RADVNVSV +PG   GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVSKLRTILRYLGTCDGDMEKGSLRADVNVSVRKPGGPLGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IEYEARRQI ILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PDLLPLE  +D
Sbjct: 241 IEYEARRQIGILEDGGAIVQETRLFDAGKGETRSMRSKEEAHDYRYFPDPDLLPLEFSQD 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-----RDKKI 364
           ++ A+K ++PELPDAK+ RF+ EFG+SL DA VLV+++  A+++E +        RD K+
Sbjct: 301 YVDALKAKLPELPDAKKARFMAEFGLSLEDAGVLVAERESAEFYEAVLAALGNQPRDGKL 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN+ G+ I  +P+S  QL  +++LI +GTISGKIAKD+F I+W +GG 
Sbjct: 361 AANWVINELFGRLNKEGRDIAASPVSAAQLATIVELIGEGTISGKIAKDLFEIVWCEGGD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P+E+VE  G++QVTDL AIEKVVD++I +NP+ VA+   KP L+ WFVGQVMK++GGKAN
Sbjct: 421 PRELVETRGMKQVTDLGAIEKVVDDIIQANPDKVAQAQAKPALMGWFVGQVMKSSGGKAN 480

Query: 485 PSIVQKMLKEKLGI 498
           P  V  +LK KLG+
Sbjct: 481 PQSVNDLLKSKLGL 494


>gi|217976923|ref|YP_002361070.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylocella
           silvestris BL2]
 gi|254790958|sp|B8EPC0|GATB_METSB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|217502299|gb|ACK49708.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylocella
           silvestris BL2]
          Length = 495

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/499 (62%), Positives = 378/499 (75%), Gaps = 11/499 (2%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T  A+   L  G TGD+E+VIG+E+HAQ++  SKLFSGAS  FG EPN  VS  DAAMPG
Sbjct: 2   TTRAKPSKLIKGATGDFEIVIGMEIHAQVTSRSKLFSGASTEFGGEPNAHVSLVDAAMPG 61

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG V+
Sbjct: 62  MLPVINQECVAQAVRTGLGLEAQINLRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGVVA 121

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V + P +      I+VGIER+HLEQDAGKS+HDQ +  S +DLNRSGVALMEIV+KPDMR
Sbjct: 122 VDVSPTEQ-----IKVGIERLHLEQDAGKSLHDQSATESLVDLNRSGVALMEIVSKPDMR 176

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRF 245
           SS EA+A++TKLR+ILRY+G+CDGNME+GS+RADVNVSV RPGE  GTRCE+KNVNSIRF
Sbjct: 177 SSDEARAYVTKLRTILRYIGSCDGNMEQGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRF 236

Query: 246 LGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLE 305
           +G AIE EARRQI ++EDGG ++QETRLFDP + ETRS+R+KE+A DYRYF +PDLLPLE
Sbjct: 237 IGQAIEVEARRQIGVIEDGGVVQQETRLFDPGRGETRSMRSKEEAHDYRYFPDPDLLPLE 296

Query: 306 IDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL----AVNRD 361
            D+ ++  +K  +PELPDAK+ERFI E+G+  YDA VLV+DK  ADY+E         RD
Sbjct: 297 FDQAYVDGLKAGLPELPDAKKERFIAEYGLPAYDAGVLVADKETADYYEAAVRHGGAKRD 356

Query: 362 KKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW-- 419
            K+VANW+  D+    N  G S+  T I P Q+  L+DLI DGTISGKIAKD+ +IL   
Sbjct: 357 PKLVANWLTGDVAAYANSVGLSVAQTHIKPGQIASLVDLIADGTISGKIAKDVLSILIAE 416

Query: 420 EKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNT 479
           EK   PK+IVE  GLRQVTD  AI   VD +I +NP+ VA+   KP+++ WFVGQVMK T
Sbjct: 417 EKDADPKDIVEARGLRQVTDTGAIAAAVDAIIKANPDKVAQAQAKPSMLGWFVGQVMKQT 476

Query: 480 GGKANPSIVQKMLKEKLGI 498
           GGKANP  V   LK KLGI
Sbjct: 477 GGKANPQAVNDELKAKLGI 495


>gi|304320045|ref|YP_003853688.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Parvularcula
           bermudensis HTCC2503]
 gi|303298948|gb|ADM08547.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Parvularcula
           bermudensis HTCC2503]
          Length = 488

 Score =  635 bits (1639), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 305/483 (63%), Positives = 370/483 (76%), Gaps = 5/483 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG+WEVVIG+EVHAQ++  +KLFSGAS  +GA PN  VS  DAA PGMLP++N  CV+
Sbjct: 11  GETGEWEVVIGLEVHAQVASNAKLFSGASAQYGAGPNENVSLVDAAFPGMLPVINRYCVE 70

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TGLGLNA IN +S F RKNYFYPDLPQGYQISQ+  PIVGEG + V +   +    
Sbjct: 71  QAVRTGLGLNAKINLWSRFDRKNYFYPDLPQGYQISQYKDPIVGEGMIEVELDDGE---- 126

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            T+E+GIER+HLEQDAGKSIHD     S +DLNRSGVALMEIV+KPDMRS+ E  A+ +K
Sbjct: 127 -TVEIGIERLHLEQDAGKSIHDLSPKESYVDLNRSGVALMEIVSKPDMRSAEEGAAYFSK 185

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR+ILRYLGTCDGNME+GSMRADVNVSV RPG+A GTR E KNVNSIRF+   I+YEARR
Sbjct: 186 LRTILRYLGTCDGNMEQGSMRADVNVSVRRPGDALGTRTETKNVNSIRFVRQVIDYEARR 245

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI +LE GG I QETRLFD    ETR++RTKEDA DYRYF +PDLLPLE++E  I  I+ 
Sbjct: 246 QIEVLEAGGTIDQETRLFDVKTGETRTMRTKEDAHDYRYFPDPDLLPLELEEAMIERIRA 305

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
           ++PELPD K+ RF+  +G+S+YDASVL +D+  ADYFE +A  RD K+ ANWV  +L  V
Sbjct: 306 ELPELPDQKKRRFVDAYGLSVYDASVLAADREKADYFETVADGRDGKLAANWVTTELFAV 365

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN+   +I ++P+    LGELIDLI DGTISGKIAK +F I+ ++GG P+ IV+E GL+Q
Sbjct: 366 LNKRDLTIAESPVPAAHLGELIDLIQDGTISGKIAKQVFEIMLDEGGAPRAIVDERGLKQ 425

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           VTD  AIE  VD+VI  NP  V ++  KP  + WFVGQVMK TGGKANP  V  +LKEKL
Sbjct: 426 VTDTGAIEAAVDKVIAENPAQVEKVKEKPKTLGWFVGQVMKETGGKANPQAVNAILKEKL 485

Query: 497 GIK 499
           G++
Sbjct: 486 GVE 488


>gi|288960012|ref|YP_003450352.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Azospirillum sp. B510]
 gi|288912320|dbj|BAI73808.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Azospirillum sp. B510]
          Length = 483

 Score =  621 bits (1601), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 307/485 (63%), Positives = 381/485 (78%), Gaps = 6/485 (1%)

Query: 13  SLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNG 72
           S   G TGDWEVVIG+EVHAQ+   +KLFSG++  FGA PN+QVSF DAA PGMLP++N 
Sbjct: 2   SYIQGETGDWEVVIGLEVHAQVISNAKLFSGSATEFGAAPNSQVSFVDAAFPGMLPVINE 61

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
            CV+QAV TGLGL A IN +SVF RKNYFY DLPQGYQISQ  +PIVG+G++ + + PD 
Sbjct: 62  YCVEQAVRTGLGLKAEINLHSVFDRKNYFYADLPQGYQISQFLQPIVGKGEIVLDL-PD- 119

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKA 192
            G  RT  VG+ R+HLEQDAGKS+HDQ+ + S IDLNRSGVALMEIV++PDMRSS EA A
Sbjct: 120 -GTSRT--VGVTRLHLEQDAGKSLHDQHPSKSYIDLNRSGVALMEIVSEPDMRSSEEAGA 176

Query: 193 FLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEY 252
           ++ KLRSILRYLGTCDGNMEEGSMR DVNVSV +PG  +GTRCE+KNVNSIRF+  AIEY
Sbjct: 177 YVRKLRSILRYLGTCDGNMEEGSMRCDVNVSVRKPGAPFGTRCEIKNVNSIRFVMQAIEY 236

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           EARRQI I+E+GG I QETRL+D +K  TRS+R+KE+A DYRYF +PDLLPLE+D +++ 
Sbjct: 237 EARRQIEIIEEGGKIDQETRLWDTTKFVTRSMRSKEEAHDYRYFPDPDLLPLELDAEWVE 296

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIND 372
            IKK +PELPD K+ RFI ++ +S+YDA VLVS+KS ADYFE +A  RD K+ +NWV  +
Sbjct: 297 DIKKTLPELPDDKKARFIEDYKLSVYDAGVLVSEKSKADYFETVAKGRDPKLASNWVTGE 356

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEEL 432
           L G LN++GK IE++P+S   LG LIDLI D TISG+IAK++F  ++E GG   +IVE+ 
Sbjct: 357 LFGYLNKAGKEIEESPVSAENLGGLIDLIADNTISGRIAKEVFEAMFETGGKAADIVEKK 416

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GLRQVTD SAIE  +D V+ +NP+ VA   + K  L  +FVGQVMK T GKANP++V ++
Sbjct: 417 GLRQVTDTSAIEGSIDAVLAANPDKVAEFRSGKDKLFGFFVGQVMKATQGKANPAMVNEI 476

Query: 492 LKEKL 496
           L  KL
Sbjct: 477 LTSKL 481


>gi|126735406|ref|ZP_01751152.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter sp.
           CCS2]
 gi|126715961|gb|EBA12826.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter sp.
           CCS2]
          Length = 503

 Score =  620 bits (1600), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 302/503 (60%), Positives = 378/503 (75%), Gaps = 16/503 (3%)

Query: 7   HVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGM 66
           + A +    +G T DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F DA MPGM
Sbjct: 6   YTAPAPKTIAGATSDWELVIGLEVHAQVATNAKLFSGASTLFGAEPNSNVAFVDAGMPGM 65

Query: 67  LPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSV 126
           LP++N  CV QAV TGLGLNA IN +S F RKNYFYPDLPQGYQISQ   PIVGEG+V V
Sbjct: 66  LPVINEGCVAQAVKTGLGLNAEINLFSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVLV 125

Query: 127 SIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRS 186
            +G   +G+ R +   IERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV++PD+R 
Sbjct: 126 EMG---NGEARNVR--IERIHLEQDAGKSIHDMDPTMSFVDLNRTGVALMEIVSRPDIRG 180

Query: 187 SLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA---W--------GTRC 235
             EA A++ KLR ILRYLGTCDGNM+ G++RADVNVSVC+PG+    W        GTRC
Sbjct: 181 PEEAAAYVLKLRQILRYLGTCDGNMQNGNLRADVNVSVCKPGDYEKYWETQDFSHLGTRC 240

Query: 236 EVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRY 295
           E+KN+NS+RF+ +AI++EARRQIA++EDG  + QETRL+DP KNETRS+R+KE+A DYRY
Sbjct: 241 EIKNMNSMRFIQMAIDFEARRQIALIEDGREVVQETRLYDPDKNETRSMRSKEEAHDYRY 300

Query: 296 FSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK 355
           F +PDLLPLEI++ ++  IK  +PELPD K+ RFI +FG+S YDASVL ++   A YFEK
Sbjct: 301 FPDPDLLPLEIEQAWVDDIKASLPELPDQKKARFISDFGLSDYDASVLTAEVVNAAYFEK 360

Query: 356 LAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIF 415
           +A  RD K+ ANWVIN+L G L +   SIED+P+S  QLGELI LI  G I+GKIAKD+F
Sbjct: 361 VAEGRDGKLAANWVINELFGRLKKEDHSIEDSPVSAAQLGELIGLIKAGDINGKIAKDVF 420

Query: 416 NILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQV 475
            I +  G  P EIVE  G++QVTD  AIE  VDE+I +NP  V +    P L+ WFVGQV
Sbjct: 421 EISYTTGRNPAEIVETEGMKQVTDTGAIETAVDEIIAANPAQVEKAQANPKLIGWFVGQV 480

Query: 476 MKNTGGKANPSIVQKMLKEKLGI 498
           MK TGGKANP+ V +++  KLG+
Sbjct: 481 MKATGGKANPAAVNQIVSAKLGL 503


>gi|89067967|ref|ZP_01155411.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Oceanicola
           granulosus HTCC2516]
 gi|89046565|gb|EAR52621.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Oceanicola
           granulosus HTCC2516]
          Length = 503

 Score =  620 bits (1599), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 299/496 (60%), Positives = 370/496 (74%), Gaps = 16/496 (3%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           + +G TGDWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F DA MPGMLP++N  
Sbjct: 13  VIAGATGDWELVIGLEVHAQVASKAKLFSGASTRFGAEPNSNVAFVDAGMPGMLPVINEG 72

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV  AV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVGEG+V V + P  +
Sbjct: 73  CVALAVKTGLGLKAEINLRSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVLVDMAPGIA 132

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
            + R     IERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV++PD+R   EA A+
Sbjct: 133 RRVR-----IERIHLEQDAGKSIHDMDPTMSFVDLNRTGVALMEIVSRPDIRGPEEAAAY 187

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNS 242
           + KLR ILRYLGTCDGNM+ G++RADVNVSVCRPG+             GTRCE+KN+NS
Sbjct: 188 VGKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGDYERYQESQDFSHLGTRCEIKNMNS 247

Query: 243 IRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLL 302
           +RF+  AI+YEARRQIA+LEDG  + QETRLFDP K+ETRS+R+KE+A DYRYF +PDLL
Sbjct: 248 MRFIQAAIDYEARRQIALLEDGKEVIQETRLFDPDKSETRSMRSKEEAHDYRYFPDPDLL 307

Query: 303 PLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK 362
           PLEI++ ++  I+  +PELPD KR RF+ EFG+  YDASVL ++   A YFE +A  RD 
Sbjct: 308 PLEIEQAWVDDIRASLPELPDEKRARFVTEFGLKEYDASVLTAEVENATYFEAVAHGRDG 367

Query: 363 KIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG 422
           K+ ANWVIN+L G L +  K+I D+P++P QLG ++DLI  G ISGKIAKD+F I++ +G
Sbjct: 368 KLAANWVINELFGRLKKDDKAIADSPVTPAQLGAIVDLIAKGDISGKIAKDLFEIVYTEG 427

Query: 423 GTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGK 482
           G P  IVEE G++QVTD  AIE  VDEVI +NP  V +    P L  WFVGQVMK TGGK
Sbjct: 428 GDPAAIVEERGMKQVTDTGAIETAVDEVIAANPAQVEKAKANPKLAGWFVGQVMKATGGK 487

Query: 483 ANPSIVQKMLKEKLGI 498
           ANP  V  ++ +KLG+
Sbjct: 488 ANPKAVNDLVTQKLGL 503


>gi|260576332|ref|ZP_05844323.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Rhodobacter sp.
           SW2]
 gi|259021403|gb|EEW24708.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Rhodobacter sp.
           SW2]
          Length = 503

 Score =  620 bits (1598), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 298/504 (59%), Positives = 372/504 (73%), Gaps = 16/504 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           TH A    + +G   DWE+VIG+E+HAQ+S  +KLFSGAS   GAEPN+ V+F DAAMPG
Sbjct: 5   THTAPKPKVIAGAKHDWELVIGMEIHAQVSSNAKLFSGASTAVGAEPNSNVAFVDAAMPG 64

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG G+V 
Sbjct: 65  MLPVINDYCVEQAVRTGLGLKAQINLVSAFDRKNYFYPDLPQGYQISQLYHPIVGAGEVL 124

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V + P   G  R +   IERIHLEQDAGKSIHD   A+S +D NR+GVALMEIV++PD+R
Sbjct: 125 VEMAP---GIARLVR--IERIHLEQDAGKSIHDMDPAMSFVDFNRTGVALMEIVSRPDIR 179

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTR 234
              EA A++ KLR ILRYLGTCDG+M+ G++RADVNVSVCRPG+             GTR
Sbjct: 180 GPEEAAAYVVKLRQILRYLGTCDGDMQHGNLRADVNVSVCRPGQYEKYQASQDFSHLGTR 239

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KN+NS+RF+ LAI+YEARRQIAILEDGG I+QETRL+DP +NETRS+R+KE+A DYR
Sbjct: 240 CEIKNMNSMRFIQLAIDYEARRQIAILEDGGVIKQETRLYDPDRNETRSMRSKEEAHDYR 299

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPL+I++ ++ AI   +PELPDAK+ RFI +FG++ YDASVL +D   A YFE
Sbjct: 300 YFPDPDLLPLQIEQAWVDAIAASMPELPDAKKARFINDFGLTDYDASVLTADLESAGYFE 359

Query: 355 KLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDI 414
            +A  RD K  ANWVIN+L G LN+ G  I D+P+S  QLG ++DLI  G ISGK+AKD+
Sbjct: 360 AVAQGRDGKQAANWVINELFGRLNKQGLGIADSPVSSAQLGGILDLIAAGDISGKMAKDL 419

Query: 415 FNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQ 474
           F ++W  GG P E+    G++QVTD  AIE  VDE+I +NP  V +    P L  WFVGQ
Sbjct: 420 FELVWTDGGDPAEVAAAHGMKQVTDTGAIEAAVDEIIAANPAQVEKARANPKLAGWFVGQ 479

Query: 475 VMKNTGGKANPSIVQKMLKEKLGI 498
           V+K +GGKANP +V  ++  KLG+
Sbjct: 480 VIKASGGKANPVVVNDLVMRKLGL 503


>gi|119384663|ref|YP_915719.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Paracoccus
           denitrificans PD1222]
 gi|119374430|gb|ABL70023.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Paracoccus denitrificans PD1222]
          Length = 504

 Score =  619 bits (1596), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 301/508 (59%), Positives = 372/508 (73%), Gaps = 16/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+   T+ A    +  G   DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDHLTYTAPEPKIIQGAKQDWELVIGLEVHAQVASNAKLFSGASTGFGAEPNSHVAFVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEFCVAQAVKTGLGLKAAINLVSAFDRKNYFYPDLPQGYQISQLYHPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V + P  + + R     IERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV+
Sbjct: 121 EGEVIVDMAPGVARRVR-----IERIHLEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVS 175

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPG-----------E 229
           +PD+R   EA A++ KLR I+RYLGTCDGNM+ G++RADVNVSVC PG            
Sbjct: 176 RPDIRGPEEAAAYVAKLRQIMRYLGTCDGNMQNGNLRADVNVSVCAPGAYERYQETGDFS 235

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AI+YEARRQIAI+EDGG + QETRL+DP + ETRS+R+KE+
Sbjct: 236 HLGTRCEIKNMNSLRFIQQAIDYEARRQIAIIEDGGKVVQETRLYDPDRGETRSMRSKEE 295

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPD K+ RF+   G+S YDA VL ++   
Sbjct: 296 AHDYRYFPDPDLLPLEIEQGWVDDIAAAMPELPDEKKARFVTGLGLSEYDAGVLTAEVES 355

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           ADYFE++A  RD K  ANWVIN+L G LN+ G S+E +P+S  QLG +IDLI  G ISGK
Sbjct: 356 ADYFEQVASGRDGKQAANWVINELFGRLNKEGLSVETSPVSAAQLGGVIDLIGSGAISGK 415

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F ILW +GG P EIVE  G++QVTDL AIEK VDE+I +NP  V +    P L  
Sbjct: 416 IAKDLFEILWTEGGDPAEIVESRGMKQVTDLGAIEKAVDEIIAANPAQVEKARANPKLAG 475

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           WFVGQV+K TGGKANP+ V +++  KLG
Sbjct: 476 WFVGQVLKATGGKANPAAVNELVARKLG 503


>gi|197104792|ref|YP_002130169.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Phenylobacterium
           zucineum HLK1]
 gi|196478212|gb|ACG77740.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Phenylobacterium
           zucineum HLK1]
          Length = 499

 Score =  619 bits (1595), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 298/496 (60%), Positives = 370/496 (74%), Gaps = 16/496 (3%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           L  G TG WEVV+G+EVHAQ++  +KLFSGA+V FGA PN QVS  DAAMPGMLP++N  
Sbjct: 9   LIQGRTGPWEVVLGLEVHAQVASNAKLFSGAAVGFGAGPNEQVSLVDAAMPGMLPVINRH 68

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ+  PIVGEG+V V     + 
Sbjct: 69  CVEQAVRTGLGLKAQINLKSRFDRKNYFYPDLPQGYQISQYQHPIVGEGEVIV-----ER 123

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
               T  V IER+HLEQDAGKS+HDQ    + +DLNR+G ALMEIV++PDMRSS EA A+
Sbjct: 124 DDGSTFTVRIERLHLEQDAGKSLHDQDPNFTYVDLNRAGTALMEIVSRPDMRSSDEAAAY 183

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPG-----------EAWGTRCEVKNVNS 242
           + KLR+IL YLG+CDG+ME+G++RADVNVSVCRPG              GTRCE+KNVNS
Sbjct: 184 VKKLRTILIYLGSCDGDMEKGNLRADVNVSVCRPGAYEKYRQTGDFSHLGTRCEIKNVNS 243

Query: 243 IRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLL 302
            RF+  AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLL
Sbjct: 244 FRFMQQAIEYEARRQIEILEDGGSIDQETRLFDPNKGETRSMRSKEEAHDYRYFPDPDLL 303

Query: 303 PLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK 362
           PLE+D  +++ I+  +PELPDAK+ RF  ++G+S YDA VL++D++ AD++E  A  RD 
Sbjct: 304 PLELDPAWVKKIEADLPELPDAKKARFQSQYGLSAYDAGVLIADQAKADFYEAAANGRDA 363

Query: 363 KIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG 422
           K+VANWV NDL   L+  G  I D+PI P  + EL+ LI DGTIS KIAKD+F  +W   
Sbjct: 364 KLVANWVTNDLAAKLSADGLEIGDSPIGPAAIAELVQLIEDGTISSKIAKDVFERMWAGE 423

Query: 423 GTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGK 482
           G+  EIVE+ GL+QV+D  A+EK++D++I +NP   A +  KP  + WFVGQVMK TGGK
Sbjct: 424 GSASEIVEKQGLKQVSDTGALEKIIDDLIAANPGQAAAVKEKPQAIGWFVGQVMKATGGK 483

Query: 483 ANPSIVQKMLKEKLGI 498
           ANP  V ++LK KLG+
Sbjct: 484 ANPGAVNQLLKAKLGV 499


>gi|221638387|ref|YP_002524649.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacter
           sphaeroides KD131]
 gi|254790964|sp|B9KMT6|GATB_RHOSK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|221159168|gb|ACM00148.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodobacter sphaeroides KD131]
          Length = 503

 Score =  618 bits (1594), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 296/504 (58%), Positives = 371/504 (73%), Gaps = 16/504 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T+ A    + +G   DWE+VIG+E+HAQ+S  +KLFSGAS  FGAEPN+ VSF D AMPG
Sbjct: 5   TYEAPKPKVIAGAKHDWELVIGMEIHAQVSSNAKLFSGASTTFGAEPNSNVSFVDCAMPG 64

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  CV QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVGEG+V 
Sbjct: 65  MLPVINEFCVAQAVRTGLGLKAQINLFSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVL 124

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V + P  +   R     IERIHLEQDAGKSIHD    +S +D NR+GVALMEIV++PD+R
Sbjct: 125 VEMAPGIARLVR-----IERIHLEQDAGKSIHDMDPNLSFVDFNRTGVALMEIVSRPDIR 179

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTR 234
              EA A++ KLR ILRYLGTCDGNM+ G++RADVNVSVCRPG+             GTR
Sbjct: 180 GPEEAAAYVAKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFSHLGTR 239

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KN+NS+RF+  AI+YEARRQIAILEDGG + QETRL+DP K ETRS+R+KE+A DYR
Sbjct: 240 CEIKNMNSMRFIQQAIDYEARRQIAILEDGGKVVQETRLYDPDKGETRSMRSKEEAHDYR 299

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPLEI++ ++  I   +PELPDAK+ RF+ ++G++ YDA+VL ++   A YFE
Sbjct: 300 YFPDPDLLPLEIEQGWVDEIAASMPELPDAKKARFMADYGVTDYDANVLTAELEAAAYFE 359

Query: 355 KLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDI 414
           ++A  RD K  ANWVIN+L G LN+ G +I DTP+   QLG ++DLI  G ISGK+AKD+
Sbjct: 360 EVARGRDGKQAANWVINELFGRLNKQGLTIADTPVKAGQLGGVLDLIASGEISGKMAKDL 419

Query: 415 FNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQ 474
           F ILW +GG P E+    G++QVTD  AIE  VDE+I +NP  V +    P L  WFVGQ
Sbjct: 420 FEILWTEGGDPAEVAAARGMKQVTDTGAIETAVDEIIAANPAQVEKAKANPKLAGWFVGQ 479

Query: 475 VMKNTGGKANPSIVQKMLKEKLGI 498
           V+K TGGKANP+ V +++ EKLG+
Sbjct: 480 VIKATGGKANPAAVNQIVAEKLGL 503


>gi|332557418|ref|ZP_08411740.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacter
           sphaeroides WS8N]
 gi|332275130|gb|EGJ20445.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacter
           sphaeroides WS8N]
          Length = 503

 Score =  617 bits (1590), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 296/504 (58%), Positives = 372/504 (73%), Gaps = 16/504 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T+ A    + +G   DWE+VIG+E+HAQ+S  +KLFSGAS  FGAEPN+ VSF D AMPG
Sbjct: 5   TYEAPKPKVIAGAKHDWELVIGMEIHAQVSSNAKLFSGASTTFGAEPNSNVSFVDCAMPG 64

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  CV QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVGEG+V 
Sbjct: 65  MLPVINEFCVAQAVRTGLGLKAQINLFSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVL 124

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V + P   G  R +   IERIHLEQDAGKSIHD    +S +D NR+GVALMEIV++PD+R
Sbjct: 125 VELAP---GIARLVR--IERIHLEQDAGKSIHDMDPNLSFVDFNRTGVALMEIVSRPDIR 179

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTR 234
              EA A++ KLR ILRYLGTCDGNM+ G++RADVNVSVCRPG+             GTR
Sbjct: 180 GPEEAAAYVAKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFSHLGTR 239

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KN+NS+RF+  AI+YEARRQIAILEDGG + QETRL+DP K ETRS+R+KE+A DYR
Sbjct: 240 CEIKNMNSMRFIQQAIDYEARRQIAILEDGGKVVQETRLYDPDKGETRSMRSKEEAHDYR 299

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPLEI++ ++  I   +PELPDAK+ RF+ ++G++ YDA+VL ++   A YFE
Sbjct: 300 YFPDPDLLPLEIEQGWVDDIAASMPELPDAKKARFMADYGVTDYDANVLTAELDAAAYFE 359

Query: 355 KLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDI 414
           ++A  RD K  ANWVIN+L G LN+ G +I DTP+   QLG ++DLI  G ISGK+AKD+
Sbjct: 360 EVARGRDGKQAANWVINELFGRLNKQGLTIADTPVKAGQLGGVLDLIASGEISGKMAKDL 419

Query: 415 FNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQ 474
           F ILW +GG P E+    G++QVTD  AIE  VDE+I +NP  V +    P L  WFVGQ
Sbjct: 420 FEILWTEGGDPAEVAAARGMKQVTDTGAIETAVDEIIAANPAQVEKAKANPKLAGWFVGQ 479

Query: 475 VMKNTGGKANPSIVQKMLKEKLGI 498
           V+K TGGKANP+ V +++ +KLG+
Sbjct: 480 VIKATGGKANPAAVNQIVAQKLGL 503


>gi|77462533|ref|YP_352037.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacter
           sphaeroides 2.4.1]
 gi|109892059|sp|Q3J4Z8|GATB_RHOS4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|77386951|gb|ABA78136.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodobacter sphaeroides 2.4.1]
          Length = 503

 Score =  615 bits (1587), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 295/504 (58%), Positives = 370/504 (73%), Gaps = 16/504 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T+ A    + +G   DWE+VIG+E+HAQ+S  +KLFSGAS  FGAEPN+ VSF D AMPG
Sbjct: 5   TYEAPKPKVIAGAKHDWELVIGMEIHAQVSSNAKLFSGASTTFGAEPNSNVSFVDCAMPG 64

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  CV QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVGEG+V 
Sbjct: 65  MLPVINEFCVAQAVRTGLGLKAQINLVSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVL 124

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V + P  +   R     IERIHLEQDAGKSIHD    +S +D NR+GVALMEIV++PD+R
Sbjct: 125 VELAPGIARLVR-----IERIHLEQDAGKSIHDMDPNLSFVDFNRTGVALMEIVSRPDIR 179

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTR 234
              EA A++ KLR ILRYLGTCDGNM+ G++RADVNVSVCRPG+             GTR
Sbjct: 180 GPEEAAAYVAKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFSHLGTR 239

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KN+NS+RF+  AI+YEARRQIAILEDGG + QETRL+DP K ETRS+R+KE+A DYR
Sbjct: 240 CEIKNMNSMRFIQQAIDYEARRQIAILEDGGKVVQETRLYDPDKGETRSMRSKEEAHDYR 299

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPLEI++ ++  I   +PELPDAK+ RF+ ++G++ YDA+VL ++   A YFE
Sbjct: 300 YFPDPDLLPLEIEQGWVDEIAASMPELPDAKKARFMADYGVTDYDANVLTAELDAAAYFE 359

Query: 355 KLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDI 414
           ++A  RD K  ANWVIN+L G LN+ G +I DTP+   QLG ++DLI  G ISGK+AKD+
Sbjct: 360 EVARGRDGKQAANWVINELFGRLNKQGLTIADTPVKAGQLGGVLDLIASGEISGKMAKDL 419

Query: 415 FNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQ 474
           F ILW +GG P E+    G++QVTD  AIE  VDE+I +NP  V +    P L  WFVGQ
Sbjct: 420 FEILWTEGGDPAEVAAARGMKQVTDTGAIETAVDEIIAANPAQVEKAKANPKLAGWFVGQ 479

Query: 475 VMKNTGGKANPSIVQKMLKEKLGI 498
           V+K TGGKANP+ V +++ +KLG+
Sbjct: 480 VIKATGGKANPAAVNQIVAQKLGL 503


>gi|255262577|ref|ZP_05341919.1| aspartyl/glutamyl-tRNA [Thalassiobium sp. R2A62]
 gi|255104912|gb|EET47586.1| aspartyl/glutamyl-tRNA [Thalassiobium sp. R2A62]
          Length = 504

 Score =  615 bits (1585), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 301/504 (59%), Positives = 374/504 (74%), Gaps = 17/504 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T+      + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F DA MPG
Sbjct: 5   TYETPKPKVIAGAKHDWELVIGLEVHAQVSSKAKLFSGASTQFGAEPNSNVAFVDAGMPG 64

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  CV  AV TGLGLNA IN  S F RKNYFYPDLPQGYQISQ  +PIVG G++ 
Sbjct: 65  MLPVINEECVALAVKTGLGLNAEINLKSAFDRKNYFYPDLPQGYQISQLYEPIVGPGEIL 124

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V +GP  + + R     +ERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV+ PD+R
Sbjct: 125 VDMGPGIARKVR-----VERIHLEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVSFPDIR 179

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTR 234
              EA A++ KLR ILRYLGTCDGNM+ G+MRADVNVSVCR G+             GTR
Sbjct: 180 GPEEAAAYVVKLRQILRYLGTCDGNMQNGNMRADVNVSVCRAGQYEKFQETGDFGHLGTR 239

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KN+NS+RF+ LAI++EARRQIAILEDGG I QETRL+D  KNETRS+R+KE+A DYR
Sbjct: 240 CELKNMNSMRFIQLAIDFEARRQIAILEDGGEITQETRLYDADKNETRSMRSKEEAHDYR 299

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPLEI++ ++  I   +PELPDAKR RF+G+FG+S YDASVL ++   A YFE
Sbjct: 300 YFPDPDLLPLEIEQAWVDDIAASLPELPDAKRARFVGDFGLSQYDASVLTAEAENAAYFE 359

Query: 355 KLAVNRDKKIVANWVINDLLGVLNR-SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKD 413
           ++A  RD K+ ANWVIN+L G L +   K+I D+P+SP QLG +I+LI    ISGKIAKD
Sbjct: 360 QVADGRDGKMAANWVINELFGRLKKDDDKAITDSPVSPAQLGGIIELISSDAISGKIAKD 419

Query: 414 IFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVG 473
           +F I++ +GG P  IVEE G++QVTD  AIE  VDE+I +NP+ VA+    P L  WFVG
Sbjct: 420 LFEIVYTEGGDPAVIVEERGMKQVTDTGAIEAAVDEIIAANPDQVAKAKENPKLAGWFVG 479

Query: 474 QVMKNTGGKANPSIVQKMLKEKLG 497
           QVMK TGGKANP  V +++ +KL 
Sbjct: 480 QVMKATGGKANPKAVNQLVAQKLA 503


>gi|310816195|ref|YP_003964159.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ketogulonicigenium vulgare Y25]
 gi|308754930|gb|ADO42859.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ketogulonicigenium vulgare Y25]
          Length = 503

 Score =  614 bits (1584), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 296/504 (58%), Positives = 371/504 (73%), Gaps = 16/504 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T+ +    + +G   DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F DA MPG
Sbjct: 5   TYTSPKPKVIAGAKYDWELVIGLEVHAQVATNAKLFSGASTGFGAEPNSHVAFVDAGMPG 64

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  C+ QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVGEG+V 
Sbjct: 65  MLPVINEECIAQAVRTGLGLKAAINLRSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVL 124

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V +G   + + R     IERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV++PD+R
Sbjct: 125 VEMGAGVARRVR-----IERIHLEQDAGKSIHDMDPHMSFVDLNRTGVALMEIVSRPDIR 179

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPG-----------EAWGTR 234
              EA A++ KLR I+RYLGTCDGNM+ G++RADVNVSVCRPG              GTR
Sbjct: 180 GPEEAAAYVGKLRQIMRYLGTCDGNMQNGNLRADVNVSVCRPGAYEKFAETGDFSYLGTR 239

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KN+NS+RF+   IEYEARRQIAILEDGG I QETRL+DP K ETRS+R+KE+A DYR
Sbjct: 240 CELKNMNSMRFIQQGIEYEARRQIAILEDGGTIDQETRLYDPEKGETRSMRSKEEAHDYR 299

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPLEI++ ++  I   +PELPDAK+ RF+ +FG++ YDASVL ++   A YFE
Sbjct: 300 YFPDPDLLPLEIEQAWVDDIAAHLPELPDAKKARFMADFGLTEYDASVLTAEAENAAYFE 359

Query: 355 KLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDI 414
           ++A  RD K+ ANWVIN+L G L +  + I D+P+SP QLG ++ LI  G ISGKI KD+
Sbjct: 360 EVAQGRDGKLSANWVINELFGRLKKDSREIGDSPVSPAQLGGIVALIASGDISGKIGKDL 419

Query: 415 FNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQ 474
           F I++ +GG P EIVE  G+RQVTD  AIE  VD+VI +NP  V +    P L  WFVGQ
Sbjct: 420 FEIIYTEGGDPAEIVESRGMRQVTDFGAIETAVDDVIAANPAQVEKAKANPKLAGWFVGQ 479

Query: 475 VMKNTGGKANPSIVQKMLKEKLGI 498
           VMK+TGGKANP+ V  ++ +KLG+
Sbjct: 480 VMKSTGGKANPAAVNDIVAKKLGL 503


>gi|114771772|ref|ZP_01449165.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [alpha
           proteobacterium HTCC2255]
 gi|114547588|gb|EAU50479.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [alpha
           proteobacterium HTCC2255]
          Length = 503

 Score =  614 bits (1584), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 299/492 (60%), Positives = 376/492 (76%), Gaps = 16/492 (3%)

Query: 16  SGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCV 75
           SGT GDWE+VIG+EVHAQ++  SKLFSGAS  FG EPN+ VS  DAAMPGMLP++N  CV
Sbjct: 15  SGTKGDWELVIGMEVHAQVASKSKLFSGASTKFGNEPNSNVSMVDAAMPGMLPVINEFCV 74

Query: 76  QQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQ 135
           +QAV TGLGL A IN YS F RKNYFYPDLPQGYQISQ   PIVGEG++ V++    +G 
Sbjct: 75  EQAVRTGLGLKAKINLYSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEILVNL---DAGI 131

Query: 136 FRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
            R + V  ERIHLEQDAGKS+HD    +S +DLNR+GVALMEIV+ PD+RS  EA A++T
Sbjct: 132 ARNVRV--ERIHLEQDAGKSVHDMDPNMSFVDLNRTGVALMEIVSMPDIRSPEEAAAYVT 189

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNSIR 244
           KLR ILRYLGTCDGNM+ G+MRADVNVSVC  G+             GTRCE+KN+NS+R
Sbjct: 190 KLRQILRYLGTCDGNMQNGNMRADVNVSVCPSGQYEKFRASGDFSHLGTRCELKNMNSMR 249

Query: 245 FLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPL 304
           F+ LAI++EARRQI+ILEDGG I QETRL+D  KNETRS+R+KE+A DYRYF +PDLLPL
Sbjct: 250 FIQLAIDFEARRQISILEDGGTIDQETRLYDAEKNETRSMRSKEEAHDYRYFPDPDLLPL 309

Query: 305 EIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKI 364
           EID+ ++  I + +PELPD K+ RFI EF ++ YDASVL +D S A+YFEK+A  RD K 
Sbjct: 310 EIDQKWVDGIAENLPELPDEKKIRFIKEFKVTEYDASVLTADLSDAEYFEKIANGRDGKQ 369

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN++  +I+++PIS  QLG+++DLI  G ISGKIAKD+F I+W +GG 
Sbjct: 370 AANWVINELFGRLNKADLTIKESPISTTQLGDILDLISKGDISGKIAKDLFEIVWTEGGN 429

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P +IV++ G++QVTD + IE  +D+++  NP+ V +    P L  WFVGQVMK TGGKAN
Sbjct: 430 PSDIVDKRGMKQVTDTTKIEAAIDKIMIENPDQVTKAKENPKLAGWFVGQVMKATGGKAN 489

Query: 485 PSIVQKMLKEKL 496
           P  V +++ +KL
Sbjct: 490 PKAVNEIIAKKL 501


>gi|85703680|ref|ZP_01034784.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseovarius sp.
           217]
 gi|85672608|gb|EAQ27465.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseovarius sp.
           217]
          Length = 504

 Score =  614 bits (1584), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 299/505 (59%), Positives = 376/505 (74%), Gaps = 17/505 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T+ A    + +G   DWE+VIG+EVHAQ++  SKLFSGAS  FGAEPN+ V+F DAAMPG
Sbjct: 5   TYKAPKPRVIAGAKHDWELVIGMEVHAQVASRSKLFSGASTQFGAEPNSNVAFVDAAMPG 64

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   P+VGEG++ 
Sbjct: 65  MLPVINEFCVEQAVRTGLGLKAKINLWSAFDRKNYFYPDLPQGYQISQLYHPLVGEGEIL 124

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V +GP   G  R + V  ERIH+EQDAGKSIHD   A+S +DLNR+GV LMEIV++PD+R
Sbjct: 125 VDMGP---GVARLVRV--ERIHMEQDAGKSIHDMDPAMSFVDLNRTGVCLMEIVSRPDIR 179

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTR 234
              EA A++TKLR ILRYLGTCDGNM+ G++RADVNVS+CRPG+             GTR
Sbjct: 180 GPEEAAAYVTKLRQILRYLGTCDGNMQNGNLRADVNVSICRPGQYEKYMETQDFSHLGTR 239

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KN+NS+RF+ +AI+YEARRQIAI+E GG + QETRL+DP KNETRS+R+KE+A DYR
Sbjct: 240 CEIKNMNSMRFIQMAIDYEARRQIAIVEAGGTVVQETRLYDPDKNETRSMRSKEEAHDYR 299

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPLEI++ ++  I   +PELPDAK+ RF+ EFG+S YDASVL +D + A YFE
Sbjct: 300 YFPDPDLLPLEIEQAWVDEIAANLPELPDAKKARFVLEFGLSEYDASVLTADLANAAYFE 359

Query: 355 KLAVNR-DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKD 413
            +A    D K+ ANWVIN+L G L +   SIED+P+SP QL  ++ LI    ISGKIAKD
Sbjct: 360 AVAAGAGDGKLAANWVINELFGRLKKEDHSIEDSPVSPAQLAGIVRLIKSDAISGKIAKD 419

Query: 414 IFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVG 473
           +F I++ +GG P+EIVE  G++QVTD  AIE+ V E+I +NP  V +    P L  WFVG
Sbjct: 420 LFEIVYTEGGDPEEIVEARGMKQVTDTGAIEQAVAEIIAANPAQVEKAQANPKLAGWFVG 479

Query: 474 QVMKNTGGKANPSIVQKMLKEKLGI 498
           QVMK TGGKANP  V  ++  KLG+
Sbjct: 480 QVMKATGGKANPKAVNDIVMAKLGL 504


>gi|146279115|ref|YP_001169274.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacter
           sphaeroides ATCC 17025]
 gi|166198813|sp|A4WX55|GATB_RHOS5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|145557356|gb|ABP71969.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 503

 Score =  614 bits (1583), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 295/504 (58%), Positives = 370/504 (73%), Gaps = 16/504 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T+      + +G   DWE+VIG+E+HAQ+S  +KLFSGAS  FGAEPN+ VSF D AMPG
Sbjct: 5   TYETPKPKVIAGAKHDWELVIGMEIHAQVSSNAKLFSGASTTFGAEPNSNVSFVDCAMPG 64

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  CV QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVGEG+V 
Sbjct: 65  MLPVINDFCVAQAVRTGLGLKAQINLVSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVL 124

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V +GP   G  R +   IERIHLEQDAGKSIHD    +S +D NR+GVALMEIV++PD+R
Sbjct: 125 VEMGP---GVARLVR--IERIHLEQDAGKSIHDMDPNLSFVDFNRTGVALMEIVSRPDIR 179

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTR 234
              EA A++ KLR ILRYLGTCDGNM+ G++RADVNVSVCRPG+             GTR
Sbjct: 180 GPEEAAAYVAKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGDYERYQATQDFSHLGTR 239

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KN+NS+RF+  AIEYEARRQIAILEDGG + QETRL+DP K ETRS+R+KE+A DYR
Sbjct: 240 CEIKNMNSMRFIQQAIEYEARRQIAILEDGGKVVQETRLYDPDKGETRSMRSKEEAHDYR 299

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPLEI++ ++  I   +PELPDAK+ RF+ ++G++ YDA+VL ++   A +FE
Sbjct: 300 YFPDPDLLPLEIEQAWVDEIATSMPELPDAKKARFMADYGVTDYDANVLTAELDAAAFFE 359

Query: 355 KLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDI 414
            +A  RD K  ANWVIN+L G LN+ G +I + P+S  QLG ++DLI  G ISGK+AKD+
Sbjct: 360 AVAKGRDGKQAANWVINELFGRLNKQGLTIAEAPVSAAQLGGVLDLIASGEISGKMAKDL 419

Query: 415 FNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQ 474
           F ILW +GG P E+    G++QVTD  AIE  VDE+I +NP  V +    P L  WFVGQ
Sbjct: 420 FEILWTEGGDPAEVAAARGMKQVTDTGAIETAVDEIIAANPAQVEKAKANPKLAGWFVGQ 479

Query: 475 VMKNTGGKANPSIVQKMLKEKLGI 498
           V+K TGGKANP+ V +++ +KLG+
Sbjct: 480 VIKATGGKANPAAVNQIVAQKLGL 503


>gi|126461467|ref|YP_001042581.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacter
           sphaeroides ATCC 17029]
 gi|166198812|sp|A3PHJ3|GATB_RHOS1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|126103131|gb|ABN75809.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 503

 Score =  613 bits (1580), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 295/504 (58%), Positives = 370/504 (73%), Gaps = 16/504 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T+ A    + +G   DWE+VIG+E+HAQ+S  +KLFSGAS  FGAEPN+ VSF D AMPG
Sbjct: 5   TYEAPKPKVIAGAKHDWELVIGMEIHAQVSSNAKLFSGASTTFGAEPNSNVSFVDCAMPG 64

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  CV QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVGEG+V 
Sbjct: 65  MLPVINEFCVAQAVRTGLGLKAQINLVSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVL 124

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V + P   G  R +   IERIHLEQDAGKSIHD    +S +D NR+GVALMEIV++PD+R
Sbjct: 125 VELAP---GIARLVR--IERIHLEQDAGKSIHDMDPNLSFVDFNRTGVALMEIVSRPDIR 179

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTR 234
              EA A++ KLR ILRYLGTCDGNM+ G++RADVNVSVCRPG+             GTR
Sbjct: 180 GPEEAAAYVAKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFSHLGTR 239

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KN+NS+RF+  AI+YEARRQIAILEDGG + QETRL+DP K ETRS+R+KE+A DYR
Sbjct: 240 CEIKNMNSMRFIQQAIDYEARRQIAILEDGGKVVQETRLYDPDKGETRSMRSKEEAHDYR 299

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPLEI++ ++  I   +PELPDAK+ RF+ ++G++ YDA+VL ++   A YFE
Sbjct: 300 YFPDPDLLPLEIEQGWVDEIAASMPELPDAKKARFMADYGVTDYDANVLTAELDAAAYFE 359

Query: 355 KLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDI 414
           ++A  RD K  ANWVIN+L G LN+ G +I D P+   QLG ++DLI  G ISGK+AKD+
Sbjct: 360 EVARGRDGKQAANWVINELFGRLNKQGLTIADPPVKAGQLGGVLDLIASGEISGKMAKDL 419

Query: 415 FNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQ 474
           F ILW +GG P E+    G++QVTD  AIE  VDE+I +NP  V +    P L  WFVGQ
Sbjct: 420 FEILWTEGGDPAEVAAARGMKQVTDTGAIETAVDEIIAANPAQVEKAKANPKLAGWFVGQ 479

Query: 475 VMKNTGGKANPSIVQKMLKEKLGI 498
           V+K TGGKANP+ V +++ +KLG+
Sbjct: 480 VIKATGGKANPAAVNQIVAQKLGL 503


>gi|56697685|ref|YP_168055.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ruegeria
           pomeroyi DSS-3]
 gi|81558383|sp|Q5LPK1|GATB_SILPO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|56679422|gb|AAV96088.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Ruegeria pomeroyi
           DSS-3]
          Length = 503

 Score =  612 bits (1579), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 295/492 (59%), Positives = 367/492 (74%), Gaps = 16/492 (3%)

Query: 16  SGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCV 75
           +G   DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ VSF DAAMPGMLP++N  CV
Sbjct: 15  AGAKHDWELVIGMEVHAQVASQAKLFSGASTAFGAEPNSNVSFVDAAMPGMLPVINEFCV 74

Query: 76  QQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQ 135
           +QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVGEG+V V +G   + +
Sbjct: 75  EQAVRTGLGLKAEINLKSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVLVEMGDGTARR 134

Query: 136 FRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
            R     IERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV++PD+R   EA A++ 
Sbjct: 135 VR-----IERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVSRPDIRGPEEAAAYIA 189

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPG-----------EAWGTRCEVKNVNSIR 244
           KLR ILRYLGTCDGNM+ G++RADVNVS+CRPG              GTRCE+KN+NS+R
Sbjct: 190 KLRQILRYLGTCDGNMQNGNLRADVNVSICRPGAYEKYQETQDFSHLGTRCEIKNMNSMR 249

Query: 245 FLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPL 304
           F+  AIEYEARRQIAI+E GG + QETRL+DP KNETRS+R+KE+A DYRYF +PDLLPL
Sbjct: 250 FIQAAIEYEARRQIAIVEAGGEVDQETRLYDPDKNETRSMRSKEEAHDYRYFPDPDLLPL 309

Query: 305 EIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKI 364
           EI++ ++  I   +PELPD K+ RFI EFG++ YDASVL ++   A YFE++A  R+ K+
Sbjct: 310 EIEQAWVDDIAASLPELPDDKKARFIKEFGLTDYDASVLTAEVESARYFEEVAQGRNGKL 369

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G L +    I D+P+SP+QLG +IDLI    ISGKIAKD+F I++ +GG 
Sbjct: 370 AANWVINELFGRLKKEDHDITDSPVSPSQLGGIIDLIASDAISGKIAKDLFEIVYTEGGD 429

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P EIVE  G++QVTD  AIE  +DE+I +NP  V +    P L  WFVGQVMK TGGKAN
Sbjct: 430 PAEIVEARGMKQVTDTGAIEAALDEIIAANPAQVEKAKVNPKLAGWFVGQVMKATGGKAN 489

Query: 485 PSIVQKMLKEKL 496
           P +V +M+ +KL
Sbjct: 490 PGVVNQMVSKKL 501


>gi|259418885|ref|ZP_05742802.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Silicibacter sp. TrichCH4B]
 gi|259345107|gb|EEW56961.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Silicibacter sp. TrichCH4B]
          Length = 502

 Score =  612 bits (1578), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 294/495 (59%), Positives = 371/495 (74%), Gaps = 16/495 (3%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F DAAMPGMLP++N  
Sbjct: 13  VIAGAKHDWELVIGMEVHAQVSSNAKLFSGASTQFGAEPNSNVAFVDAAMPGMLPVINEY 72

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVGEG+V V +G    
Sbjct: 73  CVEQAVRTGLGLKADINLWSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVLVELG---D 129

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G  R +   IERIH+EQDAGKSIHD   ++S +DLNR+GV LMEIV++PD+R   EA A+
Sbjct: 130 GTARMVR--IERIHMEQDAGKSIHDMDPSMSFVDLNRTGVCLMEIVSRPDIRGPEEAAAY 187

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNS 242
           + KLR I+RYLGTCDGNM+ G++RADVNVS+CR G+             GTRCE+KN+NS
Sbjct: 188 IAKLRQIMRYLGTCDGNMQNGNLRADVNVSICRAGQYEKYQETQDFSHLGTRCEIKNMNS 247

Query: 243 IRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLL 302
           +RF+  AIE EARRQIAI+E GG + QETRL+DP K ETRS+R+KE+A DYRYF +PDLL
Sbjct: 248 MRFIQQAIEVEARRQIAIVEAGGEVEQETRLYDPDKGETRSMRSKEEAHDYRYFPDPDLL 307

Query: 303 PLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK 362
           PLEI++D++  IK  +PELPD K+ RFI +FG++ YDASVL +D   A+YF+++A  R  
Sbjct: 308 PLEIEQDWVDGIKAALPELPDDKKARFIKDFGLTDYDASVLTADLESANYFDEVAKGRSG 367

Query: 363 KIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG 422
           K+ ANWVIN+L G L +  K I D+P+SP QLG +IDLI    ISGKIAKD+F I++ +G
Sbjct: 368 KLAANWVINELFGRLKKDDKDITDSPVSPAQLGGVIDLIASDAISGKIAKDLFEIVYTEG 427

Query: 423 GTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGK 482
           G P +IVEE G++QVTD  AIE  +DE+I +NP  V +    P L  WFVGQVMK TGGK
Sbjct: 428 GDPAQIVEERGMKQVTDTGAIEAALDEIIAANPAQVEKAKENPKLAGWFVGQVMKATGGK 487

Query: 483 ANPSIVQKMLKEKLG 497
           ANP  V +++ +KLG
Sbjct: 488 ANPKAVNELVAKKLG 502


>gi|110680511|ref|YP_683518.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter
           denitrificans OCh 114]
 gi|123065373|sp|Q163L1|GATB_ROSDO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|109456627|gb|ABG32832.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Roseobacter
           denitrificans OCh 114]
          Length = 503

 Score =  612 bits (1578), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 298/503 (59%), Positives = 369/503 (73%), Gaps = 16/503 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T+   +  + SG   DWE+VIG+EVHAQ++  +KLFS AS  FGAEPN  VSF DAAMPG
Sbjct: 5   TYETPAPKVISGAKEDWELVIGMEVHAQVTSAAKLFSAASTQFGAEPNNNVSFVDAAMPG 64

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP +N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVGEG+V 
Sbjct: 65  MLPTINEYCVEQAVRTGLGLKAEINLHSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVL 124

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V +G   +G  R + V  ERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV++PD+R
Sbjct: 125 VEMG---NGTARLVRV--ERIHLEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVSRPDIR 179

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTR 234
              EA A+L KLR ILRYLGTC+G+M+ G+MRADVNVS+CRPG+             GTR
Sbjct: 180 GPEEAAAYLGKLRQILRYLGTCNGDMQSGAMRADVNVSICRPGQYEKYQATQDFSHLGTR 239

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KN+NS+RF+  AIE EARRQIAI+E GG + QETRL+DP +NETRS+R+KE+A DYR
Sbjct: 240 CEIKNMNSMRFIQQAIEVEARRQIAIVEAGGTVDQETRLYDPDRNETRSMRSKEEAHDYR 299

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPLEI++ ++  I   +PELPDAK+ RF  +FG+S YDASVL +D   A YFE
Sbjct: 300 YFPDPDLLPLEIEQAWVDDIAANLPELPDAKKARFRNDFGLSDYDASVLTADLDSAGYFE 359

Query: 355 KLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDI 414
            +A  RD K+ ANWVIN+L G L +   +I D+P+SP QLG +IDLI    ISGKIAKD+
Sbjct: 360 AVAAGRDGKMAANWVINELFGRLKKEDHAITDSPVSPAQLGGIIDLIASDAISGKIAKDV 419

Query: 415 FNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQ 474
           F I +  G  P EIVE  G++QVTD  AIE  VDE+I +NP+ VA+    P L  WFVGQ
Sbjct: 420 FEICYTTGRDPAEIVETEGMKQVTDTGAIEAAVDEIIAANPDQVAKARENPKLAGWFVGQ 479

Query: 475 VMKNTGGKANPSIVQKMLKEKLG 497
           VMK TGGKANP +V +++ ++L 
Sbjct: 480 VMKATGGKANPKVVNQLIAKRLA 502


>gi|163792878|ref|ZP_02186854.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [alpha
           proteobacterium BAL199]
 gi|159181524|gb|EDP66036.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [alpha
           proteobacterium BAL199]
          Length = 490

 Score =  611 bits (1576), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 299/485 (61%), Positives = 372/485 (76%), Gaps = 10/485 (2%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WEVVIG+EVHAQ+   SKLFSG++  FGA  NTQVS  DAAMPGMLP++N  CV 
Sbjct: 9   GETGAWEVVIGLEVHAQVISKSKLFSGSATTFGAGANTQVSLVDAAMPGMLPVINRECVD 68

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TGL L A IN  SVF RKNYFY DLPQGYQISQ+++PIVGEG V + + PD     
Sbjct: 69  QAVRTGLALEAKINPVSVFDRKNYFYADLPQGYQISQYEQPIVGEGVVHLDL-PDS---- 123

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            T EVGIER+HLEQDAGKS+HDQ+ + S IDLNRSGVALMEIV+KPD+RS  +  A++ K
Sbjct: 124 ETKEVGIERLHLEQDAGKSLHDQHPSKSYIDLNRSGVALMEIVSKPDLRSPEDTAAYIKK 183

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LRSILRY+GTCDGNM+EGSMR DVNVSV +PG+ +GTRCE+KNVNSIRF+  AIEYEARR
Sbjct: 184 LRSILRYIGTCDGNMQEGSMRCDVNVSVRKPGDEYGTRCEIKNVNSIRFVQQAIEYEARR 243

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE+GG I+QETRLFD ++ ETRS+R+KEDA DYRYF +PDLLPL++D   + A+K 
Sbjct: 244 QVEVLEEGGSIKQETRLFDANRGETRSMRSKEDAHDYRYFPDPDLLPLKLDPARVEALKA 303

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV----NRDKKIVANWVIND 372
            +PELPD K+ RFI E+G+S+YDAS L+ +++IAD++E L       RD KI ANW I++
Sbjct: 304 ALPELPDVKKARFIAEYGLSVYDASSLIEERAIADWYEALVKGGNGKRDPKIAANWTISE 363

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEEL 432
           L G LN++G  + D+P+S + LG LIDLI DGTISG+IAKD+F  ++E G     IVEE 
Sbjct: 364 LFGALNKAGFDLADSPVSADALGGLIDLIGDGTISGRIAKDVFAEMFETGKDAAAIVEEK 423

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GLRQV+D  AIE +VD V+  N + VA   + K  L  +FVGQ MK +GGKANP +V ++
Sbjct: 424 GLRQVSDTGAIEAIVDAVLAENQDKVAEFRSGKDKLFGFFVGQTMKRSGGKANPGMVNEL 483

Query: 492 LKEKL 496
           LK KL
Sbjct: 484 LKAKL 488


>gi|99080542|ref|YP_612696.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ruegeria sp.
           TM1040]
 gi|122398285|sp|Q1GIT2|GATB_SILST RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|99036822|gb|ABF63434.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ruegeria sp. TM1040]
          Length = 502

 Score =  611 bits (1575), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 294/495 (59%), Positives = 369/495 (74%), Gaps = 16/495 (3%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F DAAMPGMLP++N  
Sbjct: 13  VIAGAKHDWELVIGMEVHAQVSSNAKLFSGASTQFGAEPNSNVAFVDAAMPGMLPVINEY 72

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVGEG+V V +G    
Sbjct: 73  CVEQAVRTGLGLKADINLWSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVLVELG---D 129

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G  R +   IERIH+EQDAGKSIHD   ++S +DLNR+GV LMEIV++PD+R   EA A+
Sbjct: 130 GTARMVR--IERIHMEQDAGKSIHDMDPSMSFVDLNRTGVCLMEIVSRPDIRGPEEAAAY 187

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPG-----------EAWGTRCEVKNVNS 242
           + KLR I+RYLGTCDGNM+ G++RADVNVS+CRPG              GTRCE+KN+NS
Sbjct: 188 IAKLRQIMRYLGTCDGNMQNGNLRADVNVSICRPGAYEKYQETQDFSHLGTRCEIKNMNS 247

Query: 243 IRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLL 302
           +RF+  AIE EARRQIAI+E GG + QETRL+DP K ETRS+R+KE+A DYRYF +PDLL
Sbjct: 248 MRFIQQAIEVEARRQIAIVEAGGEVEQETRLYDPDKGETRSMRSKEEAHDYRYFPDPDLL 307

Query: 303 PLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK 362
           PLEI++ ++  IK ++PELPD K+ RFI +FG++ YDASVL +D   A YF+ +A  R  
Sbjct: 308 PLEIEQAWVDDIKSKLPELPDEKKARFIKDFGLTDYDASVLTADLESAHYFDAVAKGRSG 367

Query: 363 KIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG 422
           K+ ANWVIN+L G L +  K I D+P+SP QLG +IDLI    ISGKIAKD+F I++ +G
Sbjct: 368 KLAANWVINELFGRLKKDDKDITDSPVSPAQLGGVIDLIASDAISGKIAKDLFEIVYTEG 427

Query: 423 GTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGK 482
           G P +IVEE G++QVTD  AIE  +DE+I +NP  V +    P L  WFVGQVMK TGGK
Sbjct: 428 GDPAQIVEERGMKQVTDTGAIEAALDEIIAANPAQVEKAKENPKLAGWFVGQVMKATGGK 487

Query: 483 ANPSIVQKMLKEKLG 497
           ANP  V +++ +KLG
Sbjct: 488 ANPKAVNQLVAKKLG 502


>gi|149201944|ref|ZP_01878918.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseovarius sp.
           TM1035]
 gi|149144992|gb|EDM33021.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseovarius sp.
           TM1035]
          Length = 511

 Score =  609 bits (1570), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 296/497 (59%), Positives = 371/497 (74%), Gaps = 17/497 (3%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           + +G   DWE+VIG+EVHAQ++  SKLFSGAS  FGAEPN+ V+F DAAMPGMLP++N  
Sbjct: 20  VIAGAKHDWELVIGMEVHAQVASKSKLFSGASTQFGAEPNSNVAFVDAAMPGMLPVINEF 79

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   P+VGEG++ V + P   
Sbjct: 80  CVEQAVRTGLGLKAKINLWSAFDRKNYFYPDLPQGYQISQLYHPLVGEGEILVDMAP--- 136

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G  R +   IERIH+EQDAGKSIHD   A+S +DLNR+GV LMEIV++PD+R   EA A+
Sbjct: 137 GVARLVR--IERIHMEQDAGKSIHDMDPAMSFVDLNRTGVCLMEIVSRPDIRGPEEAAAY 194

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNS 242
           +TKLR ILRYLGTCDGNM+ G++RADVNVS+CRPG+             GTRCE+KN+NS
Sbjct: 195 VTKLRQILRYLGTCDGNMQNGNLRADVNVSICRPGQYEKYMETQDFSHLGTRCEIKNMNS 254

Query: 243 IRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLL 302
           +RF+  AIEYEARRQIAI+E GG + QETRL+DP KNETRS+R+KE+A DYRYF +PDLL
Sbjct: 255 MRFIQAAIEYEARRQIAIVEAGGTVVQETRLYDPDKNETRSMRSKEEAHDYRYFPDPDLL 314

Query: 303 PLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR-D 361
           PLEI++ ++  I   +PELPDAK+ RF+ EFG+S YDA+VL +D + A YFE +A    D
Sbjct: 315 PLEIEQAWVDEIAANLPELPDAKKARFVLEFGLSEYDANVLTADLANAAYFEAVAEGAGD 374

Query: 362 KKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK 421
            K+ ANWVIN+L G L +   SIED+P+SP QL  ++ LI    ISGKIAKD+F I++ +
Sbjct: 375 GKLAANWVINELFGRLKKEDHSIEDSPVSPAQLAGIVRLIKSDAISGKIAKDLFEIVYTE 434

Query: 422 GGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGG 481
           GG P+EIVE  G++QVTD  AIE+ V E+I +NP  V +    P L  WFVGQVMK TGG
Sbjct: 435 GGDPEEIVEARGMKQVTDTGAIEQAVAEIIAANPAQVEKAQANPKLAGWFVGQVMKATGG 494

Query: 482 KANPSIVQKMLKEKLGI 498
           KANP  V  ++  KLG+
Sbjct: 495 KANPKAVNDIVMAKLGL 511


>gi|83310683|ref|YP_420947.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Magnetospirillum
           magneticum AMB-1]
 gi|109892030|sp|Q2W6Y7|GATB_MAGMM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|82945524|dbj|BAE50388.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit
           [Magnetospirillum magneticum AMB-1]
          Length = 485

 Score =  608 bits (1569), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 300/486 (61%), Positives = 372/486 (76%), Gaps = 9/486 (1%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           +  G TGDWE+VIG+EVHAQ+   +KLFSGA+  FGAEPNTQVSF DA  PGMLP++N  
Sbjct: 4   IIQGETGDWEIVIGLEVHAQVISKAKLFSGAATEFGAEPNTQVSFIDAGFPGMLPVINEV 63

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV TGLGL A IN  SVFARKNYFY DLPQGYQISQ+D+PIVGEG++ + + PD  
Sbjct: 64  CVEQAVRTGLGLKAKINLTSVFARKNYFYADLPQGYQISQYDQPIVGEGELILDL-PD-- 120

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G  RT  VGIER+HLEQDAGKSIHD + + S IDLNRSGVALMEIV+KPD+RS  EA  +
Sbjct: 121 GGTRT--VGIERLHLEQDAGKSIHDMHPSKSFIDLNRSGVALMEIVSKPDLRSPEEAGLY 178

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIE 251
           LTKLRSILRYL TCDGNM+EGSMR D NVSV RP       TRCE+KNVNSIRF+  AIE
Sbjct: 179 LTKLRSILRYLETCDGNMQEGSMRCDANVSV-RPVGSTELRTRCEIKNVNSIRFVQQAIE 237

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
           +EARR I + E GG IRQETRLFD  K ETRS+R+KE A DYRYF +PDLLPL I++ F+
Sbjct: 238 FEARRHIDVYESGGEIRQETRLFDSVKGETRSMRSKEHAHDYRYFPDPDLLPLVIEQSFV 297

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
             IK  +PELPD K+ RF+ E+G++ YDA VLV++K+ A++FE +A  RD K+  NWV+ 
Sbjct: 298 DGIKSGLPELPDEKKARFMAEYGLNAYDAGVLVAEKASAEFFETVAKGRDSKMACNWVMG 357

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D    LN +GK+IE+ P++   LG+LIDLI DGT+SG++AKD+F ++ E G  P  +VEE
Sbjct: 358 DFFASLNATGKTIENPPVTAANLGQLIDLIKDGTLSGRLAKDVFALMVETGKAPAVLVEE 417

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+QVTD  AIE  VD VI++NP+ V ++   K  L+ WF GQVMK+T GKANP++V +
Sbjct: 418 RGLKQVTDTGAIEAAVDAVISANPDKVQQVKDGKTALLGWFTGQVMKSTQGKANPAMVNE 477

Query: 491 MLKEKL 496
           ML +K+
Sbjct: 478 MLSKKI 483


>gi|23014590|ref|ZP_00054399.1| COG0064: Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit (PET112
           homolog) [Magnetospirillum magnetotacticum MS-1]
          Length = 485

 Score =  607 bits (1566), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 301/486 (61%), Positives = 371/486 (76%), Gaps = 9/486 (1%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           +  G TGDWE+VIG+EVHAQ+   +KLFSGA+  FGAEPNTQVSF DA  PGMLP++NG 
Sbjct: 4   IIQGDTGDWEIVIGLEVHAQVISKAKLFSGAATEFGAEPNTQVSFVDAGFPGMLPVINGI 63

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV TGLGL A IN  SVFARKNYFY DLPQGYQISQ+D+PIVGEG++ + + PD  
Sbjct: 64  CVEQAVRTGLGLKARINLTSVFARKNYFYADLPQGYQISQYDQPIVGEGELILDL-PD-- 120

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G  RT  VGIER+HLEQDAGKSIHD + A S IDLNRSGVALMEIV+KPD+RS  EA  +
Sbjct: 121 GGTRT--VGIERLHLEQDAGKSIHDMHPAKSFIDLNRSGVALMEIVSKPDLRSPEEAGLY 178

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIE 251
           LTKLRSILRYL TCDGNM+EGSMR D NVSV RP        RCE+KNVNSIRF+  AIE
Sbjct: 179 LTKLRSILRYLETCDGNMQEGSMRCDANVSV-RPVGSTELRDRCEIKNVNSIRFVQQAIE 237

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
           +EARR I + E GG I+QETRLFD  K ETRS+R+KE+A DYRYF +PDLLPL I++ F+
Sbjct: 238 FEARRHIDVYEAGGTIKQETRLFDSVKGETRSMRSKENAHDYRYFPDPDLLPLVIEQSFV 297

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
             IK  +PELPD K+ RF+ E+G++ YDA VLV++K+ A++FE +A  RD K+  NWV+ 
Sbjct: 298 DGIKAGLPELPDEKKARFMAEYGLNAYDAGVLVAEKASAEFFETVAKGRDSKMACNWVMG 357

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D    LN +GK+IE+ P+S   LG LIDLI DGT+SG++AKD+F ++ E G  P  IVEE
Sbjct: 358 DFFAALNATGKTIENPPVSAADLGALIDLIKDGTLSGRLAKDVFALMVETGKAPSVIVEE 417

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQK 490
            G++QVTD  AIE  VD VI++N + VA++   K  L+ WF GQVMK T GKANP++V +
Sbjct: 418 KGMKQVTDTGAIEAAVDAVISANADKVAQVKEGKTALLGWFTGQVMKATQGKANPAMVNE 477

Query: 491 MLKEKL 496
           ML +K+
Sbjct: 478 MLSKKI 483


>gi|83945535|ref|ZP_00957882.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Oceanicaulis
           alexandrii HTCC2633]
 gi|83851111|gb|EAP88969.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Oceanicaulis
           alexandrii HTCC2633]
          Length = 498

 Score =  607 bits (1566), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 292/491 (59%), Positives = 367/491 (74%), Gaps = 16/491 (3%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TGDWE+V+G+EVHAQ+   +KLFSGA+  FGAEPNTQVS  DA MPGMLP++N  CV 
Sbjct: 11  GATGDWELVMGLEVHAQVKSNAKLFSGAATAFGAEPNTQVSLVDAGMPGMLPVINEACVA 70

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TGLGLNA IN +S F RKNYFYPDLPQGYQISQ   PIVGEG++         G  
Sbjct: 71  QAVRTGLGLNAQINAFSRFDRKNYFYPDLPQGYQISQFAHPIVGEGEIECE---RDDGTL 127

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            T  VGIER+HLEQDAGKSIHD     + +DLNRSGVALMEIV++P +R+  +A A++  
Sbjct: 128 FT--VGIERLHLEQDAGKSIHDLDPTATYVDLNRSGVALMEIVSRPHIRTPADAAAYVRT 185

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPG-----------EAWGTRCEVKNVNSIRF 245
           LR+ILRYL TC G+ME+G +RADVNVSVCRPG           E  GTRCE+KNVNS+RF
Sbjct: 186 LRTILRYLDTCGGDMEKGQLRADVNVSVCRPGQYENFIETGSFEHLGTRCEIKNVNSLRF 245

Query: 246 LGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLE 305
           +  AIEYEA+RQ+ ILE+GG I QETRLFD +   TRS+R+KE+A DYRYF +PDLLPL+
Sbjct: 246 IMQAIEYEAQRQVDILEEGGTIDQETRLFDANAGVTRSMRSKEEAHDYRYFPDPDLLPLQ 305

Query: 306 IDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIV 365
           +++ FI  +K  +PELP  KR+RF+ E G+S YDASVL +DK  ADYFEK+   RD K+ 
Sbjct: 306 LEDSFIADLKANLPELPAEKRKRFVEELGLSEYDASVLAADKDRADYFEKVLEGRDPKLA 365

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ANWV N+L G LN+ G  I ++P+SP QLG ++ LI+D TISGKIAKD+F I+W +GG P
Sbjct: 366 ANWVNNELFGRLNKEGLGITESPVSPEQLGGIVSLIMDKTISGKIAKDVFEIVWAEGGDP 425

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANP 485
            +IV++ G++QVTD  AIEKV+D++I +NP+   ++  KP  + WFVGQVMK  GGKANP
Sbjct: 426 AKIVDDRGMKQVTDTGAIEKVIDDLIAANPDQAEKVKEKPKTMGWFVGQVMKEMGGKANP 485

Query: 486 SIVQKMLKEKL 496
             V ++L +KL
Sbjct: 486 QAVNEILAKKL 496


>gi|84516936|ref|ZP_01004294.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Loktanella
           vestfoldensis SKA53]
 gi|84509404|gb|EAQ05863.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Loktanella
           vestfoldensis SKA53]
          Length = 506

 Score =  607 bits (1565), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 293/504 (58%), Positives = 374/504 (74%), Gaps = 16/504 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T+ A +  + SG TGDWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F DA MPG
Sbjct: 8   TYDAPTPKVISGATGDWELVIGLEVHAQVATNAKLFSGASTLFGAEPNSNVAFVDAGMPG 67

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  CV QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVGEG+V 
Sbjct: 68  MLPVINEACVAQAVRTGLGLKAQINLTSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVL 127

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V +G   +G  R +   IERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV++PD+R
Sbjct: 128 VEMG---NGTARLVR--IERIHLEQDAGKSIHDMDPTMSFVDLNRTGVALMEIVSRPDIR 182

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTR 234
              EA A++ KLR I+RYLGTCDGNM+ G++RADVNVSVCRPG+             GTR
Sbjct: 183 GPEEAAAYVLKLRQIMRYLGTCDGNMQNGNLRADVNVSVCRPGDYERYQATQDFSHLGTR 242

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KN+NS+RF+ +AI++EARRQIA+LEDG  + QETRL+DP +NETRS+R+KE+A DYR
Sbjct: 243 CEIKNMNSMRFIQMAIDFEARRQIALLEDGKSVTQETRLYDPDRNETRSMRSKEEAHDYR 302

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPLEI++ ++  I   +PELPD K+ RFI ++G+S YDASVL ++   A +FE
Sbjct: 303 YFPDPDLLPLEIEQAWVDDIAAHLPELPDTKKARFIADYGLSDYDASVLTAEGENAAFFE 362

Query: 355 KLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDI 414
           K A  RD K+ ANWVIN+L G L +  + I D+PIS  +LG++I LI   TISGKIAKD+
Sbjct: 363 KAAEGRDGKLAANWVINELFGRLKKDDRDIADSPISAQRLGQIIGLIKSDTISGKIAKDV 422

Query: 415 FNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQ 474
           F+I + +   P+EIV   G+ QVTD  AIE+ VD +I +NP+ V +    P L  WFVGQ
Sbjct: 423 FDIAYTQDRDPEEIVATEGMTQVTDTGAIEEAVDAIIAANPDQVEKAKANPKLAGWFVGQ 482

Query: 475 VMKNTGGKANPSIVQKMLKEKLGI 498
           VMK TGGKANP+ V +++  +LG+
Sbjct: 483 VMKATGGKANPAAVNQIVAARLGL 506


>gi|83942720|ref|ZP_00955181.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sulfitobacter sp.
           EE-36]
 gi|83953959|ref|ZP_00962680.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sulfitobacter
           sp. NAS-14.1]
 gi|83841904|gb|EAP81073.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sulfitobacter
           sp. NAS-14.1]
 gi|83846813|gb|EAP84689.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sulfitobacter sp.
           EE-36]
          Length = 503

 Score =  607 bits (1564), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 302/506 (59%), Positives = 370/506 (73%), Gaps = 19/506 (3%)

Query: 2   VSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDA 61
           ++ DT   R+    +G   DWE+VIG+EVHAQ+   +KLFS AS  FGAEPN  V+F DA
Sbjct: 4   LTYDTPKVRT---IAGAKHDWELVIGMEVHAQVLSNAKLFSAASTKFGAEPNNNVAFVDA 60

Query: 62  AMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGE 121
           AMPGMLP +N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVGE
Sbjct: 61  AMPGMLPTINEYCVEQAVRTGLGLKAEINLHSAFDRKNYFYPDLPQGYQISQLYHPIVGE 120

Query: 122 GKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTK 181
           G+V V +G    G  R + V  ERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV++
Sbjct: 121 GEVLVELG---DGTARLVRV--ERIHLEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVSR 175

Query: 182 PDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------A 230
           PD+R   EA A+LTKLR ILRYLGTC+G+M+ G+MRADVNVS+C PG+            
Sbjct: 176 PDIRGPEEAAAYLTKLRQILRYLGTCNGDMQSGAMRADVNVSICLPGQYEKYQETQDFSH 235

Query: 231 WGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDA 290
            GTRCE+KN+NS+RF+  AIE EA+RQIAI+E GG + QETRLFDP K ETRS+R+KE+A
Sbjct: 236 LGTRCEIKNMNSMRFIQQAIEVEAKRQIAIVEAGGEVVQETRLFDPDKQETRSMRSKEEA 295

Query: 291 LDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIA 350
            DYRYF +PDLLPL I++ ++  I   +PELPDAK+ RFI +FG+S YDASVL SD   A
Sbjct: 296 HDYRYFPDPDLLPLVIEQAWVDDIGANLPELPDAKKARFINDFGLSDYDASVLTSDLDSA 355

Query: 351 DYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKI 410
            YFE  A  RD K+ ANWVIN+L G L +  K+I D+P+SP QLG +IDLI    ISGKI
Sbjct: 356 GYFEATAQGRDGKMAANWVINELFGRLKKDEKAITDSPVSPAQLGGVIDLIASDAISGKI 415

Query: 411 AKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSW 470
           AKD+F I++ +GG P  IVEE G++QVTD SAIE  VDE+I +NP+ VA+    P L  W
Sbjct: 416 AKDLFEIVYTEGGDPAVIVEERGMKQVTDTSAIEAAVDEIIAANPDQVAKARENPKLAGW 475

Query: 471 FVGQVMKNTGGKANPSIVQKMLKEKL 496
           FVGQ MK TGGKANP  V +++ +KL
Sbjct: 476 FVGQTMKATGGKANPKAVNQIVAQKL 501


>gi|260434225|ref|ZP_05788196.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260418053|gb|EEX11312.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 503

 Score =  607 bits (1564), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 294/508 (57%), Positives = 376/508 (74%), Gaps = 17/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L   + + +++ +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ VSF D
Sbjct: 1   MLDLTYELPKPKTI-AGAKHDWELVIGMEVHAQVSSNAKLFSGASTKFGAEPNSNVSFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPVINEFCVEQAVRTGLGLKAQINLKSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G    G  R +   IERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV+
Sbjct: 120 EGEVLVELG---DGTARMVR--IERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA---------- 230
           +PD+R   EA A++ KLR I+RYLGTCDGNM+ G++RADVNVS+CRPG+           
Sbjct: 175 RPDIRGPEEAAAYIAKLRQIMRYLGTCDGNMQNGNLRADVNVSICRPGDYEKYMETQDFS 234

Query: 231 -WGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIE EARRQIAI+E GG + QETRL+DP K ETRS+R+KE+
Sbjct: 235 YLGTRCEIKNMNSMRFIQQAIEVEARRQIAIVEAGGKVEQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I  ++PELPD K+ RFI +FG++ YDASVL ++   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAAKLPELPDEKKARFIKDFGLTDYDASVLTAEVES 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE++A  R+ K+ ANWVIN+L G L +  + I D+P+SP QLG +IDLI    ISGK
Sbjct: 355 AVYFEEVAKGRNGKLAANWVINELFGRLKKDDRDITDSPVSPAQLGGIIDLIASDAISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAK++F I++ +GG P +IVEE G++QVTD  AIE  +DE+I +NP  V +    P L  
Sbjct: 415 IAKELFEIVYTEGGDPAQIVEERGMKQVTDTGAIEAALDEIIAANPAQVEKAKVNPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           WFVGQVMK TGGKANP  V +++ +KLG
Sbjct: 475 WFVGQVMKATGGKANPKAVNQLVAQKLG 502


>gi|295690142|ref|YP_003593835.1| glutamyl-tRNA(Gln) amidotransferase, subunit B [Caulobacter segnis
           ATCC 21756]
 gi|295432045|gb|ADG11217.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Caulobacter segnis
           ATCC 21756]
          Length = 498

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 292/494 (59%), Positives = 371/494 (75%), Gaps = 16/494 (3%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WE+V+G+EVHAQ++  SKLFSGA+V FGA PN QVS  DAAMPGMLP+LN  CV+
Sbjct: 10  GRTGPWEMVLGLEVHAQVASKSKLFSGAAVGFGAGPNEQVSLVDAAMPGMLPVLNRFCVE 69

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ D+PIVGEG V+V     +    
Sbjct: 70  QAVKTGLGLKAQINLKSRFDRKNYFYPDLPQGYQISQFDQPIVGEGVVTV-----ERDDG 124

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            T +V IER+HLEQDAGKS+HDQ    + +DLNR+G ALMEIV+KPDMR+S EA A++ K
Sbjct: 125 TTFDVRIERLHLEQDAGKSLHDQDPNATYVDLNRAGTALMEIVSKPDMRTSEEAAAYVKK 184

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNSIRF 245
           LR+IL YLGTCDG+ME+G++RADVNVSVCRPG+             GTRCE+KNVNS R+
Sbjct: 185 LRTILVYLGTCDGDMEKGNLRADVNVSVCRPGDYEKFRATGDFKHLGTRCEIKNVNSYRY 244

Query: 246 LGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLE 305
           +  AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLPL 
Sbjct: 245 IQQAIEYEARRQIEILEDGGKIDQETRLFDPNKGETRSMRSKEEAHDYRYFPDPDLLPLV 304

Query: 306 IDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIV 365
           +D  ++++I++ +PELPDAK+ R   ++G+S YDA VL+ D   ADYFE  A  RD K+V
Sbjct: 305 LDPAWVKSIEQTLPELPDAKKARLQSQYGLSAYDAGVLIIDADRADYFEAAAKGRDAKLV 364

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ANWV N+LL  L+ +G +  D+P+  + + +L++LI +GTIS KIAK++F  +W   G P
Sbjct: 365 ANWVTNELLAKLSAAGTAFTDSPLPSSDITQLVELIENGTISSKIAKEVFEHMWAGEGRP 424

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANP 485
            EIVE+ GL Q+ D  AIEK +D++I  NP+    +  KP  + WFVGQVMK TGGKANP
Sbjct: 425 AEIVEKRGLVQINDTGAIEKAIDDLIAGNPDKAEAVKDKPQALGWFVGQVMKATGGKANP 484

Query: 486 SIVQKMLKEKLGIK 499
           + V ++L++KLG++
Sbjct: 485 ATVNELLRKKLGVE 498


>gi|163732110|ref|ZP_02139556.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter
           litoralis Och 149]
 gi|161394408|gb|EDQ18731.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter
           litoralis Och 149]
          Length = 503

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 298/503 (59%), Positives = 366/503 (72%), Gaps = 16/503 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T+   +  + SG   DWE+VIG+EVHAQ++  +KLFS AS  FGAEPN  VSF DAAMPG
Sbjct: 5   TYETPAPKVISGAKHDWELVIGMEVHAQVNSAAKLFSAASTQFGAEPNNNVSFVDAAMPG 64

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP +N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVGEG+V 
Sbjct: 65  MLPTINEFCVEQAVRTGLGLKAEINLHSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVL 124

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V +G    G  R + V  ERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV++PD+R
Sbjct: 125 VEMG---DGTARLVRV--ERIHLEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVSRPDIR 179

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTR 234
              EA A+L KLR ILRYLGTC+G+M+ G+MRADVNVS+CR G+             GTR
Sbjct: 180 GPEEAAAYLAKLRQILRYLGTCNGDMQSGAMRADVNVSICRAGQYEKYQATQDFSHLGTR 239

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KN+NS+RF+  AI+ EARRQIAI+E GG I QETRL+DP KNETRS+R+KE+A DYR
Sbjct: 240 CEIKNMNSMRFIQQAIDVEARRQIAIVEAGGTIDQETRLYDPDKNETRSMRSKEEAHDYR 299

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPLEI++ ++  I   +PELPDAK+ RF  +FG+S YDASVL +D   + YFE
Sbjct: 300 YFPDPDLLPLEIEQAWVDDIAANLPELPDAKKARFRDDFGLSDYDASVLTADLDSSGYFE 359

Query: 355 KLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDI 414
            +A  RD K+ ANWVIN+L G L +   +I D+P+SP QLG +IDLI    ISGKIAKD+
Sbjct: 360 AVAAGRDGKMAANWVINELFGRLKKEDHAITDSPVSPAQLGGIIDLIASDAISGKIAKDV 419

Query: 415 FNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQ 474
           F I +  G  P EIVE  G++QVTD  AIE  VDE+I +NP+ VA+    P L  WFVGQ
Sbjct: 420 FEICYTTGRDPAEIVETEGMKQVTDTGAIEAAVDEIIAANPDQVAKARENPKLAGWFVGQ 479

Query: 475 VMKNTGGKANPSIVQKMLKEKLG 497
           VMK TGGKANP  V +++ +KL 
Sbjct: 480 VMKATGGKANPKAVNQLVAKKLA 502


>gi|304570811|ref|YP_002517891.2| aspartyl/glutamyl-tRNA amidotransferase subunit B [Caulobacter
           crescentus NA1000]
          Length = 503

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 292/494 (59%), Positives = 369/494 (74%), Gaps = 16/494 (3%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TGDWE+V+G+EVHAQ++  SKLFSGA+V FGA PN QVS  DAAMPGMLP+LN  CV+
Sbjct: 15  GRTGDWEMVLGLEVHAQVASKSKLFSGAAVGFGAGPNEQVSLVDAAMPGMLPVLNRFCVE 74

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ D+PIVGEG VSV     +    
Sbjct: 75  QAVKTGLGLRAQINLKSRFDRKNYFYPDLPQGYQISQFDQPIVGEGVVSV-----ERDDG 129

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            T +V IER+HLEQDAGKS+HDQ    + +DLNR+G ALMEIV+KPDMR+S EA A++ K
Sbjct: 130 TTFDVRIERLHLEQDAGKSLHDQDPNATYVDLNRAGTALMEIVSKPDMRTSEEAAAYVKK 189

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNSIRF 245
           LR+IL YLGTCDG+ME+G++RADVNVSVCRPG+             GTRCE+KNVNS R+
Sbjct: 190 LRTILVYLGTCDGDMEKGNLRADVNVSVCRPGDYEKFRATGDFKHLGTRCEIKNVNSYRY 249

Query: 246 LGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLE 305
           +  AIEYEARRQI ILEDGG + QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLPL 
Sbjct: 250 IQQAIEYEARRQIEILEDGGKVDQETRLFDPTKGETRSMRSKEEAHDYRYFPDPDLLPLV 309

Query: 306 IDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIV 365
           +D  ++++I++ +PELPDAK+ R   ++G+S YDA VL+ D   ADYFE  A  RD K+V
Sbjct: 310 LDPAWVKSIEETLPELPDAKKARLQSQYGLSAYDAGVLIIDADRADYFEAAAKGRDAKLV 369

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ANWV N+LL  L+ +G    ++P+    + +L++LI +GTIS KIAK++F  +W   G P
Sbjct: 370 ANWVTNELLAKLSAAGTEFTNSPLPHTDIAQLVELIENGTISSKIAKEVFEHMWAGEGRP 429

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANP 485
            EIVE+ GL Q+ D  AIEK +D++I  NP+    +  KP  + WFVGQVMK TGGKANP
Sbjct: 430 AEIVEKRGLVQINDTGAIEKAIDDLIAGNPDKAEAVKDKPQALGWFVGQVMKATGGKANP 489

Query: 486 SIVQKMLKEKLGIK 499
             V ++L++KLG++
Sbjct: 490 GTVNELLRKKLGVE 503


>gi|163746154|ref|ZP_02153513.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Oceanibulbus
           indolifex HEL-45]
 gi|161380899|gb|EDQ05309.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Oceanibulbus
           indolifex HEL-45]
          Length = 504

 Score =  606 bits (1562), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 298/507 (58%), Positives = 371/507 (73%), Gaps = 19/507 (3%)

Query: 2   VSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDA 61
           +S DT   R   + +G   DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F DA
Sbjct: 4   LSYDTPKPR---VIAGAKHDWELVIGMEVHAQVASNAKLFSGASTQFGAEPNSNVAFVDA 60

Query: 62  AMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGE 121
           AMPGMLP++N  C++QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ  +PIVGE
Sbjct: 61  AMPGMLPVINEYCIEQAVRTGLGLKAEINLKSAFDRKNYFYPDLPQGYQISQLYEPIVGE 120

Query: 122 GKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTK 181
           G+V V +G    G  R +   IERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV++
Sbjct: 121 GEVLVELG---DGTARLVR--IERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVSR 175

Query: 182 PDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------A 230
           PD+R   EA A+L+KLR ILRYLGTC+G+M+ G+MRADVNVS+CR G+            
Sbjct: 176 PDIRGPEEAAAYLSKLRQILRYLGTCNGDMQSGAMRADVNVSICRVGQYEKYQETQDFSH 235

Query: 231 WGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDA 290
            GTRCE+KN+NS+RF+  AIE EA+RQIAI+E GG + QETRLFDP K ETRS+R+KE+A
Sbjct: 236 LGTRCEIKNMNSMRFIQQAIEVEAKRQIAIVEAGGEVVQETRLFDPDKQETRSMRSKEEA 295

Query: 291 LDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIA 350
            DYRYF +PDLLPLEI++ ++  I   +PELPD K+ RFIG+FG+S YDASVL +D   A
Sbjct: 296 HDYRYFPDPDLLPLEIEQAWVDEIAANLPELPDQKKARFIGDFGLSDYDASVLTADLDSA 355

Query: 351 DYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKI 410
            YFE +A  RD K+ ANWVIN+L G L +  K+I D+P+SP QLG ++DLI    ISGKI
Sbjct: 356 GYFEAVAQGRDGKMAANWVINELFGRLKKDDKNITDSPVSPAQLGAIVDLIASDAISGKI 415

Query: 411 AKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSW 470
           AK++F I +  G  P EIVE  GL+QVTD  AIE  VDE+I +NP+ VA+    P L  W
Sbjct: 416 AKEVFEITYTTGRDPAEIVETEGLKQVTDTGAIETAVDEIIAANPDQVAKAQQNPKLAGW 475

Query: 471 FVGQVMKNTGGKANPSIVQKMLKEKLG 497
           FVGQVMK TGGKANP  V +++  KL 
Sbjct: 476 FVGQVMKATGGKANPKAVNEIVSRKLA 502


>gi|16126675|ref|NP_421239.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Caulobacter
           crescentus CB15]
 gi|24418431|sp|Q9A5L1|GATB_CAUCR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|13423981|gb|AAK24407.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Caulobacter
           crescentus CB15]
 gi|220964627|gb|ACL95983.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Caulobacter crescentus NA1000]
          Length = 498

 Score =  606 bits (1562), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 292/494 (59%), Positives = 369/494 (74%), Gaps = 16/494 (3%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TGDWE+V+G+EVHAQ++  SKLFSGA+V FGA PN QVS  DAAMPGMLP+LN  CV+
Sbjct: 10  GRTGDWEMVLGLEVHAQVASKSKLFSGAAVGFGAGPNEQVSLVDAAMPGMLPVLNRFCVE 69

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ D+PIVGEG VSV     +    
Sbjct: 70  QAVKTGLGLRAQINLKSRFDRKNYFYPDLPQGYQISQFDQPIVGEGVVSV-----ERDDG 124

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            T +V IER+HLEQDAGKS+HDQ    + +DLNR+G ALMEIV+KPDMR+S EA A++ K
Sbjct: 125 TTFDVRIERLHLEQDAGKSLHDQDPNATYVDLNRAGTALMEIVSKPDMRTSEEAAAYVKK 184

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNSIRF 245
           LR+IL YLGTCDG+ME+G++RADVNVSVCRPG+             GTRCE+KNVNS R+
Sbjct: 185 LRTILVYLGTCDGDMEKGNLRADVNVSVCRPGDYEKFRATGDFKHLGTRCEIKNVNSYRY 244

Query: 246 LGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLE 305
           +  AIEYEARRQI ILEDGG + QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLPL 
Sbjct: 245 IQQAIEYEARRQIEILEDGGKVDQETRLFDPTKGETRSMRSKEEAHDYRYFPDPDLLPLV 304

Query: 306 IDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIV 365
           +D  ++++I++ +PELPDAK+ R   ++G+S YDA VL+ D   ADYFE  A  RD K+V
Sbjct: 305 LDPAWVKSIEETLPELPDAKKARLQSQYGLSAYDAGVLIIDADRADYFEAAAKGRDAKLV 364

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ANWV N+LL  L+ +G    ++P+    + +L++LI +GTIS KIAK++F  +W   G P
Sbjct: 365 ANWVTNELLAKLSAAGTEFTNSPLPHTDIAQLVELIENGTISSKIAKEVFEHMWAGEGRP 424

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANP 485
            EIVE+ GL Q+ D  AIEK +D++I  NP+    +  KP  + WFVGQVMK TGGKANP
Sbjct: 425 AEIVEKRGLVQINDTGAIEKAIDDLIAGNPDKAEAVKDKPQALGWFVGQVMKATGGKANP 484

Query: 486 SIVQKMLKEKLGIK 499
             V ++L++KLG++
Sbjct: 485 GTVNELLRKKLGVE 498


>gi|254459535|ref|ZP_05072951.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodobacterales bacterium HTCC2083]
 gi|206676124|gb|EDZ40611.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 503

 Score =  606 bits (1562), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 297/493 (60%), Positives = 362/493 (73%), Gaps = 16/493 (3%)

Query: 16  SGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCV 75
           +G   DWE+VIG+EVHAQ++  SKLFS AS  FGAEPN+ V+F DAAMPGMLP++N  CV
Sbjct: 15  AGAKHDWELVIGMEVHAQVASNSKLFSAASTKFGAEPNSNVAFVDAAMPGMLPVINEFCV 74

Query: 76  QQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQ 135
           +QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVGEG++ V + P  + +
Sbjct: 75  EQAVRTGLGLKAEINLFSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEIIVDLEPGIARR 134

Query: 136 FRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
            R     IERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV++PD+R   EA AF+ 
Sbjct: 135 VR-----IERIHLEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVSRPDIRGPEEAAAFVV 189

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNSIR 244
           KLR ILRYLGTCDGNM+ GSMRADVNVSVC PG+             GTRCE+KN+NS+R
Sbjct: 190 KLRQILRYLGTCDGNMQSGSMRADVNVSVCLPGQYEKFIETGDFGHLGTRCEIKNMNSMR 249

Query: 245 FLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPL 304
           F+  AI+ EA+RQIAI+E GG + QETRL+DP K ETRS+R+KE+A DYRYF +PDLLPL
Sbjct: 250 FIQQAIDVEAKRQIAIIEAGGKVEQETRLYDPDKGETRSMRSKEEAHDYRYFPDPDLLPL 309

Query: 305 EIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKI 364
           EI++ ++  I K +PELPD K+ RF+  FG+S YDASVL +D   A YFE +A NRD K+
Sbjct: 310 EIEQAWVDDIAKTLPELPDEKKARFVTSFGLSEYDASVLTADVESAGYFESVAENRDGKL 369

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G L    K I   PI+P QLG +IDLI   TISGKIAKD+F I++ +GG 
Sbjct: 370 AANWVINELFGRLKSDEKDIITCPITPAQLGGIIDLIKADTISGKIAKDLFEIVYTEGGN 429

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P +IVE  G++QVTD  AIE  VD++I  NP  VA+    P L  WFVGQVMK TGGKAN
Sbjct: 430 PADIVEARGMKQVTDTGAIEAAVDQIIADNPAQVAKAKENPKLAGWFVGQVMKATGGKAN 489

Query: 485 PSIVQKMLKEKLG 497
           P  V +++  KL 
Sbjct: 490 PKAVNQIIAAKLA 502


>gi|167645488|ref|YP_001683151.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Caulobacter sp.
           K31]
 gi|167347918|gb|ABZ70653.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Caulobacter sp.
           K31]
          Length = 499

 Score =  605 bits (1561), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 293/504 (58%), Positives = 372/504 (73%), Gaps = 17/504 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T  A S+ +  G TG WE+V+G+E+HAQ++ VSKLFSGA+V FGA PN QVS  DAAMPG
Sbjct: 2   TETASSKQI-QGRTGPWEIVLGLEIHAQVASVSKLFSGAAVGFGAGPNQQVSLVDAAMPG 60

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP+LNG CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ D+PIVGEG V+
Sbjct: 61  MLPVLNGFCVEQAVKTGLGLKAQINLKSRFDRKNYFYPDLPQGYQISQFDQPIVGEGVVT 120

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V     +     T +VGIER+HLEQDAGKSIHD     + +DLNR+G ALMEIV+KP MR
Sbjct: 121 V-----ERDDGTTFDVGIERLHLEQDAGKSIHDIDPNATYVDLNRAGTALMEIVSKPHMR 175

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTR 234
           S+ EA A++ K+R+IL YLGTCDG+ME+G++RADVNVSVCRPG+             GTR
Sbjct: 176 SAEEAAAYVKKIRTILVYLGTCDGDMEKGNLRADVNVSVCRPGDYEKFRETGSFSHLGTR 235

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KNVNS R++  AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KE+A DYR
Sbjct: 236 CEIKNVNSYRYIQQAIEYEARRQIEILEDGGKIDQETRLFDPTKVETRSMRSKEEAHDYR 295

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPL +D D+++ I+  +PELPDAK+ R   ++G+S YDA VL+ +   ADYFE
Sbjct: 296 YFPDPDLLPLVLDADWVKRIQDTLPELPDAKKARLQSQYGLSAYDAGVLIIESHRADYFE 355

Query: 355 KLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDI 414
             AV RD K+V+NWV N+LL  L+  G  I  +P+  + + +L++LI +GTIS KIAK++
Sbjct: 356 AAAVGRDAKLVSNWVTNELLSKLSAHGHEIAASPLPSSDIAQLVELIENGTISSKIAKEV 415

Query: 415 FNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQ 474
           F  +W   G P +IVE  GL Q+ D  AIE  +D +I +NP+  + +  KP  + WFVGQ
Sbjct: 416 FEHMWAGEGRPAQIVETRGLVQINDTGAIEAAIDALIAANPDKASAVKEKPQAIGWFVGQ 475

Query: 475 VMKNTGGKANPSIVQKMLKEKLGI 498
           VMK TGGKANP+ V ++L+ KLG+
Sbjct: 476 VMKETGGKANPATVNELLRSKLGL 499


>gi|126740324|ref|ZP_01756012.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter sp.
           SK209-2-6]
 gi|126718460|gb|EBA15174.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter sp.
           SK209-2-6]
          Length = 504

 Score =  605 bits (1560), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 296/496 (59%), Positives = 367/496 (73%), Gaps = 17/496 (3%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FG EPN+ VSF DAAMPGMLP++N  
Sbjct: 13  VIAGAKHDWELVIGMEVHAQVSSKAKLFSGASTKFGNEPNSNVSFVDAAMPGMLPVINEY 72

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVGEG+V V +G    
Sbjct: 73  CVEQAVRTGLGLKAEINLWSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVLVELG---D 129

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G  R + V  ERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV++PD+R   EA A+
Sbjct: 130 GTARNVRV--ERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVSRPDIRGPEEAAAY 187

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPG-----------EAWGTRCEVKNVNS 242
           + KLR I+RYLGTCDGNM+ G++RADVNVS+C PG              GTRCE+KN+NS
Sbjct: 188 IAKLRQIMRYLGTCDGNMQNGNLRADVNVSICLPGAYEKYQETQDFSHLGTRCEIKNMNS 247

Query: 243 IRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLL 302
           +RF+  AIE EARRQIAI+E GG + QETRL+DP K ETRS+R+KE+A DYRYF +PDLL
Sbjct: 248 MRFIQQAIEVEARRQIAIVEGGGKVDQETRLYDPDKGETRSMRSKEEAHDYRYFPDPDLL 307

Query: 303 PLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK 362
           PLEI++D++  I   +PELPD K+ RFIG+FG+S YDASVL +D   A YFE +A  R+ 
Sbjct: 308 PLEIEQDWVDGIAASLPELPDEKKARFIGDFGLSDYDASVLTADVESAAYFEAVAEGRNG 367

Query: 363 KIVANWVINDLLGVLNR-SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK 421
           K+ ANWVIN+L G L +   K+I D+P+SP QLG +IDLI    ISGKIAKD+F I++ +
Sbjct: 368 KLAANWVINELFGRLKKDEDKTITDSPVSPVQLGGIIDLISSDAISGKIAKDLFEIVYTE 427

Query: 422 GGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGG 481
           GG P EIVE  G++QVTD  AIE  +DE+I +NP  V +    P L  WFVGQVMK TGG
Sbjct: 428 GGDPAEIVEARGMKQVTDTGAIETALDEIIAANPAQVEKAKVNPKLAGWFVGQVMKATGG 487

Query: 482 KANPSIVQKMLKEKLG 497
           KANP  V +++ +KLG
Sbjct: 488 KANPKAVNELVAKKLG 503


>gi|159043756|ref|YP_001532550.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Dinoroseobacter
           shibae DFL 12]
 gi|189045278|sp|A8LI95|GATB_DINSH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|157911516|gb|ABV92949.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Dinoroseobacter
           shibae DFL 12]
          Length = 505

 Score =  605 bits (1559), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 298/504 (59%), Positives = 367/504 (72%), Gaps = 17/504 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T+      + +G   DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F DA MPG
Sbjct: 5   TYETPKPKVIAGAREDWELVIGLEVHAQVATNAKLFSGASTLFGAEPNSNVAFVDAGMPG 64

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  CV QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVGEG+V 
Sbjct: 65  MLPVINEECVAQAVRTGLGLKAAINLTSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVL 124

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V +G    G  R +   IERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV++PD+R
Sbjct: 125 VELG---DGTARVVR--IERIHLEQDAGKSIHDMDPHMSFVDLNRTGVALMEIVSRPDIR 179

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTR 234
              EA A+++KLR I+RYLGTCDGNM+ G++RADVNVSVCRPG+             GTR
Sbjct: 180 GPEEAAAYVSKLRQIMRYLGTCDGNMQNGNLRADVNVSVCRPGDYEKYQASQDFSHLGTR 239

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KN+NS+RF+  AIEYEARRQIAI+EDGG + QETRL+DP K ETRS+R+KE+A DYR
Sbjct: 240 CEIKNMNSLRFIQQAIEYEARRQIAIIEDGGSVTQETRLYDPDKGETRSMRSKEEAHDYR 299

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPLEI++ ++  I   +PELPDAK+ RFI EFG+S YDASVL +D + A YFE
Sbjct: 300 YFPDPDLLPLEIEQAWVDDIAAALPELPDAKKARFITEFGLSDYDASVLTADTTNAAYFE 359

Query: 355 KLAVNR-DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKD 413
            +A    D K+ ANWVIN+L G L +    I ++P+SP QL  +I LI    ISGKIAKD
Sbjct: 360 AVAGEAGDGKLAANWVINELFGRLKKEDHDITESPVSPAQLAGIIKLIKADAISGKIAKD 419

Query: 414 IFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVG 473
           +F I++ +GG P EIVE  G++QVTD  AIE  VDE+I +NP  VA+    P L  WFVG
Sbjct: 420 LFEIVYTEGGDPAEIVEARGMKQVTDTGAIEAAVDEIIAANPAQVAKAQENPKLAGWFVG 479

Query: 474 QVMKNTGGKANPSIVQKMLKEKLG 497
           QVMK TGGKANP  V +++  KL 
Sbjct: 480 QVMKATGGKANPKAVNQIVAAKLA 503


>gi|254466376|ref|ZP_05079787.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodobacterales bacterium Y4I]
 gi|206687284|gb|EDZ47766.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodobacterales bacterium Y4I]
          Length = 503

 Score =  605 bits (1559), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 291/495 (58%), Positives = 366/495 (73%), Gaps = 16/495 (3%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F DAAMPGMLP++N  
Sbjct: 13  VIAGAKHDWELVIGMEVHAQVSSNAKLFSGASTKFGAEPNSNVAFVDAAMPGMLPVINEF 72

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVGEG+V V +G   +
Sbjct: 73  CVEQAVRTGLGLKADINLWSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVLVELGDGTA 132

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
            + R     IERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV++PD+R   EA A+
Sbjct: 133 RKVR-----IERIHMEQDAGKSIHDMDPHMSFVDLNRTGVCLMEIVSRPDIRGPEEAAAY 187

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNS 242
           + KLR I++YLGTCDGNM+ G++RADVNVSVC PG+             GTRCE+KN+NS
Sbjct: 188 IAKLRQIMQYLGTCDGNMQNGNLRADVNVSVCLPGQYEKYQETQDFSHLGTRCEIKNMNS 247

Query: 243 IRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLL 302
           +RF+  A E EARRQIAILE GG I QETRL+DP K ETRS+R+KE+A DYRYF +PDLL
Sbjct: 248 MRFIQQATEVEARRQIAILESGGEIVQETRLYDPDKGETRSMRSKEEAHDYRYFPDPDLL 307

Query: 303 PLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK 362
           PLEI++D++  I   +PELPD K+ RFI +FG+S YDASVL +D   A +FE+ A  R  
Sbjct: 308 PLEIEQDWVDGIAASLPELPDEKKARFINDFGLSDYDASVLTADVESATFFEETAKGRSG 367

Query: 363 KIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG 422
           K+ ANWVIN+L G L +   +I ++P++P QLG +IDLI    ISGKIAKD+F I++ +G
Sbjct: 368 KLAANWVINELFGRLKKEDHTITESPVTPAQLGGIIDLIASDAISGKIAKDLFEIVYTEG 427

Query: 423 GTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGK 482
           G P +IVEE G++QVTD  AIE  +DE+I +NP  V +    P L  WFVGQVMK TGGK
Sbjct: 428 GDPAQIVEERGMKQVTDTGAIETALDEIIAANPAQVEKAKVNPKLAGWFVGQVMKATGGK 487

Query: 483 ANPSIVQKMLKEKLG 497
           ANP  V +++ +KLG
Sbjct: 488 ANPKAVNELVAKKLG 502


>gi|86137653|ref|ZP_01056230.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter sp.
           MED193]
 gi|85825988|gb|EAQ46186.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter sp.
           MED193]
          Length = 503

 Score =  603 bits (1556), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 293/495 (59%), Positives = 366/495 (73%), Gaps = 16/495 (3%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           + SG   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ VSF DAAMPGMLP++N  
Sbjct: 13  VISGAKHDWELVIGMEVHAQVSSNAKLFSGASTKFGAEPNSNVSFVDAAMPGMLPVINEY 72

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVGEG+V V +G    
Sbjct: 73  CVEQAVRTGLGLKAEINLWSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVLVELG---D 129

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G  RT+ V  ERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV++PD+R   EA A+
Sbjct: 130 GTARTVRV--ERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVSRPDIRGPEEAAAY 187

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNS 242
           + K+R IL+YLGTCDGNM+ G++RADVNVSVCRPG+             GTRCE+KN+NS
Sbjct: 188 IAKIRQILKYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFGHLGTRCEIKNMNS 247

Query: 243 IRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLL 302
           +RF+  AIE EARRQIAI+E GG + QETRL+DP K ETRS+R+KE+A DYRYF +PDLL
Sbjct: 248 MRFIQQAIEIEARRQIAIIEAGGEVDQETRLYDPDKGETRSMRSKEEAHDYRYFPDPDLL 307

Query: 303 PLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK 362
           PLEI++ ++  I   +PELPDAK+ RFI +F +S YDASVL +D   A YFE +A  R+ 
Sbjct: 308 PLEIEQAWVDDIAANLPELPDAKKARFIADFKLSDYDASVLTADVESAAYFEAVAEGRNG 367

Query: 363 KIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG 422
           K+ ANWVIN+L G L      I ++P++P QLG +++LI   TISGKIAKD+F I++  G
Sbjct: 368 KLAANWVINELFGRLKADEADIANSPVTPAQLGGIVELISAETISGKIAKDLFEIVYTTG 427

Query: 423 GTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGK 482
           G P +IVEE G++QVTD  AIE  +D++I  NP  V +    P L  WFVGQVMK TGGK
Sbjct: 428 GDPAQIVEERGMKQVTDTGAIEAALDQIIADNPAQVEKAKVNPKLAGWFVGQVMKATGGK 487

Query: 483 ANPSIVQKMLKEKLG 497
           ANP  V +++ +KLG
Sbjct: 488 ANPKAVNQLVAQKLG 502


>gi|254476166|ref|ZP_05089552.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ruegeria sp. R11]
 gi|214030409|gb|EEB71244.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ruegeria sp. R11]
          Length = 503

 Score =  603 bits (1555), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 292/495 (58%), Positives = 367/495 (74%), Gaps = 16/495 (3%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F DAAMPGMLP++N  
Sbjct: 13  VIAGAKHDWELVIGMEVHAQVSSNAKLFSGASTKFGAEPNSNVAFVDAAMPGMLPVINEY 72

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVGEG+V V +G    
Sbjct: 73  CVEQAVRTGLGLKAEINLWSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVLVELG---D 129

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G  R + V  ERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV++PD+R   EA A+
Sbjct: 130 GTARLVRV--ERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVSRPDIRGPEEAAAY 187

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNS 242
           + KLR I++YLGTCDGNM+ G++RADVNVS+CRPG+             GTRCE+KN+NS
Sbjct: 188 IAKLRQIMQYLGTCDGNMQNGNLRADVNVSICRPGQYEKYQETGDFSHLGTRCEIKNMNS 247

Query: 243 IRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLL 302
           +RF+  AIE EARRQIAI+E GG + QETRL+DP K ETRS+R+KE+A DYRYF +PDLL
Sbjct: 248 MRFIQQAIEVEARRQIAIVEAGGTVDQETRLYDPDKGETRSMRSKEEAHDYRYFPDPDLL 307

Query: 303 PLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK 362
           PLEI++ ++  I   +PELPD K+ RFI +FG+S YDASVL +D   A +FE+ A  R  
Sbjct: 308 PLEIEQAWVDDIAANLPELPDEKKARFINDFGLSDYDASVLTADVESAAFFEETAKGRSG 367

Query: 363 KIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG 422
           K+ ANWVIN+L G L +   SI ++P+SP QLG +IDLI    ISGKIAKD+F I++ +G
Sbjct: 368 KLAANWVINELFGRLKKEDHSITESPVSPAQLGGIIDLISSDAISGKIAKDLFEIVYTEG 427

Query: 423 GTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGK 482
           G P +IVEE G++QVTD  AIE  +DE+I +NP  V +    P L  WFVGQVMK TGGK
Sbjct: 428 GDPAQIVEERGMKQVTDTGAIEAALDEIIAANPAQVEKAKVNPKLAGWFVGQVMKATGGK 487

Query: 483 ANPSIVQKMLKEKLG 497
           ANP  V +++ +KLG
Sbjct: 488 ANPKAVNELVAKKLG 502


>gi|163741547|ref|ZP_02148938.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Phaeobacter
           gallaeciensis 2.10]
 gi|161385281|gb|EDQ09659.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Phaeobacter
           gallaeciensis 2.10]
          Length = 504

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 294/496 (59%), Positives = 368/496 (74%), Gaps = 17/496 (3%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F DAAMPGMLP++N  
Sbjct: 13  VIAGAKHDWELVIGMEVHAQVSSNAKLFSGASTKFGAEPNSNVAFVDAAMPGMLPVINDY 72

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVGEG+V V +G    
Sbjct: 73  CVEQAVRTGLGLKADINLWSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVLVELG---D 129

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G  R + V  ERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV++PD+R   EA A+
Sbjct: 130 GTARNVRV--ERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVSRPDIRGPEEAAAY 187

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNS 242
           + KLR I++YLGTCDGNM+ G++RADVNVSVCRPG+             GTRCE+KN+NS
Sbjct: 188 IAKLRQIMQYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFSHLGTRCEIKNMNS 247

Query: 243 IRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLL 302
           +RF+  AI+ EARRQIAI+E GG I QETRL+DP K ETRS+R+KE+A DYRYF +PDLL
Sbjct: 248 MRFIQQAIDVEARRQIAIIEAGGTIDQETRLYDPDKGETRSMRSKEEAHDYRYFPDPDLL 307

Query: 303 PLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK 362
           PLEI++ ++  I   +PELPD K+ RFI +FG+S YDASVL +D   A +FE+ A  R  
Sbjct: 308 PLEIEQAWVDDIAANLPELPDEKKARFIKDFGLSDYDASVLTADVESATFFEQTAKGRSG 367

Query: 363 KIVANWVINDLLGVLNR-SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK 421
           K+ ANWVIN+L G L +   K I D+P+SP QLG++IDLI    ISGKIAKD+F I++ +
Sbjct: 368 KLAANWVINELFGRLKKDEDKQITDSPVSPAQLGDIIDLISSDAISGKIAKDLFEIVYTE 427

Query: 422 GGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGG 481
           GG P +IVEE G++QVTD  AIE  +DE+I +NP  V +    P L  WFVGQVMK TGG
Sbjct: 428 GGDPAQIVEERGMKQVTDTGAIEAALDEIIAANPAQVEKAKVNPKLAGWFVGQVMKATGG 487

Query: 482 KANPSIVQKMLKEKLG 497
           KANP  V +++ +KLG
Sbjct: 488 KANPKAVNELVAKKLG 503


>gi|83949491|ref|ZP_00958224.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseovarius
           nubinhibens ISM]
 gi|83837390|gb|EAP76686.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseovarius
           nubinhibens ISM]
          Length = 503

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 292/504 (57%), Positives = 369/504 (73%), Gaps = 16/504 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T+      + +G   DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F DAAMPG
Sbjct: 5   TYDTPKPKVIAGAKQDWELVIGMEVHAQVASRAKLFSGASTQFGAEPNSNVAFVDAAMPG 64

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  CV+Q V TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVGEG++ 
Sbjct: 65  MLPVINEFCVEQTVRTGLGLKADINLKSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEIL 124

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V + P   G  R +   IERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV++PD+R
Sbjct: 125 VDLEP---GIARLVR--IERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVSRPDIR 179

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPG-----------EAWGTR 234
              EA A++ KLR ILRYLGTCDGNM+ G++RADVNVS+C+PG              GTR
Sbjct: 180 GPEEAAAYVGKLRQILRYLGTCDGNMQNGNLRADVNVSICQPGAYERFRETGDFSHLGTR 239

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KN+NS+RF+  AIE EARRQIAI+E GG + QETRL+DP +NETRS+R+KE+A DYR
Sbjct: 240 CEIKNMNSMRFIQAAIEVEARRQIAIVEAGGAVVQETRLYDPDRNETRSMRSKEEAHDYR 299

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPLEI++ ++  IK  +PELPD K+ RF+  FG+S YDASVL +D + A YFE
Sbjct: 300 YFPDPDLLPLEIEQAWVDEIKASLPELPDEKKARFVTAFGLSEYDASVLTADVANAAYFE 359

Query: 355 KLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDI 414
           + A +RD K+VANWVIN+L G L +  + I D P++P QLG ++DLI    ISGKIAKD+
Sbjct: 360 EAAQDRDGKLVANWVINELFGRLKKDDRDITDCPVTPAQLGGIVDLIASDAISGKIAKDL 419

Query: 415 FNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQ 474
           F I++ +GG P +IVEE G++QVTD  AIE  VD++I  NP  V +    P L  WFVGQ
Sbjct: 420 FEIVYTEGGDPAQIVEERGMKQVTDTGAIETAVDQIIADNPAQVEKAKQNPKLAGWFVGQ 479

Query: 475 VMKNTGGKANPSIVQKMLKEKLGI 498
           VMK TGGKANP  V +++  KLG+
Sbjct: 480 VMKATGGKANPKAVNEIVAAKLGL 503


>gi|114570252|ref|YP_756932.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Maricaulis maris MCS10]
 gi|114340714|gb|ABI65994.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Maricaulis maris MCS10]
          Length = 497

 Score =  602 bits (1553), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 296/491 (60%), Positives = 364/491 (74%), Gaps = 16/491 (3%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TGDWEVV+G+E+HAQ+   +KLFSGA+  FGA PNTQVS  DAAMPGMLP++N   V+
Sbjct: 10  GATGDWEVVMGLEIHAQVVSNAKLFSGAATAFGAAPNTQVSLVDAAMPGMLPVINSHVVE 69

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TGLGLNA IN  S F RKNYFYPDLPQGYQISQ   PIVGEG++      D   +F
Sbjct: 70  QAVRTGLGLNAQINLMSRFDRKNYFYPDLPQGYQISQFQFPIVGEGEIECE--RDDGSRF 127

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
               VGIER+HLEQDAGKSIHD     + +DLNRSGVALMEIV++P +RS  EA A++ K
Sbjct: 128 T---VGIERLHLEQDAGKSIHDLDPNSTYVDLNRSGVALMEIVSRPHIRSPEEASAYVAK 184

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNSIRF 245
           LR+ILRYLGTC G+ME+G +RADVNVSVCRPG+             GTRCE+KNVNS+RF
Sbjct: 185 LRTILRYLGTCGGDMEKGQLRADVNVSVCRPGQYEKFRETGDFSHLGTRCEIKNVNSLRF 244

Query: 246 LGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLE 305
           +  AIEYEA+RQI I+EDGG I QETRLFD +   TRS+R+KE+A DYRYF +PDLLPLE
Sbjct: 245 IRQAIEYEAQRQIDIIEDGGKIDQETRLFDANTGVTRSMRSKEEAHDYRYFPDPDLLPLE 304

Query: 306 IDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIV 365
           + + F+  IK  +PELPD KR R + E G+S YDA+VL +DK  ADY+E +A  RD K+ 
Sbjct: 305 LQQSFVDEIKAGLPELPDQKRARLVSELGLSDYDAAVLSADKDRADYYEIVAEGRDAKLA 364

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ++WV N+L G LN+ G  I D+P+S  QLG LI LI D TISGKIAKD+F ILW +GG P
Sbjct: 365 SSWVNNELYGRLNKEGLDITDSPVSATQLGGLIALISDDTISGKIAKDVFEILWSEGGDP 424

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANP 485
            +IV+E GL+QVTD  AIE V+D++I  NP+  A++  KP  + WFVGQVMK   GKANP
Sbjct: 425 AKIVDEKGLKQVTDTGAIEAVIDQLIADNPDQAAQVKEKPKTMGWFVGQVMKAMQGKANP 484

Query: 486 SIVQKMLKEKL 496
             V ++L++KL
Sbjct: 485 QAVNEILRKKL 495


>gi|89054357|ref|YP_509808.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Jannaschia sp.
           CCS1]
 gi|109892028|sp|Q28R79|GATB_JANSC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|88863906|gb|ABD54783.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Jannaschia sp. CCS1]
          Length = 503

 Score =  602 bits (1552), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 296/493 (60%), Positives = 357/493 (72%), Gaps = 16/493 (3%)

Query: 16  SGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCV 75
           +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F DA MPGMLP++N  CV
Sbjct: 15  AGAKQDWELVIGMEVHAQVSTRAKLFSGASTRFGAEPNSNVAFVDAGMPGMLPVINEACV 74

Query: 76  QQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQ 135
            QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVGEG+V V +G    G 
Sbjct: 75  SQAVRTGLGLKAQINLESAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVLVELG---DGL 131

Query: 136 FRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
            R +   IERIHLEQDAGKSIHD   A+S +DLNR+GVALMEIV+KPD+RS  EA A++ 
Sbjct: 132 ARLVR--IERIHLEQDAGKSIHDMDPALSFVDLNRTGVALMEIVSKPDIRSPEEAAAYVV 189

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNSIR 244
           KLR I+ YLGTCDGNM+ G++RADVNVS+C PG+             GTRCE+KN+NS+R
Sbjct: 190 KLRQIMLYLGTCDGNMQNGNLRADVNVSICAPGQYEKYQATQDFSHLGTRCEIKNMNSMR 249

Query: 245 FLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPL 304
           F+  AIE EA+RQIAI+E GG + QETRL+DP K ETRS+R+KE+A DYRYF +PDLLPL
Sbjct: 250 FIQQAIEVEAKRQIAIIEGGGTVDQETRLYDPDKGETRSMRSKEEAHDYRYFPDPDLLPL 309

Query: 305 EIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKI 364
             D+ ++ AI   +PELPDAK+ RFI  FG+S YDASVL +D   A YFE  A     K+
Sbjct: 310 TFDQAYVDAIAADLPELPDAKKARFIRGFGLSDYDASVLTADIDAAQYFEATATKDTGKL 369

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G L +  + IED+P++P QL  LI LI   TISGKIAKD+F I +  G  
Sbjct: 370 SANWVINELFGRLKKDERQIEDSPVAPAQLASLIALIASDTISGKIAKDVFEISYTTGRD 429

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P EIVE  GL+QVTD  AIE  VD++I  NP  VA+    P L  WFVGQVMK TGGKAN
Sbjct: 430 PSEIVETEGLKQVTDTGAIEAAVDQIIADNPAQVAKAQENPKLAGWFVGQVMKATGGKAN 489

Query: 485 PSIVQKMLKEKLG 497
           P  V +++ +KLG
Sbjct: 490 PKAVNQIVAQKLG 502


>gi|163738742|ref|ZP_02146156.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Phaeobacter
           gallaeciensis BS107]
 gi|161388070|gb|EDQ12425.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Phaeobacter gallaeciensis BS107]
          Length = 504

 Score =  601 bits (1550), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 294/496 (59%), Positives = 367/496 (73%), Gaps = 17/496 (3%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F DAAMPGMLP++N  
Sbjct: 13  VIAGAKHDWELVIGMEVHAQVSSNAKLFSGASTKFGAEPNSNVAFVDAAMPGMLPVINDY 72

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVGEG+V V +G    
Sbjct: 73  CVEQAVRTGLGLKADINLWSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVLVELG---D 129

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G  R + V  ERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV++PD+R   EA A+
Sbjct: 130 GTARNVRV--ERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVSRPDIRGPEEAAAY 187

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNS 242
           + KLR I++YLGTCDGNM+ G++RADVNVSVCRPG+             GTRCE+KN+NS
Sbjct: 188 IAKLRQIMQYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFSHLGTRCEIKNMNS 247

Query: 243 IRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLL 302
           +RF+  AI+ EARRQIAI+E GG I QETRL+DP K ETRS+R+KE+A DYRYF +PDLL
Sbjct: 248 MRFIQQAIDVEARRQIAIIEAGGTIDQETRLYDPDKGETRSMRSKEEAHDYRYFPDPDLL 307

Query: 303 PLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK 362
           PLEI++ ++  I   +PELPD K+ RFI +FG+S YDASVL +D   A +FE+ A  R  
Sbjct: 308 PLEIEQAWVDDIAANLPELPDEKKARFIKDFGLSDYDASVLTADVESATFFEQTAKGRSG 367

Query: 363 KIVANWVINDLLGVLNR-SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK 421
           K+ ANWVIN+L G L +   K I D+P+SP QLG +IDLI    ISGKIAKD+F I++ +
Sbjct: 368 KLAANWVINELFGRLKKDEDKQITDSPVSPAQLGGIIDLISSDAISGKIAKDLFEIVYTE 427

Query: 422 GGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGG 481
           GG P +IVEE G++QVTD  AIE  +DE+I +NP  V +    P L  WFVGQVMK TGG
Sbjct: 428 GGDPAQIVEERGMKQVTDTGAIEAALDEIIAANPAQVEKAKVNPKLAGWFVGQVMKATGG 487

Query: 482 KANPSIVQKMLKEKLG 497
           KANP  V +++ +KLG
Sbjct: 488 KANPKAVNELVAKKLG 503


>gi|260428477|ref|ZP_05782456.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Citreicella sp. SE45]
 gi|260422969|gb|EEX16220.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Citreicella sp. SE45]
          Length = 504

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 296/505 (58%), Positives = 372/505 (73%), Gaps = 17/505 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           ++ A    + +G   DWE+VIG+E+HAQ+S  +KLFSGAS  FGAEPN+ VSF DAAMPG
Sbjct: 5   SYEAPKPKVIAGAKHDWELVIGMEIHAQVSSQAKLFSGASTRFGAEPNSNVSFVDAAMPG 64

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVGEG+V 
Sbjct: 65  MLPVINEYCVEQAVRTGLGLKAQINLKSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVL 124

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V + P   G  R +   IERIH+EQDAGKSIHD    +S +DLNR+GVALMEIV++PD+R
Sbjct: 125 VDMEP---GIARLVR--IERIHIEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVSRPDIR 179

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTR 234
              EA A++ KLR ILRYLGTCDGNM+ G++RADVNVSVC PG              GTR
Sbjct: 180 GPEEAAAYVGKLRQILRYLGTCDGNMQNGNLRADVNVSVCLPGAYERYQETQDFGHLGTR 239

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KN+NS+RF+  AI+YEA+RQIAILE GG I QETRL+DP K ETRS+R+KE+A DYR
Sbjct: 240 CEIKNMNSMRFIQQAIDYEAKRQIAILEAGGSIDQETRLYDPDKGETRSMRSKEEAHDYR 299

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPLEI++ ++  I   +PELPDAK+ RF+ EFG+S YDA VL ++ + A YFE
Sbjct: 300 YFPDPDLLPLEIEQAWVDDIAASLPELPDAKKARFVTEFGLSEYDAGVLTAEVANAAYFE 359

Query: 355 KLAVNR-DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKD 413
           ++A +  D K+ ANWVIN+L G L +   SIED+P++P QL  +I LI    ISGKIAKD
Sbjct: 360 QVAGDAGDGKLAANWVINELFGRLKKEDHSIEDSPVTPAQLAGIIRLITSDAISGKIAKD 419

Query: 414 IFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVG 473
           +F I++ +GG P++IVEE G++QVTD  AIE  VDE+I +NP  V +    P L  WFVG
Sbjct: 420 LFEIVYTEGGDPEKIVEERGMKQVTDTGAIETAVDEIIAANPAQVEKAKQNPKLAGWFVG 479

Query: 474 QVMKNTGGKANPSIVQKMLKEKLGI 498
           QVMK TGGKANP  V +++  +LG+
Sbjct: 480 QVMKATGGKANPKAVNEIVAARLGL 504


>gi|83594505|ref|YP_428257.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodospirillum
           rubrum ATCC 11170]
 gi|109892058|sp|Q2RPH5|GATB_RHORT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|83577419|gb|ABC23970.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodospirillum rubrum ATCC 11170]
          Length = 485

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 303/485 (62%), Positives = 369/485 (76%), Gaps = 7/485 (1%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           L  G T  WEVV+G+EVHAQ+   SKLFSG+S  FGA  N+QVS  DAAMPGMLP++NG 
Sbjct: 4   LIKGETATWEVVVGLEVHAQVVSQSKLFSGSSTRFGAPANSQVSLVDAAMPGMLPVINGL 63

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV TGLGL A INK S+FARKNYFY DLPQGYQISQ+++PIVGEGKV + + PD S
Sbjct: 64  CVEQAVRTGLGLRAKINKRSIFARKNYFYADLPQGYQISQYEQPIVGEGKVVLDM-PDGS 122

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
            +    EVGIER+HLEQDAGKS+HDQ+   S IDLNRSGVALMEIV+KPDMR   EA A+
Sbjct: 123 SR----EVGIERLHLEQDAGKSMHDQHPTKSLIDLNRSGVALMEIVSKPDMREPEEAGAY 178

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEY 252
           L KLRSI+RYLGTCDGNMEEGSMRADVNVSV   G     TRCE+KNVNS+RF+  AIE 
Sbjct: 179 LRKLRSIMRYLGTCDGNMEEGSMRADVNVSVRPIGTTDLRTRCEIKNVNSVRFVMQAIEA 238

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           EA RQ+ + E GG +RQETRLFDP+K ETRS+R+KE A DYRYF +PDLLPLE D+ F+ 
Sbjct: 239 EAHRQVEVWESGGEVRQETRLFDPAKGETRSMRSKEHAHDYRYFPDPDLLPLEFDDAFVE 298

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIND 372
            +++ +PELPD K+ RFI +FG++ YDASVLV D+  A +FEK+A  RD K  ANWVIN+
Sbjct: 299 KVRRSLPELPDDKKNRFIADFGLTPYDASVLVVDRENAAFFEKVAEGRDGKTAANWVINN 358

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEEL 432
           L G L ++GK + D+P+S   LG+L+DL+ D  I+G+IAKD+F I+ E G  P  IVE+ 
Sbjct: 359 LFGALAKAGKGVADSPVSAENLGKLLDLLKDEVINGRIAKDVFEIMMETGEDPDAIVEDK 418

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GLRQVTD SAIE  VD VI +NP     +   K  L+ WFVGQVMK T GKANP+++  +
Sbjct: 419 GLRQVTDTSAIEAAVDAVIAANPEKADDVRGGKEKLLGWFVGQVMKATQGKANPAMLNDI 478

Query: 492 LKEKL 496
           L+ KL
Sbjct: 479 LRAKL 483


>gi|114765124|ref|ZP_01444269.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pelagibaca
           bermudensis HTCC2601]
 gi|114542528|gb|EAU45554.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseovarius sp.
           HTCC2601]
          Length = 504

 Score =  600 bits (1546), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 294/496 (59%), Positives = 370/496 (74%), Gaps = 17/496 (3%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F DAAMPGMLP++N  
Sbjct: 13  VIAGAKYDWELVIGMEVHAQVSSEAKLFSGASTKFGAEPNSNVAFVDAAMPGMLPVINEY 72

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVGEG+V V + P   
Sbjct: 73  CVEQAVRTGLGLKAEINLKSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVIVDMEP--- 129

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G  R +   IERIH+EQDAGKSIHD    +S +DLNR+GVALMEIV++PD+R   EA A+
Sbjct: 130 GIARLVR--IERIHIEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVSRPDIRGPEEAAAY 187

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNS 242
           ++KLR ILRYLGTCDGNM+ G++RADVNVSVCRPG+             GTRCE+KN+NS
Sbjct: 188 VSKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFSHLGTRCEIKNMNS 247

Query: 243 IRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLL 302
           +RF+  AI+YEA+RQIAILE GG I QETRL+DP K ETRS+R+KE+A DYRYF +PDLL
Sbjct: 248 MRFIQQAIDYEAKRQIAILEAGGSIDQETRLYDPDKGETRSMRSKEEAHDYRYFPDPDLL 307

Query: 303 PLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR-D 361
           PLEI++ ++  I   +PELPD K+ RF+ EFG+S YDASVL ++ + A +FEK+A +  D
Sbjct: 308 PLEIEQAWVDDIAASLPELPDEKKARFVKEFGLSEYDASVLTAEVANAAFFEKVAGDAGD 367

Query: 362 KKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK 421
            K+ ANWVIN+L G L + G  I ++P+SP QL  ++ LI    ISGKIAKD+F I++ +
Sbjct: 368 GKLAANWVINELFGRLKKEGHEITESPVSPAQLAGIVRLIKSDAISGKIAKDLFEIVYTE 427

Query: 422 GGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGG 481
           GG P++IVEE G++QVTD  AIE  VDE+I +NP  V +    P L  WFVGQVMK TGG
Sbjct: 428 GGDPEQIVEERGMKQVTDTGAIETAVDEIIAANPAQVEKAKQNPKLAGWFVGQVMKATGG 487

Query: 482 KANPSIVQKMLKEKLG 497
           KANP  V +++ +KL 
Sbjct: 488 KANPKAVNEIVAKKLA 503


>gi|126726644|ref|ZP_01742484.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacterales
           bacterium HTCC2150]
 gi|126703973|gb|EBA03066.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacterales
           bacterium HTCC2150]
          Length = 504

 Score =  599 bits (1544), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 296/496 (59%), Positives = 365/496 (73%), Gaps = 17/496 (3%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           + +G  GDWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F DA MPGMLP++N  
Sbjct: 13  VIAGAKGDWELVIGLEVHAQVATSAKLFSGASTKFGAEPNSNVAFVDAGMPGMLPVINEG 72

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV QAV TGLGLNA IN +S F RKNYFYPDLPQGYQISQ   PIVGEG+V V +G   +
Sbjct: 73  CVSQAVRTGLGLNAEINLFSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEVLVEMG---N 129

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           GQ R +   IERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV++PD+R   EA AF
Sbjct: 130 GQARLVR--IERIHLEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVSRPDVRGPEEAAAF 187

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNS 242
           + KLR ILRYLGTCDGNM+ G+MRADVNVSVC+PG+             GTRCE+KN+NS
Sbjct: 188 VGKLRQILRYLGTCDGNMQNGNMRADVNVSVCKPGDYEKYQATQDFSHLGTRCEIKNMNS 247

Query: 243 IRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLL 302
           +RF+  AI  EA RQIAILEDGG + QETRL+D  KNETRS+R+KE+A DYRYF  PDLL
Sbjct: 248 MRFIQAAIMVEANRQIAILEDGGSVDQETRLYDADKNETRSMRSKEEAHDYRYFPCPDLL 307

Query: 303 PLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK 362
           PLEI++ ++  IK  +PELPDAK+ RFI +F +S YDASVL ++   A YFE++A   D 
Sbjct: 308 PLEIEQSWVDDIKADLPELPDAKKARFISDFKLSDYDASVLTAEAENAAYFEEVANGNDG 367

Query: 363 KIVANWVINDLLGVLNR-SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK 421
           K+ ANWVIN+L G L +   K I ++P++P QL  +I LI  G ISGKIAKD+F I++ +
Sbjct: 368 KLAANWVINELFGRLKKDDDKGISESPVNPAQLAGIISLITKGDISGKIAKDLFEIVYTE 427

Query: 422 GGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGG 481
           GG P EIVE  G++QVTD  AIE  VD++I  NP  V +      L  WFVGQVMK TGG
Sbjct: 428 GGDPSEIVEARGMKQVTDTGAIESAVDKIIAENPAQVEKAKANLKLAGWFVGQVMKATGG 487

Query: 482 KANPSIVQKMLKEKLG 497
           KANP  V +++ +KL 
Sbjct: 488 KANPKAVNEIVAKKLA 503


>gi|148259881|ref|YP_001234008.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acidiphilium
           cryptum JF-5]
 gi|166217728|sp|A5FWV7|GATB_ACICJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|146401562|gb|ABQ30089.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acidiphilium cryptum JF-5]
          Length = 487

 Score =  598 bits (1541), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 289/482 (59%), Positives = 369/482 (76%), Gaps = 6/482 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           GTTG WE+VIG+EVHAQ+   SKLFSGA+  FGAEPN+QVSF DA  PGMLP++N  CV 
Sbjct: 7   GTTGAWELVIGLEVHAQVISRSKLFSGAATAFGAEPNSQVSFVDAGFPGMLPVINRECVA 66

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TGLGL AHIN  S F RKNYFY DLPQGYQISQ++ PIVG G + + +   +SG+ 
Sbjct: 67  QAVRTGLGLAAHINLVSRFDRKNYFYADLPQGYQISQYEHPIVGAGAIEIEL---ESGET 123

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           RTI  GI R+HLEQDAGKS+HDQ+ + S IDLNRSGVALMEIV++PDMRS  EA A+L K
Sbjct: 124 RTI--GITRLHLEQDAGKSMHDQHPSKSLIDLNRSGVALMEIVSEPDMRSPEEAGAYLRK 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR+ILRYLGTCDGNM+EGSMRADVNVSV + GE + TRCE+KNVNSIRF+  AIE EA+R
Sbjct: 182 LRTILRYLGTCDGNMDEGSMRADVNVSVRKHGEPFRTRCEIKNVNSIRFVMQAIEAEAKR 241

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI I E GG + QETRLF+P++  TRS+R+KEDA DYRYF EPDLLPL ++E+++ ++K 
Sbjct: 242 QIEIWEAGGTVDQETRLFEPARGVTRSMRSKEDAHDYRYFPEPDLLPLVLEEEWVESLKA 301

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPDAKR R + +FG+S Y+AS+ V ++  AD+FE +A  RD K+VANW++ D    
Sbjct: 302 TLPELPDAKRARLMRDFGLSRYEASIFVMEQVTADFFETVAAGRDAKLVANWMLGDFFAH 361

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LNR+G SIE +P++  +LGEL+DLI D TI+GKIAK++  ++++ G     IVE  GL+Q
Sbjct: 362 LNRTGTSIETSPVTAARLGELLDLITDKTINGKIAKEVLELMFDTGDAAGAIVEARGLKQ 421

Query: 437 VTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           VTD  AI++ +D V+ +N + +A   A K  L  +FVGQVMK   GK NP++V + LK K
Sbjct: 422 VTDTGAIDEAIDRVVAANADKLAEYKAGKDKLFGFFVGQVMKAMQGKGNPALVNEALKRK 481

Query: 496 LG 497
           +G
Sbjct: 482 IG 483


>gi|209963378|ref|YP_002296293.1| aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit B, GatB
           putative [Rhodospirillum centenum SW]
 gi|229486447|sp|B6IPU4|GATB_RHOCS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|209956844|gb|ACI97480.1| aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit B, GatB
           putative [Rhodospirillum centenum SW]
          Length = 484

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 289/484 (59%), Positives = 375/484 (77%), Gaps = 6/484 (1%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           L  G TG+WE+VIG+EVHAQ+   +KLFSGA+  FGA PN+QVSF DAA PGMLP++N  
Sbjct: 4   LIQGETGEWEIVIGLEVHAQVISNAKLFSGAATAFGAAPNSQVSFVDAAFPGMLPVINEV 63

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV TGLGL A IN  SVF RKNYFY DLP GYQISQ  +P+VG G + + +  D S
Sbjct: 64  CVEQAVKTGLGLKAQINLRSVFDRKNYFYADLPAGYQISQFQQPVVGNGTIVLDLA-DGS 122

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
               T EVGIER+HLE DAGKS+HDQ+ + + +DLNR+GVALMEIV+KPDMRS  EA A+
Sbjct: 123 ----TREVGIERLHLEIDAGKSLHDQHPSKTYVDLNRAGVALMEIVSKPDMRSPEEAAAY 178

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYE 253
           L KLR+ILRYLGTCDGNMEEGSMR DVNVSV + G+ +GTR E KNVNSIR++  AIEYE
Sbjct: 179 LRKLRTILRYLGTCDGNMEEGSMRCDVNVSVRKVGQPYGTRTETKNVNSIRYVQQAIEYE 238

Query: 254 ARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRA 313
           A+RQ+ ++E GG + QETRL+DP+K ETRS+R+KE+A DYRYF +PDLLPLEI++ ++  
Sbjct: 239 AQRQVELIEGGGTVVQETRLWDPNKGETRSMRSKEEAHDYRYFPDPDLLPLEIEQSWVDR 298

Query: 314 IKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDL 373
           IK+ +PELPD K+ RF+ ++G+S YDA +LV++++ AD++E +A  RD K+ AN+VI DL
Sbjct: 299 IKETLPELPDDKKARFMADYGLSAYDAGILVAERARADFYETVAKGRDPKLAANYVIGDL 358

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
           LG LN++G+ I ++PI+ + LG LIDL+ DGTISG+IAKD+F  + E G  P  IVE+ G
Sbjct: 359 LGALNKTGRDITESPIAADDLGGLIDLVTDGTISGRIAKDVFAEMLETGEKPSLIVEKKG 418

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           LRQVTD  AI+K +DEV+ +N + VA   + K  L  +FVGQVM+ T GKANP++V ++L
Sbjct: 419 LRQVTDTGAIDKAIDEVMAANADKVAEFRSGKEKLFGFFVGQVMRATQGKANPALVNEIL 478

Query: 493 KEKL 496
             KL
Sbjct: 479 ATKL 482


>gi|144899095|emb|CAM75959.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 483

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 294/486 (60%), Positives = 363/486 (74%), Gaps = 9/486 (1%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           +  G TGDWE+VIG+EVHAQ+   SKLFSGA+ +FGAEPN QVSF DA  PGMLP++N +
Sbjct: 2   IIQGDTGDWEIVIGLEVHAQVISKSKLFSGAATDFGAEPNDQVSFVDAGFPGMLPVINEK 61

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV TGLGL A IN  SVFARKNYFY DLPQGYQISQ+D PIVGEG + + +     
Sbjct: 62  CVEQAVRTGLGLKAKINLTSVFARKNYFYADLPQGYQISQYDLPIVGEGTLLIDLA---D 118

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G  R I  GIER+HLEQDAGKSIHD + + S IDLNRSGVALMEIV+KPDMRS  EA A+
Sbjct: 119 GTSRAI--GIERLHLEQDAGKSIHDMHPSKSYIDLNRSGVALMEIVSKPDMRSPEEAGAY 176

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIE 251
           LTKLR+ILRYL TCDGNM+EGSMR D NVSV RP       TRCE+KNVNSIRF+  AIE
Sbjct: 177 LTKLRTILRYLETCDGNMQEGSMRCDANVSV-RPVGSTELRTRCEIKNVNSIRFVQQAIE 235

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
           YEARR I + E+GG I+QETRLFD  K ETRS+R+KE A DYRYF +PDLLPL + +DF+
Sbjct: 236 YEARRHIDVYENGGEIKQETRLFDSVKGETRSMRSKEHAHDYRYFPDPDLLPLVVAQDFV 295

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
             I+  +PELPD K+ RF+ +FG++ YDA VLV++++ AD+FE +A  RD K+ ANW++ 
Sbjct: 296 DGIQATLPELPDDKKARFMADFGLNAYDAGVLVAERASADFFEAVAAGRDAKMAANWIMG 355

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D    +N    S E  P+S   LG++IDLI DGTIS ++AKD+F  + E G  P  IVEE
Sbjct: 356 DFFAAMNSGDYSWEKPPVSAQNLGKMIDLIKDGTISTRLAKDVFIFMLESGKDPAIIVEE 415

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+QVTD  AIEK + EV+ +NP+ VA + A K  L+ WFVGQVMK T GKANP ++ +
Sbjct: 416 KGLKQVTDTGAIEKAIAEVMAANPDKVAEVKAGKDKLIGWFVGQVMKATQGKANPGMLNE 475

Query: 491 MLKEKL 496
           ++ +K 
Sbjct: 476 LIVKKF 481


>gi|84686379|ref|ZP_01014273.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84665562|gb|EAQ12038.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacterales
           bacterium HTCC2654]
          Length = 535

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 297/528 (56%), Positives = 373/528 (70%), Gaps = 47/528 (8%)

Query: 13  SLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNG 72
           ++ +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN  V+F DAAMPGMLP++N 
Sbjct: 13  TVIAGAREDWELVIGMEVHAQVSSKAKLFSGASTQFGAEPNANVAFVDAAMPGMLPVINE 72

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
            CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVGEG++ V +GP  
Sbjct: 73  FCVEQAVRTGLGLKAEINLFSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEIIVDMGPGI 132

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKA 192
           + + R     IERIHLEQDAGKSIHD   ++S +DLNR+GVALMEIV++PD+R   EA A
Sbjct: 133 ARRVR-----IERIHLEQDAGKSIHDMDPSMSFVDLNRTGVALMEIVSRPDIRGPEEAAA 187

Query: 193 FLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVN 241
           ++TKLR ILRYLGTCDGNM+ G++RADVNVSVCRPG+             GTRCE+KN+N
Sbjct: 188 YVTKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYMETQDFSHLGTRCEIKNMN 247

Query: 242 SIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDL 301
           S+RF+  AI+YEARRQIAI+EDGG + QETRL+DP KNETRS+R+KE+A DYRYF  PDL
Sbjct: 248 SMRFIQAAIDYEARRQIAIVEDGGEVVQETRLYDPDKNETRSMRSKEEAHDYRYFPCPDL 307

Query: 302 LPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL----- 356
           LPLEI++ ++  IK  +PELPD K+ RF+ +FG+S YDA VL +D + A +FE++     
Sbjct: 308 LPLEIEQAWVDGIKATLPELPDEKKARFVKDFGLSEYDAGVLTADTTNASFFEEVVGSTI 367

Query: 357 ------------AVNRDK--------------KIVANWVINDLLGVLNRSGKSIEDTPIS 390
                       A   DK              K+ ANWVIN+L G L +  + I D+PIS
Sbjct: 368 GKLDELPLSPVYATTSDKPVGDFESIQSRDLGKLSANWVINELFGRLKKDDRDIADSPIS 427

Query: 391 PNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEV 450
           P +LG+++ LI  G ISGKI KD+F I + +   P+EIVE  G++QVTD  AIE  VDEV
Sbjct: 428 PARLGQIVALIKKGDISGKIGKDVFEIAYTQDRDPEEIVETEGMKQVTDTGAIETAVDEV 487

Query: 451 INSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
           I +NP  V +    P L  WFVGQVMK TGGKANP  V +++  KLG+
Sbjct: 488 IAANPEQVEKAKQNPKLAGWFVGQVMKATGGKANPKAVNEIVAAKLGL 535


>gi|326403189|ref|YP_004283270.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acidiphilium multivorum AIU301]
 gi|325050050|dbj|BAJ80388.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acidiphilium multivorum AIU301]
          Length = 487

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 290/482 (60%), Positives = 369/482 (76%), Gaps = 6/482 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           GTTG WE+VIG+EVHAQ+   SKLFSGA+  FGAEPN+QVSF DA  PGMLP++N  CV 
Sbjct: 7   GTTGAWELVIGLEVHAQVISRSKLFSGAATAFGAEPNSQVSFVDAGFPGMLPVINRECVA 66

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TGLGL AHIN  S F RKNYFY DLPQGYQISQ++ PIVG G + + +    SG+ 
Sbjct: 67  QAVRTGLGLAAHINLVSRFDRKNYFYADLPQGYQISQYEHPIVGAGAIEIEL---DSGET 123

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           RTI  GI R+HLEQDAGKS+HDQ+ + S IDLNRSGVALMEIV++PDMRS  EA A+L K
Sbjct: 124 RTI--GITRLHLEQDAGKSMHDQHPSKSLIDLNRSGVALMEIVSEPDMRSPEEAGAYLRK 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR+ILRYLGTCDGNM+EGSMRADVNVSV + GE + TRCE+KNVNSIRF+  AIE EA+R
Sbjct: 182 LRTILRYLGTCDGNMDEGSMRADVNVSVRKHGEPFRTRCEIKNVNSIRFVMQAIEAEAKR 241

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI I E GG + QETRLF+P++  TRS+R+KEDA DYRYF EPDLLPL ++E+++ ++K 
Sbjct: 242 QIEIWEAGGTVDQETRLFEPARGVTRSMRSKEDAHDYRYFPEPDLLPLVLEEEWVESLKA 301

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPDAKR R + +FG+S Y+AS+ V ++  AD+FE +A  RD K+VANW++ D    
Sbjct: 302 TLPELPDAKRARLMRDFGLSRYEASIFVMEQVTADFFETVAAGRDAKLVANWMLGDFFAH 361

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LNR+G SIE +P++  +LGEL+DLI D TI+GKIAK++  ++++ G     IVE  GL+Q
Sbjct: 362 LNRTGTSIETSPVNAARLGELLDLITDKTINGKIAKEVLELMFDTGDAAGAIVEARGLKQ 421

Query: 437 VTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           VTD  AI++ +D+VI +N + +A   A K  L  +FVGQVMK   GK NP++V + LK K
Sbjct: 422 VTDTGAIDEAIDKVIAANADKLAEYKAGKDKLFGFFVGQVMKAMQGKGNPALVNEALKRK 481

Query: 496 LG 497
           +G
Sbjct: 482 IG 483


>gi|294676398|ref|YP_003577013.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Rhodobacter
           capsulatus SB 1003]
 gi|294475218|gb|ADE84606.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Rhodobacter
           capsulatus SB 1003]
          Length = 505

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 292/497 (58%), Positives = 365/497 (73%), Gaps = 17/497 (3%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           + +G   DWE+VIG+EVHAQ++  +KLFSGAS  FG EPN  V+F DAAMPGMLP++N  
Sbjct: 14  VIAGAKSDWELVIGMEVHAQVASNAKLFSGASTMFGNEPNANVAFVDAAMPGMLPVINEF 73

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV QAV TGL L A IN  S F RKNYFYPDLPQGYQISQ   PIVGEG++ V +GP  +
Sbjct: 74  CVAQAVRTGLALKAGINLRSAFDRKNYFYPDLPQGYQISQLYHPIVGEGEIIVDMGPGVA 133

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
            + R     IERIHLEQDAGKSIHD    +S +D NR+GVALMEIV++PD+R   EA A+
Sbjct: 134 RKVR-----IERIHLEQDAGKSIHDMDPTMSFVDFNRTGVALMEIVSRPDIRGPEEAAAY 188

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEVKNVNS 242
           + KLR ILRY+GTCDGNM+ G++RADVNVSVCRPG+             GTRCE+KN+NS
Sbjct: 189 IAKLRQILRYIGTCDGNMQNGNLRADVNVSVCRPGQYEKYQATQDFSHLGTRCEIKNMNS 248

Query: 243 IRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLL 302
           +RF+  AI+YEARRQIAILEDGG I QETRL+DP K ETRS+R+KE+A DYRYF  PDLL
Sbjct: 249 MRFIQQAIDYEARRQIAILEDGGSIVQETRLYDPDKGETRSMRSKEEAHDYRYFPCPDLL 308

Query: 303 PLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRD 361
           PLEI++ ++  I   +PELPD K+ RF+ + G+S YDASVL ++ + A+YFE  +AV  D
Sbjct: 309 PLEIEQAWVDDIGATMPELPDEKKARFVKDLGLSEYDASVLTAEVADAEYFEAVVAVAED 368

Query: 362 KKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK 421
            K+ ANWVIN+L G L + G  I  +P+SP QLG +I LI  G ISGKIAKD+F I++ +
Sbjct: 369 GKLAANWVINELFGRLKKEGHEIGQSPVSPVQLGGIIKLIRSGDISGKIAKDLFEIVYTE 428

Query: 422 GGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGG 481
           GG P  IVE  G++QVTDL AIE  VDE+I +NP  V +    P L  WFVGQV+K +GG
Sbjct: 429 GGDPAAIVEARGMKQVTDLGAIEAAVDEIIAANPAQVEKAKANPKLAGWFVGQVIKASGG 488

Query: 482 KANPSIVQKMLKEKLGI 498
           KANP+ V +++  KLG+
Sbjct: 489 KANPAAVNEIVARKLGL 505


>gi|254441346|ref|ZP_05054839.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Octadecabacter antarcticus 307]
 gi|198251424|gb|EDY75739.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Octadecabacter antarcticus 307]
          Length = 502

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 294/492 (59%), Positives = 359/492 (72%), Gaps = 16/492 (3%)

Query: 16  SGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCV 75
           +G TGDWE+VIG+EVHAQ++  +KLFS AS  FGAEPN+ V+F DA MPGMLP++N  CV
Sbjct: 15  AGATGDWELVIGLEVHAQVATKAKLFSSASTQFGAEPNSNVAFVDAGMPGMLPVINEECV 74

Query: 76  QQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQ 135
             AV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG G+V V +     G 
Sbjct: 75  AYAVKTGLGLKAQINLNSAFDRKNYFYPDLPQGYQISQLYHPIVGTGEVLVEM---NDGT 131

Query: 136 FRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
            R +   IERIHLEQDAGKSIHD   A+S +DLNR+GVALMEIV+ PD+R   EA A++ 
Sbjct: 132 ARNVR--IERIHLEQDAGKSIHDMDPAMSFVDLNRTGVALMEIVSFPDIRGPEEAAAYVV 189

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-----------WGTRCEVKNVNSIR 244
           KLR ILRYLGTCDGNM+ G++RADVNVSVCRPG+             GTRCE+KN+NS+R
Sbjct: 190 KLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGDYEKFQASGDFGDLGTRCEIKNMNSMR 249

Query: 245 FLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPL 304
           F+ LAI++EARRQIAI+EDGG I QETRL+D  KNETRS+R+KE+A DYRYF +PDLLPL
Sbjct: 250 FIQLAIDFEARRQIAIIEDGGKIVQETRLYDADKNETRSMRSKEEAHDYRYFPDPDLLPL 309

Query: 305 EIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKI 364
           EI++ ++  I   +PELPDAK+ RFI +FG+S YDASVL +D   A +FE +A   D K+
Sbjct: 310 EIEQAWVDDIAASLPELPDAKKARFIKDFGLSDYDASVLTADVDNAGFFESVAQGNDGKL 369

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G L +  K I D+PIS  +LG+++ LI    ISGKIAKD+F I +     
Sbjct: 370 AANWVINELFGRLKKDDKDISDSPISATRLGQIVALIKSDKISGKIAKDVFEIAYTSDRD 429

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P EIV+  G+ QVTD  AIE  VD +I +NP+ VA+    P L  WFVGQVMK TGGKAN
Sbjct: 430 PIEIVKTEGMEQVTDTGAIEAAVDAIIAANPDQVAKAKENPKLAGWFVGQVMKATGGKAN 489

Query: 485 PSIVQKMLKEKL 496
           P  V K++ EKL
Sbjct: 490 PGAVNKLISEKL 501


>gi|254510930|ref|ZP_05122997.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Rhodobacteraceae bacterium
           KLH11]
 gi|221534641|gb|EEE37629.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Rhodobacteraceae bacterium
           KLH11]
          Length = 503

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 292/508 (57%), Positives = 371/508 (73%), Gaps = 17/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L   + + +++ +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDLTYEMPKPKTI-AGAKHDWELVIGMEVHAQVSSNAKLFSGASTQFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 60  AAMPGMLPVINEYCVEQAVRTGLGLKADINLKSAFDRKNYFYPDLPQGYQISQLYQPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G    G  R +   IERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV+
Sbjct: 120 EGEVLVEMG---DGTARMVR--IERIHMEQDAGKSIHDMDPHMSFVDLNRTGVCLMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPG-----------E 229
           +PD+R   EA A++ KLR ILRYLGTCDGNM+ G++RADVNVS+C PG            
Sbjct: 175 RPDIRGPEEAAAYIAKLRQILRYLGTCDGNMQNGNLRADVNVSICLPGAYEKYQETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIE EARRQIAI+E GG + QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIEVEARRQIAIVEGGGKVDQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I  ++PELPD K+ RFI  FG++ YDASVL ++   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAAKLPELPDDKKARFISVFGLTDYDASVLTAEVES 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE++A  R  K+ ANWVIN+L G L +    I  +P+SP QLG +IDLI    ISGK
Sbjct: 355 AAYFEEVAKGRSGKLAANWVINELFGRLKKDDAEITASPVSPVQLGGIIDLIASDAISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F I++ +GG P +IVE+ G++QVTD  AIE  +DE+I +NP  V +    P L  
Sbjct: 415 IAKDLFEIVYTEGGDPAQIVEDRGMKQVTDTGAIEAALDEIIAANPAQVEKAKVNPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           WFVGQVMK TGGKANP  V +++ +KLG
Sbjct: 475 WFVGQVMKATGGKANPKAVNELVSKKLG 502


>gi|302382953|ref|YP_003818776.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193581|gb|ADL01153.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 500

 Score =  595 bits (1535), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 291/504 (57%), Positives = 366/504 (72%), Gaps = 16/504 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T    + +L  G TG WE+V+G+E+HAQ++  +KLFSGA+V FGA PN QVS  DA  PG
Sbjct: 2   TDTIDTSNLIQGRTGAWEIVMGLEIHAQVASKAKLFSGAAVGFGAGPNEQVSLIDAGFPG 61

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP LN  CV+QAV TGLGLNA INK S F RKNYFYPDLPQGYQISQ   PIVGEG + 
Sbjct: 62  MLPTLNAHCVEQAVKTGLGLNATINKRSQFDRKNYFYPDLPQGYQISQLYFPIVGEGVIE 121

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V     + G F    VGIER+HLEQDAGK IHD     S +DLNR+G ALMEIV++PD+R
Sbjct: 122 VEA---EDGSF--FNVGIERLHLEQDAGKLIHDLSPTESYVDLNRAGTALMEIVSRPDIR 176

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTR 234
           S  EA A++ K+R+IL YLGTCDG+ME+G++RADVNVSVCR G+             GTR
Sbjct: 177 SPEEAVAYVKKIRTILIYLGTCDGDMEKGNLRADVNVSVCREGQYAKFKATGDFSHLGTR 236

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KNVNS RF+  AI YEARRQI ILEDGG I QETRL+DP+  ETRS+R+KE+A DYR
Sbjct: 237 CEIKNVNSFRFISQAINYEARRQIEILEDGGKIVQETRLYDPTAGETRSMRSKEEANDYR 296

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPLE+++ +I AIK  +PELPD KR R + ++G+S YDA VL S+++ ADYFE
Sbjct: 297 YFPDPDLLPLELEQAWIDAIKANLPELPDDKRRRLMADYGLSQYDAVVLTSEQAKADYFE 356

Query: 355 KLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDI 414
           + A+ RD K+VANWV N+L   L   G+   ++P+    +GEL+ LI +G IS KIAK++
Sbjct: 357 EAAMGRDAKLVANWVTNELSARLAADGRDFSESPLPAAHVGELVALIEEGVISSKIAKEV 416

Query: 415 FNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQ 474
           F+ +W   G+P+ +VE  GL QV D  AIEK VDE+I +NP+  A +A KP  + WFVGQ
Sbjct: 417 FDHVWNGEGSPRAVVEARGLVQVNDTGAIEKAVDEIIAANPDKAAAVAEKPQAIGWFVGQ 476

Query: 475 VMKNTGGKANPSIVQKMLKEKLGI 498
           VMK TGGKANP+   ++LK KLG+
Sbjct: 477 VMKATGGKANPAAANEILKAKLGL 500


>gi|114798220|ref|YP_760986.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Hyphomonas
           neptunium ATCC 15444]
 gi|114738394|gb|ABI76519.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Hyphomonas
           neptunium ATCC 15444]
          Length = 502

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 293/501 (58%), Positives = 363/501 (72%), Gaps = 14/501 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           R+     G TGDWEVV+G+E+HAQ++  +KLFSGAS  FGA+PN  VS  DAAMPGMLP+
Sbjct: 4   RTPFRIKGETGDWEVVMGLEIHAQVASNAKLFSGASTTFGADPNCNVSLVDAAMPGMLPV 63

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QA+ TGLGL A IN YS F RKNYFYPDLPQGYQISQ   PIVGEG++ V + 
Sbjct: 64  INKFCVEQAIRTGLGLKAQINTYSRFDRKNYFYPDLPQGYQISQFAHPIVGEGEIEVDVE 123

Query: 130 -PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
            P K          IER+HLEQDAGKSIHD     + +DLNRSGVALMEIV+KPD+RS  
Sbjct: 124 VPGKEDY--AFPCRIERLHLEQDAGKSIHDMDPNSTYVDLNRSGVALMEIVSKPDIRSPA 181

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCEV 237
           EA A++ KLR+I+  LGTCDG+ME+G++RADVNVSVC+PG+             GTRCE+
Sbjct: 182 EAAAYVKKLRAIVIALGTCDGDMEKGNLRADVNVSVCKPGQYEKFRETGDFKHLGTRCEL 241

Query: 238 KNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFS 297
           KN+NS RF+  AIEYEA RQI I+E GG + QETRLFDP K ETRS+R+KEDA DYRYF 
Sbjct: 242 KNMNSYRFIQQAIEYEAHRQIEIIEGGGKVDQETRLFDPVKGETRSMRSKEDAHDYRYFP 301

Query: 298 EPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA 357
           +PDLLPLE+++ +I  I+  +PELPD KR RF  ++G+S YDA VL SD   A +FE+ A
Sbjct: 302 DPDLLPLEVEQAWIEEIRASLPELPDQKRARFEKDYGLSRYDAGVLTSDADKAAFFEEAA 361

Query: 358 VNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNI 417
             RD K+ ANWV  +L G LN+ G  + ++P+S   LG LI+LI + TISGKIAKD+F  
Sbjct: 362 KGRDAKLTANWVTQELFGYLNKEGLELSESPVSAEALGGLIELISNDTISGKIAKDVFAR 421

Query: 418 LWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMK 477
           +    G    IVE+ GL+QVTD  AIEKVVDE+I +NP+ VA++  KP  + WFVGQVMK
Sbjct: 422 MIAGEGEAAAIVEKHGLKQVTDTGAIEKVVDEIIAANPDQVAKVKDKPQTLGWFVGQVMK 481

Query: 478 NTGGKANPSIVQKMLKEKLGI 498
            +GGKANP  V  +LK KLGI
Sbjct: 482 ASGGKANPKAVNDILKAKLGI 502


>gi|296535593|ref|ZP_06897774.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Roseomonas
           cervicalis ATCC 49957]
 gi|296264109|gb|EFH10553.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Roseomonas
           cervicalis ATCC 49957]
          Length = 483

 Score =  592 bits (1527), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 286/482 (59%), Positives = 360/482 (74%), Gaps = 6/482 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           GTTG WEVVIG+EVHAQ++  +KLFSGA+  FGAEPNTQVSF DA  PGMLP++NG CV 
Sbjct: 7   GTTGPWEVVIGLEVHAQVTSEAKLFSGAATEFGAEPNTQVSFVDAGFPGMLPVINGECVA 66

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TGLGLNA +N +S F RKNYFY DLPQGYQISQ+  PI+G G++ + +     G  
Sbjct: 67  QAVRTGLGLNAQVNLWSRFDRKNYFYADLPQGYQISQYQFPIIGTGQIEIELA---DGTR 123

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           + I  GI R+HLEQDAGKS+HDQ+   S IDLNRSGVALMEIV++PD+RS  EA A+LTK
Sbjct: 124 KPI--GITRLHLEQDAGKSLHDQHPTKSYIDLNRSGVALMEIVSEPDLRSPEEAGAYLTK 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR ILRYLGTCDGNME+GS+RADVNVSV +PGE + TRCEVKNVNSIRF+  A+E EARR
Sbjct: 182 LRQILRYLGTCDGNMEQGSLRADVNVSVRKPGEGFRTRCEVKNVNSIRFVMQAVEAEARR 241

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ + E G  + QETRLFD S+  TRS+R+KEDA DYRYF +PDL PL I++ ++  +K 
Sbjct: 242 QVELWEAGEEVVQETRLFDTSRGVTRSMRSKEDAHDYRYFPDPDLPPLVIEQAWVDQLKA 301

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPDA+R R++GEFG++ YDA VL  +K  A ++E +A  RD K+ ANWV  D    
Sbjct: 302 ALPELPDARRARYVGEFGLTPYDAHVLTLEKETAAFYETVARGRDPKVAANWVTGDFFAG 361

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LNR+G  I D+P+S   LG L+DLI D T+SGK+AK++   ++E G  P EIVEE GL+Q
Sbjct: 362 LNRTGHGIGDSPVSAENLGALLDLIADNTLSGKLAKEVLEAMFETGKAPGEIVEERGLKQ 421

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           VTD  AIE V+D+V+ +N   V    + K  L  +FVGQ MK   GK NP++V ++LK+K
Sbjct: 422 VTDTGAIEAVIDQVMAANAGKVEEYRSGKDKLFGFFVGQTMKAMQGKGNPALVNELLKKK 481

Query: 496 LG 497
           LG
Sbjct: 482 LG 483


>gi|126733101|ref|ZP_01748855.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sagittula
           stellata E-37]
 gi|126706450|gb|EBA05533.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sagittula
           stellata E-37]
          Length = 504

 Score =  592 bits (1525), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 285/504 (56%), Positives = 367/504 (72%), Gaps = 17/504 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T+      + +G   DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ VSF DAAMPG
Sbjct: 5   TYETPKPKVIAGAKHDWELVIGMEVHAQVASKAKLFSGASTQFGAEPNSNVSFVDAAMPG 64

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  C++QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   P+VGEG++ 
Sbjct: 65  MLPVINEYCIEQAVRTGLGLKAQINLVSAFDRKNYFYPDLPQGYQISQLYHPLVGEGEIL 124

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V + P  +   R     IERIH+EQDAGKSIHD    +S +DLNR+GVALMEIV++PD+R
Sbjct: 125 VDMEPGIARLVR-----IERIHVEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVSRPDIR 179

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTR 234
              EA A++ K+R ILRYLGTCDGNM+ G++RADVNVS+CRPG+             GTR
Sbjct: 180 GPEEAAAYVAKMRQILRYLGTCDGNMQNGNLRADVNVSICRPGQYEKYQETQDFSHLGTR 239

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KN+NS+RF+ +AI+ EARRQIAI+E GG + QETRL+DP KNETRS+R+KE+A DYR
Sbjct: 240 CEIKNMNSMRFIQMAIDVEARRQIAIVEGGGTVDQETRLYDPDKNETRSMRSKEEAHDYR 299

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF  PDLLPLEI++ ++  I   +PELPD K+ RF+G+FG++ YDA+VL ++   A YFE
Sbjct: 300 YFPCPDLLPLEIEQGWVDDIAASLPELPDEKKARFMGDFGLTEYDANVLTAETVNAAYFE 359

Query: 355 KLAVNR-DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKD 413
           ++     D K+ ANWVIN+L G L +  + I D+P++P QL  +I LI    ISGKIAKD
Sbjct: 360 QVVTEAGDGKLSANWVINELFGRLKKDDRDITDSPVTPGQLASIIKLIKSDAISGKIAKD 419

Query: 414 IFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVG 473
           +F I++ +GG P++IVEE G++QVTD  AIE  VDE+I +NP  V +    P L  WFVG
Sbjct: 420 LFEIVYTEGGDPEKIVEERGMKQVTDTGAIETAVDEIIAANPAQVEKAKANPKLAGWFVG 479

Query: 474 QVMKNTGGKANPSIVQKMLKEKLG 497
           QVMK TGGKANP  V +++  KL 
Sbjct: 480 QVMKATGGKANPKAVNEIVARKLA 503


>gi|297717788|gb|ADI50037.1| aspartyl/glutamyl-tRNA amidotransferase subunit b [Candidatus
           Odyssella thessalonicensis L13]
          Length = 492

 Score =  588 bits (1516), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 283/497 (56%), Positives = 369/497 (74%), Gaps = 13/497 (2%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
           ++ +++L  G TG WEVVIG+EVHAQ    +KLF G S +FGAEPNTQV FF AAMPGML
Sbjct: 1   MSENKNLIEGRTGLWEVVIGLEVHAQTISKAKLFDGCSTDFGAEPNTQVGFFTAAMPGML 60

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P+LN  CV+QA+ TGLGLNA +NK+SVF RKNYFY DLP GYQISQ   PIV  G + + 
Sbjct: 61  PVLNQFCVEQAIKTGLGLNATVNKFSVFDRKNYFYADLPCGYQISQFSHPIVTGGYLDID 120

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
           +   +S +     + I R+H+E DAGKSIHD +   + IDLNRSG+ALMEIV++P+MRSS
Sbjct: 121 LEGGESKR-----INITRLHMEMDAGKSIHDLHPTKTYIDLNRSGIALMEIVSEPEMRSS 175

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLG 247
            EA A++ KLRSILRYLGTCDGNME+GS+R D N+S+ RPG+ +GTR E+KNVNSIRFLG
Sbjct: 176 SEAMAYVKKLRSILRYLGTCDGNMEQGSLRVDANISLRRPGDPFGTRAEIKNVNSIRFLG 235

Query: 248 LAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEID 307
            AIEYE +RQ+ ILEDGG + QETRLFDP+K ETRS+R+KEDA DYRYF +PDLLPL + 
Sbjct: 236 QAIEYEIQRQLDILEDGGQVIQETRLFDPNKGETRSMRSKEDAHDYRYFPDPDLLPLRLS 295

Query: 308 EDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV---NRDK-- 362
           ++ I  ++  +PELPDAKR+R I EFG+ LYDA+V+V+++  ADY+E+       +DK  
Sbjct: 296 DERIENVRITMPELPDAKRQRLIAEFGLPLYDATVIVTERETADYYERAVAALKAKDKAQ 355

Query: 363 --KIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
             K++ANW++ D+   +N+  K++E  P++   L  LIDLI+D TISGKIAKD+F  +W+
Sbjct: 356 GAKLIANWLMGDVFAAMNKDNKTVETMPVTAENLAGLIDLILDNTISGKIAKDVFTKMWD 415

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNT 479
            G  P  +VEELGL+Q+TD S IE+ VD V+  + + VA   + K  L  +FVGQVMK T
Sbjct: 416 SGKAPSLLVEELGLKQITDTSVIEQAVDTVLAQHADKVAEYKSGKEALFGFFVGQVMKAT 475

Query: 480 GGKANPSIVQKMLKEKL 496
            GKANP +V  ++K KL
Sbjct: 476 QGKANPGLVNDLIKNKL 492


>gi|294084178|ref|YP_003550936.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663751|gb|ADE38852.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 484

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 278/484 (57%), Positives = 365/484 (75%), Gaps = 6/484 (1%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           L +G TGDWEVVIG+EVHAQ+S  +KLFSGA   FGAEPN  VS  DAAMPGMLP++N  
Sbjct: 4   LVAGRTGDWEVVIGLEVHAQVSSSAKLFSGAPTKFGAEPNQNVSLVDAAMPGMLPVINSE 63

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV QAV TGLGL A IN +SVF RKNYFY DLPQGYQISQ  +PIVGEG + + +    S
Sbjct: 64  CVYQAVRTGLGLKAEINLFSVFDRKNYFYADLPQGYQISQFKQPIVGEGILRIDLADGSS 123

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
                 ++GIER+HLEQDAGKS+HDQ+ + S IDLNR+GVALMEIV++PD+RS+ +A A+
Sbjct: 124 K-----DIGIERLHLEQDAGKSMHDQHPSKSYIDLNRTGVALMEIVSRPDIRSATQAAAY 178

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYE 253
           + KLRSILRYLGTCDGNMEEGSMRADVNVSV RPG+  GTR E KN+NS+RF+  AI+YE
Sbjct: 179 VRKLRSILRYLGTCDGNMEEGSMRADVNVSVRRPGDELGTRTETKNLNSLRFIQQAIDYE 238

Query: 254 ARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRA 313
             RQI ++EDGG I QETRLFD +   TR++R+KEDA DYRYF +PDLLPLEI +  +  
Sbjct: 239 VARQIEVIEDGGTIDQETRLFDTNTGMTRTMRSKEDAHDYRYFPDPDLLPLEITQSDVDK 298

Query: 314 IKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDL 373
           +  ++PELPD+ ++R + ++G+S YDA+V+  ++  A ++E  +  RD+K+VANW+  +L
Sbjct: 299 LAAELPELPDSIKDRLMNDYGLSAYDAAVITEERETAAFYEAASKGRDRKLVANWMTVEL 358

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
            G LN++G  +  +P+SP+ LG L+D+I DGTISG+IAKD+F  +   G    +IVEE G
Sbjct: 359 FGALNKAGLDLARSPVSPDALGGLVDMISDGTISGRIAKDVFADMMLSGKQAADIVEEKG 418

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           L+QV+D  AIE ++D+V+ +N + VA     K  L  +FVGQVMK +GG+ANP +V ++L
Sbjct: 419 LKQVSDSGAIETLIDDVMAANEDKVAEYRGGKDKLFGFFVGQVMKQSGGQANPGMVNQLL 478

Query: 493 KEKL 496
           + KL
Sbjct: 479 RSKL 482


>gi|329889396|ref|ZP_08267739.1| glutamyl-tRNAGln and/or aspartyl-tRNAAsn amidotransferase, B
           subunit [Brevundimonas diminuta ATCC 11568]
 gi|328844697|gb|EGF94261.1| glutamyl-tRNAGln and/or aspartyl-tRNAAsn amidotransferase, B
           subunit [Brevundimonas diminuta ATCC 11568]
          Length = 497

 Score =  584 bits (1506), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 286/496 (57%), Positives = 358/496 (72%), Gaps = 16/496 (3%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           L  G TG WE+V+G+E+HAQ++  +KLFSGA+V FGA PN QVS  DA  PGMLP LN  
Sbjct: 7   LIQGRTGAWEIVMGLEIHAQVASNAKLFSGAAVGFGAGPNEQVSLIDAGFPGMLPTLNKY 66

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV +GLGL A IN  S F RKNYFYPDLP GYQISQ   PIVGEG V V     + 
Sbjct: 67  CVEQAVKSGLGLRAQINLKSQFDRKNYFYPDLPTGYQISQLYHPIVGEGVVEVEA---ED 123

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G F    VGIER+HLEQDAGK IHD     S +DLNR+G ALMEIV++PD+R+  EA A+
Sbjct: 124 GSF--FNVGIERLHLEQDAGKLIHDLSPTESYVDLNRAGTALMEIVSRPDIRTPEEAVAY 181

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-----------WGTRCEVKNVNS 242
           + K+R+IL YLGTCDG+ME+G++RADVNVSVCR G              GTRCE+KNVNS
Sbjct: 182 VKKIRTILIYLGTCDGDMEKGNLRADVNVSVCRAGNYHKFKETGDFSFLGTRCEIKNVNS 241

Query: 243 IRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLL 302
            RF+  AI+YEARRQI ILEDGG I QETRL+DP+  ETRS+R+KE+A DYRYF +PDLL
Sbjct: 242 FRFISQAIQYEARRQIEILEDGGSITQETRLYDPTAGETRSMRSKEEAQDYRYFPDPDLL 301

Query: 303 PLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK 362
           PL +++ +I AIK  +PELPD KR RF+ E+G+S YDA VL+S+++ A YFE  A  RD 
Sbjct: 302 PLVLEQAWIDAIKADLPELPDDKRRRFMSEYGLSQYDAGVLISEQAKALYFEAAAKGRDA 361

Query: 363 KIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG 422
           K+V+NWV N++   L   GK   D P+    + +L++LI    IS KIAK++F+ +W   
Sbjct: 362 KLVSNWVTNEVSARLAADGKDFSDNPLPAAHVAQLVELIETNVISSKIAKEVFDYVWNGE 421

Query: 423 GTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGK 482
           G+P E+VE+ GL+QVTD  AIEK VDE+I +NP+  A +A KP  + WFVGQVMK TGGK
Sbjct: 422 GSPAEVVEKHGLKQVTDTGAIEKAVDEIIAANPDKAAAVAEKPQAIGWFVGQVMKATGGK 481

Query: 483 ANPSIVQKMLKEKLGI 498
           ANP+ V  +LK KLG+
Sbjct: 482 ANPAAVNDILKAKLGL 497


>gi|192291885|ref|YP_001992490.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Rhodopseudomonas
           palustris TIE-1]
 gi|192285634|gb|ACF02015.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Rhodopseudomonas
           palustris TIE-1]
          Length = 520

 Score =  583 bits (1503), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 293/521 (56%), Positives = 374/521 (71%), Gaps = 38/521 (7%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +   L  G TGDWEVVIG+E+HAQ+S  +KLFSGA+  FG + NT VS  DAAMPGMLP+
Sbjct: 6   KPSKLIKGATGDWEVVIGLEIHAQVSSNAKLFSGAATAFGGDQNTHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QA+ +GLGLNA I+  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V + 
Sbjct: 66  INEECVRQAIRSGLGLNAKIHLRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGEVVVDL- 124

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
           PD      +I VGIER+HLEQDAGK +HDQ+   + +DLNRSGVALMEIV+KPD+RSS +
Sbjct: 125 PDGD----SITVGIERLHLEQDAGKLLHDQHPTSTFVDLNRSGVALMEIVSKPDLRSSEQ 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA+++KLR+I+RYLGTCDG+ME+GS+RADVNVSV RPGE +GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVSKLRTIMRYLGTCDGDMEKGSLRADVNVSVRRPGEPYGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IEYEA+RQI ILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PDLLPLE  + 
Sbjct: 241 IEYEAQRQIGILEDGGKIDQETRLFDANKGETRSMRSKEEAHDYRYFPDPDLLPLEFTQA 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANW 368
           ++  +K  +PELPDAK+ R++ EF +S  DA VLV++   A YFEK+  N  + K  ANW
Sbjct: 301 YVDELKSGLPELPDAKKARYLKEFSLSDQDADVLVAEPERAAYFEKMVANGAEPKAAANW 360

Query: 369 VINDLLGVL--------------------------NRSGKSIEDTPISPNQLGELIDLII 402
            IN+ LG +                          +RSG+ I     +P     ++ ++ 
Sbjct: 361 FINEYLGQISKVEESDSVPAVVEPTISVSVGHGSTSRSGQ-ITINWTAPEANSAIVRMVT 419

Query: 403 DGTISGKIAKDIFNILWEKGGTP-----KEIVEELGLRQVTDLSAIEKVVDEVINSNPNN 457
              ISGK AK +  ++ E G        K IVE L L+QVTDLSAIEKVVD+++ +NP+ 
Sbjct: 420 SNLISGKSAKALLGLVIEIGPVADPDDVKTIVEHLNLKQVTDLSAIEKVVDDIVAANPDK 479

Query: 458 VARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
           VA++  KP ++ WFVGQVMK++GGKANP  V  +LK KLG+
Sbjct: 480 VAQVVAKPAMLGWFVGQVMKSSGGKANPQAVNDLLKRKLGL 520


>gi|114327617|ref|YP_744774.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Granulibacter
           bethesdensis CGDNIH1]
 gi|122327412|sp|Q0BTK1|GATB_GRABC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|114315791|gb|ABI61851.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Granulibacter bethesdensis CGDNIH1]
          Length = 483

 Score =  583 bits (1502), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 292/482 (60%), Positives = 364/482 (75%), Gaps = 6/482 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WE+VIG+EVHAQ+   SKLFSGA+  FGAEPN+QVS  DAA+PGMLP+LN  CV 
Sbjct: 7   GATGAWELVIGLEVHAQVISQSKLFSGAATAFGAEPNSQVSLVDAALPGMLPVLNRECVA 66

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TGLGL AHIN  S F RKNYFY DLPQGYQISQ   PIVG G + + +   + G  
Sbjct: 67  QAVRTGLGLKAHINPVSRFDRKNYFYADLPQGYQISQFAHPIVGSGTIEIEL---QDGST 123

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           R  ++G+ R+HLEQDAGKS+HDQ    S IDLNRSGVALMEIV++PDMRS  EA A+L K
Sbjct: 124 R--QIGVTRLHLEQDAGKSLHDQDPTRSFIDLNRSGVALMEIVSEPDMRSPEEAGAYLRK 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR+ILRYLGTCDGNMEEGSMRADVNVSV R GE + TRCE+KNVNSIR++  AIE EA+R
Sbjct: 182 LRTILRYLGTCDGNMEEGSMRADVNVSVRRAGEPFRTRCEIKNVNSIRYVMQAIEAEAKR 241

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QIAI E+G  + QETRLFDPS+ ETRS+R+KEDA DYRYF +PDLLPL +DED+I  +K 
Sbjct: 242 QIAIWEEGEEVDQETRLFDPSRGETRSMRSKEDAHDYRYFPDPDLLPLVLDEDWIEGLKA 301

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPD K  RF+ E+G++ YDA VLV++++ A +FE +A  RD ++ AN++  DL  V
Sbjct: 302 SLPELPDEKSARFVSEYGLTRYDAGVLVAEQASAHFFETVAKGRDARLAANYITGDLFAV 361

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LNR+G+SI D+PIS   LG L+DL+ D TI+G+IAK++F  + E G  P +IVE  GLRQ
Sbjct: 362 LNRTGRSITDSPISAEALGGLLDLLADNTINGRIAKEVFEAMAETGEHPADIVEARGLRQ 421

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           VTD  AI+  V +V+ +NP+ +A   + K  L  +FVGQVMK   GK NP++V + LK+ 
Sbjct: 422 VTDTGAIDTAVAQVLEANPDKLAEYRSGKDKLFGFFVGQVMKAMQGKGNPALVNEALKKA 481

Query: 496 LG 497
           LG
Sbjct: 482 LG 483


>gi|148553521|ref|YP_001261103.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sphingomonas
           wittichii RW1]
 gi|166198819|sp|A5V3U9|GATB_SPHWW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|148498711|gb|ABQ66965.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Sphingomonas wittichii RW1]
          Length = 494

 Score =  583 bits (1502), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 283/488 (57%), Positives = 359/488 (73%), Gaps = 8/488 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG+WEVVIG+EVHAQ+   +KLFSGAS  FGAEPN  VS  DAAMPGMLP+ N  C++
Sbjct: 8   GATGEWEVVIGLEVHAQVVSNAKLFSGASAAFGAEPNQSVSLVDAAMPGMLPVPNEECIR 67

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TG+ L A IN++S F RKNYFY DLPQGYQISQ   P+VGEG +++    +K+G  
Sbjct: 68  QAVKTGMALGAEINRWSRFDRKNYFYADLPQGYQISQLYHPLVGEGTITID-ADEKAGIA 126

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
               +G+ER+H+EQDAGK +HDQ+   S +DLNRSGVALMEIV+KPDMRS  EA A+L K
Sbjct: 127 EARTIGVERLHVEQDAGKLMHDQHPTRSYVDLNRSGVALMEIVSKPDMRSPSEAGAYLRK 186

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LRSILRY+G+CDGNMEEGSMRADVNVSV + G+ +GTR E KNVNSIRF+  AIE EA R
Sbjct: 187 LRSILRYVGSCDGNMEEGSMRADVNVSVRKAGDPFGTRTETKNVNSIRFVMAAIESEANR 246

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ ++E GG I QETRL+DP +NETRS+R+KEDA DYRYF +PDLLPLE+ E+F+   + 
Sbjct: 247 QVDVIEGGGKIVQETRLYDPDRNETRSMRSKEDAHDYRYFPDPDLLPLELSEEFVAQCRA 306

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK------KIVANWVI 370
           ++PELPDAKR R+ GE G+  Y+A+VL SD   A +FE L     K      +  +NW+I
Sbjct: 307 ELPELPDAKRARYEGELGLPAYNAAVLTSDVETARWFEALLDAAGKPGAEVARAASNWLI 366

Query: 371 NDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVE 430
           +DL G LNR GK+I+++P+SP Q  EL+ L+ DGT+SG +AK +F I+ E G  P  IVE
Sbjct: 367 SDLFGALNRLGKAIDESPVSPRQGAELLALVADGTLSGTLAKQVFEIMLETGDDPARIVE 426

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
           E GL+Q +D  AIE V+ EV+ +N + VA     K  L  +FVGQ MK  GGKANP +V 
Sbjct: 427 ERGLKQTSDTGAIEAVIAEVMAANADKVAEYRGGKDKLFGFFVGQTMKAMGGKANPGVVN 486

Query: 490 KMLKEKLG 497
           ++LK+ LG
Sbjct: 487 ELLKKTLG 494


>gi|254294335|ref|YP_003060358.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Hirschia baltica
           ATCC 49814]
 gi|254042866|gb|ACT59661.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Hirschia baltica
           ATCC 49814]
          Length = 506

 Score =  582 bits (1500), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 291/508 (57%), Positives = 363/508 (71%), Gaps = 24/508 (4%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           R   + SG TGDWEVV+G+EVHAQ++  SKLFSGAS +FGA+PN  V+  D A+PGMLP+
Sbjct: 4   RKPLIISGITGDWEVVMGLEVHAQITSKSKLFSGASTHFGADPNCNVALVDTALPGMLPV 63

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QAV TGLGLNA IN +S F RKNYFYPDLPQGYQISQ   PIVGEG++ V + 
Sbjct: 64  INEFCVEQAVRTGLGLNAQINLFSRFDRKNYFYPDLPQGYQISQFQYPIVGEGEIEVELE 123

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
              S     I VGIER+H+EQDAGKSIHD     + +DLNRSGVALMEIV+KPD+RS  E
Sbjct: 124 DGSS-----ITVGIERLHMEQDAGKSIHDLDPNATYVDLNRSGVALMEIVSKPDIRSPKE 178

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPG-----------EAWGTRCEVK 238
           A A++ KLRSI+  LGTC+G M EG++RADVNVSVC+ G              GTRCE+K
Sbjct: 179 ASAYVKKLRSIVVALGTCNGVMAEGNLRADVNVSVCKVGGYDKFQETGDFSHLGTRCEIK 238

Query: 239 NVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSE 298
           NVNS RF+  A EYEARRQ+ I+EDGG I QETRLFD     TRS+R+KEDA DYRYF +
Sbjct: 239 NVNSFRFIEQAAEYEARRQVEIIEDGGVIDQETRLFDAETGVTRSMRSKEDAHDYRYFPD 298

Query: 299 PDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV 358
           PDLLPL + ++++  IK  +PELPD K++RFI E+G+  YDA VL ++   A +FE++A 
Sbjct: 299 PDLLPLVLTQEYVDKIKANLPELPDQKKQRFIDEYGLKAYDAGVLSAESDKAAFFEEVAK 358

Query: 359 NRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFN-I 417
            RD K+ ANWV  +L G LN+    +ED+P+S  QLG LIDLI + TISGKIAKD+F  +
Sbjct: 359 GRDAKMAANWVTQELFGYLNKFDLELEDSPVSAKQLGGLIDLIANKTISGKIAKDVFQKL 418

Query: 418 LWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-------KPNLVSW 470
           + E    P  IVE  GL+QVTD  AIEKVVDE++ +NP+ V ++         KP  + W
Sbjct: 419 IEEDDANPAAIVERDGLKQVTDTGAIEKVVDEIMAANPDQVEQVKAQFAEGHKKPKALGW 478

Query: 471 FVGQVMKNTGGKANPSIVQKMLKEKLGI 498
           FVGQ MK +GGKANP  V ++LK KLGI
Sbjct: 479 FVGQAMKLSGGKANPQAVNEILKSKLGI 506


>gi|258543590|ref|YP_003189023.1| aspartyl/glutamyl-tRNA amidotransferase subunit beta [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256634668|dbj|BAI00644.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256637724|dbj|BAI03693.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256640778|dbj|BAI06740.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643833|dbj|BAI09788.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646888|dbj|BAI12836.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649941|dbj|BAI15882.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652931|dbj|BAI18865.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256655985|dbj|BAI21912.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 484

 Score =  580 bits (1495), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 279/481 (58%), Positives = 359/481 (74%), Gaps = 6/481 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WE+V+G+EVHAQ+   SKLFSGAS  FG +PNTQVS  DAA PGMLP++N  CV 
Sbjct: 7   GKTGPWEIVVGLEVHAQVISQSKLFSGASTKFGGDPNTQVSLVDAAFPGMLPVINKECVA 66

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QA+ TGLGLNA IN +S F RKNYFY DLPQGYQISQ + PI+G+G + + +   +SG+ 
Sbjct: 67  QAIRTGLGLNAQINLFSRFDRKNYFYADLPQGYQISQFEHPIIGKGSIEIEL---QSGET 123

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           R  ++GI R+HLEQDAGK +HDQ    S +DLNR+GVALMEIV++PD+R   EA A+L K
Sbjct: 124 R--QIGITRLHLEQDAGKLLHDQDPTKSFVDLNRAGVALMEIVSEPDIREPEEAGAYLRK 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR ILRYLGTCDGNMEEGSMRADVNVSV + GE + TRCE+KNVNSIRF+  AIE EA R
Sbjct: 182 LRQILRYLGTCDGNMEEGSMRADVNVSVRKAGEPFRTRCEIKNVNSIRFVMQAIEVEATR 241

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI I E+GG + QETRLFDP + ETR++R+KEDA DYRYF +PDLLPL +++ ++  +K 
Sbjct: 242 QIEIWENGGEVDQETRLFDPGRGETRTMRSKEDAHDYRYFPDPDLLPLVVEQAWVDELKS 301

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
           ++PELPDAKR RF  ++GI  YDA VLV+++++AD++E +A  RD K+ A+WVI DL   
Sbjct: 302 KLPELPDAKRARFQKDYGIPSYDAGVLVAEQAVADFYETVAKGRDGKLAASWVIGDLFAA 361

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LNR+  +IE +P+S   LG+++DLI DGTI+GKIAK++F  + E G +P  IVE  GLRQ
Sbjct: 362 LNRTSNTIETSPVSAASLGKMLDLIADGTINGKIAKEVFEDMVETGDSPDAIVERKGLRQ 421

Query: 437 VTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           VTD   I+  +  ++  + + VA     K  L  +FVGQVMK T GKANP++V   LK +
Sbjct: 422 VTDTGVIDAAIAAILEKHADKVAEYRGGKDKLFGFFVGQVMKETKGKANPALVNSALKAQ 481

Query: 496 L 496
           L
Sbjct: 482 L 482


>gi|294012192|ref|YP_003545652.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Sphingobium japonicum UT26S]
 gi|292675522|dbj|BAI97040.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Sphingobium japonicum UT26S]
          Length = 500

 Score =  578 bits (1491), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 277/491 (56%), Positives = 363/491 (73%), Gaps = 12/491 (2%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG+WEVVIG+EVHAQ++  +KLFSGA+  FGAEPNTQVS  DAAMPGMLP+ N  C++
Sbjct: 10  GATGEWEVVIGLEVHAQVTSQAKLFSGAATAFGAEPNTQVSLVDAAMPGMLPVPNRECIR 69

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TG+ + A INK+S F RKNYFY DLPQGYQISQ   P+VGEG++ +S+  DK+   
Sbjct: 70  QAVRTGMAIKAQINKWSRFDRKNYFYADLPQGYQISQLYHPLVGEGEIEISLD-DKNPDA 128

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            T ++GIERIH+EQDAGK +HDQ+   S +DLNRSGVALMEIV+KPDMRS  EA A+L+K
Sbjct: 129 ETKKIGIERIHVEQDAGKLMHDQHPTRSYVDLNRSGVALMEIVSKPDMRSPAEAGAYLSK 188

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR+ILRY+G+CDGNM++GSMRADVNVSV +PGE +GTR E KNVNS+RF+   +E+EA R
Sbjct: 189 LRTILRYVGSCDGNMDQGSMRADVNVSVRKPGEPFGTRTETKNVNSVRFVMAVVEHEANR 248

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE GG + QETRL+DP +NETRS+R+KEDA DYRYF +PDLLPLE+D+ F+   ++
Sbjct: 249 QVDVLEAGGKVVQETRLYDPDRNETRSMRSKEDAHDYRYFPDPDLLPLELDDAFLEECRQ 308

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK----------KIVA 366
            +PELPDAKR R+  + G+S Y+A+ L +D   A +FE L     +          K  A
Sbjct: 309 SLPELPDAKRRRYEKDLGLSAYNAATLTADADTARWFEALLAEGARIQKKSEGEVAKASA 368

Query: 367 NWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK 426
           NW++++L G LNR GKS+ED+P+ P +  EL+ LI DGTISG IAK +F I+ E G +  
Sbjct: 369 NWLLSELYGALNRLGKSLEDSPVGPEEGAELLALIADGTISGTIAKQVFEIMLETGDSAP 428

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANP 485
           +IVEE GL+Q +D  AIE  V +V+  N + V +  A K  L  +FVGQ MK   GKANP
Sbjct: 429 KIVEEKGLKQTSDTGAIEAAVAKVLADNGDKVEQYKAGKEALFGFFVGQTMKAMQGKANP 488

Query: 486 SIVQKMLKEKL 496
            +V +++++ L
Sbjct: 489 QVVNELIRKAL 499


>gi|94497361|ref|ZP_01303932.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sphingomonas sp.
           SKA58]
 gi|94423224|gb|EAT08254.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sphingomonas sp.
           SKA58]
          Length = 501

 Score =  578 bits (1490), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 276/492 (56%), Positives = 363/492 (73%), Gaps = 12/492 (2%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG+WEVVIG+EVHAQ++  +KLFSGA+  FGAEPNTQVS  DAAMPGMLP+ N  C++
Sbjct: 10  GATGEWEVVIGLEVHAQVTSNAKLFSGAATAFGAEPNTQVSLVDAAMPGMLPVPNRECIR 69

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TG+ ++A INK+S F RKNYFY DLPQGYQISQ   PIVGEG++ + +  +K+ + 
Sbjct: 70  QAVRTGMAIDAQINKWSRFDRKNYFYADLPQGYQISQLYHPIVGEGQIEIVLD-EKNPEA 128

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            T  +G+ERIH+EQDAGK +HDQ+   S +DLNRSGVALMEIV+KPDMRS  EA A+L+K
Sbjct: 129 STKVIGVERIHVEQDAGKLMHDQHPTSSYVDLNRSGVALMEIVSKPDMRSPAEAGAYLSK 188

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR+ILRY+G+CDGNM++GSMRADVNVSV RPGEA+GTR E KNVNS+RF+   +E+EA R
Sbjct: 189 LRTILRYVGSCDGNMDQGSMRADVNVSVRRPGEAFGTRTETKNVNSVRFVMAVVEHEANR 248

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE GG I QETRL+DP +NETRS+R+KEDA DYRYF +PDLLPLE+D+ F+   ++
Sbjct: 249 QVDVLEAGGKIVQETRLYDPDRNETRSMRSKEDAHDYRYFPDPDLLPLELDDAFLEECRQ 308

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK----------KIVA 366
            +PELPDAKR R++ + G+S Y+A+ L +D   A +FE L     +          K  A
Sbjct: 309 SLPELPDAKRARYVNDLGLSAYNATTLTADADTARWFEALLAQGARIQKKSEGEVAKASA 368

Query: 367 NWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK 426
           NW++++L G LNR GKS++++P+ P +  EL+ L+ DGTISG IAK +F I+ E G    
Sbjct: 369 NWLLSELYGALNRLGKSLDESPVGPEEGAELLALVADGTISGTIAKQVFEIMLETGARAP 428

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANP 485
            IVEE GL+Q +D  AIE  V +V+  N + VA+    K  L  +FVGQ MK   GKANP
Sbjct: 429 AIVEEKGLKQTSDTGAIEAAVAKVLADNADKVAQYKGGKEALFGFFVGQTMKAMQGKANP 488

Query: 486 SIVQKMLKEKLG 497
            +V +++K+ L 
Sbjct: 489 QVVNELVKKGLA 500


>gi|329851414|ref|ZP_08266171.1| glutamyl-tRNA and/or aspartyl-tRNA amidotransferase, B subunit
           [Asticcacaulis biprosthecum C19]
 gi|328840260|gb|EGF89832.1| glutamyl-tRNA and/or aspartyl-tRNA amidotransferase, B subunit
           [Asticcacaulis biprosthecum C19]
          Length = 496

 Score =  578 bits (1489), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 289/498 (58%), Positives = 367/498 (73%), Gaps = 8/498 (1%)

Query: 4   LDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAM 63
           LD   A +     G TG WE++IG+EVHAQ++  +KLFSGA V FGA PN QVS  DAAM
Sbjct: 5   LDIRPADASKFIQGRTGPWELIIGLEVHAQVASNTKLFSGAKVGFGAGPNEQVSLVDAAM 64

Query: 64  PGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGK 123
           PGMLP+LN  CV+QAV TGLGL A IN++S F RKNYFYPDLPQGYQISQ   PIVGEG+
Sbjct: 65  PGMLPVLNRFCVEQAVKTGLGLKAQINRHSRFDRKNYFYPDLPQGYQISQLFHPIVGEGE 124

Query: 124 VSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPD 183
           V V +         TI V IER+HLEQDAGKSIHD     + +DLNR+G ALMEIV+KPD
Sbjct: 125 VLVELDD------TTITVRIERLHLEQDAGKSIHDIDPVATYVDLNRAGTALMEIVSKPD 178

Query: 184 MRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSI 243
           MRSS EA A+  KLR+IL YLGTCDG+ME+G+MRAD NVSV RPGE  GTRCE+KNVNS 
Sbjct: 179 MRSSDEAVAYFKKLRTILIYLGTCDGDMEKGNMRADCNVSVRRPGEKLGTRCEIKNVNSF 238

Query: 244 RFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLP 303
           RF+  AIE+EARRQI +LEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PDLLP
Sbjct: 239 RFMQQAIEFEARRQIEVLEDGGSIIQETRLFDATKVETRSMRSKEEAHDYRYFPDPDLLP 298

Query: 304 LEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKK 363
           LEI+E +I  I++ + ELPD K+ RF+ ++G+S YDA VL+SD++ A+Y+E+ A  RD K
Sbjct: 299 LEIEEAWIEEIRQHLVELPDDKKARFVSQYGLSGYDAGVLISDQARAEYYEQAAKGRDAK 358

Query: 364 IVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG 423
           +VANWV N LL  L  +G+ I D+P+ P  +  L++LI    IS KIAK +F  +W++ G
Sbjct: 359 LVANWVTNGLLSRLAEAGQDIADSPLPPEHISGLVELIETKVISSKIAKQVFEHMWDEKG 418

Query: 424 --TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGG 481
             TP EIV++  L+   D  A++K +D++I +N +  A + TKP  + WFVGQVM+ T G
Sbjct: 419 ILTPAEIVDKHDLKTDNDTGALDKAIDDLIAANADKAAEVMTKPQALGWFVGQVMRATQG 478

Query: 482 KANPSIVQKMLKEKLGIK 499
           KA+P+ V  +LK KLG++
Sbjct: 479 KADPATVNALLKAKLGVE 496


>gi|209545485|ref|YP_002277714.1| aspartyl/glutamyl-tRNA amidotransferase subunit B
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533162|gb|ACI53099.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 482

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 285/484 (58%), Positives = 356/484 (73%), Gaps = 6/484 (1%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           L  G TG WE+V+G+EVHAQ+   SKLFSGAS ++G EPNT VS  DA  PGMLP++N  
Sbjct: 4   LVEGRTGPWELVVGLEVHAQVISRSKLFSGASASYGGEPNTHVSLVDAGFPGMLPVINRE 63

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV QAV TGLGL A IN  S F RKNYFY DLP GYQISQ   PI+GEG V + +     
Sbjct: 64  CVAQAVRTGLGLKARINLESRFDRKNYFYADLPTGYQISQFAHPIIGEGAVEIELA---D 120

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G  RTI  GI R+HLEQDAGKS+HDQ    S IDLNR+GVALMEIV++PD+R+  EA A+
Sbjct: 121 GATRTI--GITRLHLEQDAGKSMHDQDPTRSFIDLNRAGVALMEIVSEPDIRTPEEAGAY 178

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYE 253
           L KLR ILRYLGTCDGNMEEGSMRADVNVSV + GE + TRCE+KNVNSIR++  AIE E
Sbjct: 179 LRKLRMILRYLGTCDGNMEEGSMRADVNVSVRKAGEPFRTRCEIKNVNSIRYVMQAIEVE 238

Query: 254 ARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRA 313
           A RQ+ I E GG + QETRLFDP++ ETRSLR+KEDA DYRYF +PDLLPL I+E ++ +
Sbjct: 239 AVRQVEIWESGGEVDQETRLFDPARGETRSLRSKEDAHDYRYFPDPDLLPLVIEEAWVES 298

Query: 314 IKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDL 373
           +   +PELPDAKR+RF  E+GI  YDA VLV++++ AD++E +A  RD ++ ANWVI DL
Sbjct: 299 LAAVLPELPDAKRQRFQDEYGIPRYDAGVLVAEQATADFYETVARGRDPRLAANWVIGDL 358

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
              LNR+G++I+D+PIS + LG ++DL+ DGTI+GKIAK++F  + E G     IVE  G
Sbjct: 359 FAALNRTGRTIQDSPISADALGGMLDLVTDGTINGKIAKEVFEDMLETGDPAAAIVERKG 418

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           LRQVTD  AI+  V  V+ +N + +A   + K  L  +FVGQVMK   GK NP++V + L
Sbjct: 419 LRQVTDTGAIDAAVQAVLAANADKLAEYRSGKDKLFGFFVGQVMKAMAGKGNPALVNEAL 478

Query: 493 KEKL 496
           K+ L
Sbjct: 479 KKVL 482


>gi|315500152|ref|YP_004088955.1| glutamyl-tRNA(gln) amidotransferase, b subunit [Asticcacaulis
           excentricus CB 48]
 gi|315418164|gb|ADU14804.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Asticcacaulis
           excentricus CB 48]
          Length = 489

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 293/484 (60%), Positives = 363/484 (75%), Gaps = 7/484 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WE+VIG+E+HAQ++  SKLFSGA+V FGA PN QVS  DA  PGMLP+LN  CV+
Sbjct: 11  GRTGPWELVIGLEIHAQVASTSKLFSGAAVGFGAGPNEQVSLVDAGFPGMLPVLNRFCVE 70

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVGEG+V + +     G  
Sbjct: 71  QAVKTGLGLKAQINPHSRFDRKNYFYPDLPQGYQISQLFYPIVGEGEVLIDLS---DGTQ 127

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           +T+   IER+HLEQDAGKSIHD     + +DLNR+G ALMEIV+KPD+RS+ EA A+  K
Sbjct: 128 KTVR--IERLHLEQDAGKSIHDLDPNNTYVDLNRAGTALMEIVSKPDIRSAEEAVAYFKK 185

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           +R+IL YLGT DG+ME+G+MRADVNVSVC+PG  +GTRCE+KNVNS RF+  AIEYEARR
Sbjct: 186 IRTILVYLGTSDGDMEKGNMRADVNVSVCKPGAEFGTRCEIKNVNSFRFMQQAIEYEARR 245

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI I+EDGG I QETRLFD  K ETRSLR+KE+A DYRYF +PDLLPLE++  +I  IKK
Sbjct: 246 QIEIIEDGGTITQETRLFDSVKVETRSLRSKEEAHDYRYFPDPDLLPLELELAWIEDIKK 305

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPD KR+R + ++G+S YDA+VLV++++ ADY+E  A +RD K+VANWV N+LL  
Sbjct: 306 SLPELPDDKRQRLMTQYGLSQYDATVLVTEQARADYYEAAAKDRDAKLVANWVTNELLAR 365

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG--TPKEIVEELGL 434
           L + G  IE +P+ P Q+  L++LI    IS KIAK +F  +WE  G  TP EIVE+ GL
Sbjct: 366 LTKDGLEIEQSPLPPAQIAGLVELIETNVISSKIAKTVFEHMWEGKGTITPAEIVEKHGL 425

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           +QVTD  AIEK +DE+I +N         KP  + WFVGQVMK TGGKANP+ V  +LK 
Sbjct: 426 KQVTDTGAIEKAIDEIIAANLEKAEAAKEKPQAIGWFVGQVMKATGGKANPAAVNDLLKT 485

Query: 495 KLGI 498
           KLG+
Sbjct: 486 KLGL 489


>gi|162148749|ref|YP_001603210.1| aspartyl/glutamyl-tRNA amidotransferase subunit B
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787326|emb|CAP56920.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 483

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 285/484 (58%), Positives = 356/484 (73%), Gaps = 6/484 (1%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           L  G TG WE+V+G+EVHAQ+   SKLFSGAS ++G EPNT VS  DA  PGMLP++N  
Sbjct: 5   LVEGRTGPWELVVGLEVHAQVISRSKLFSGASASYGGEPNTHVSLVDAGFPGMLPVINRE 64

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV QAV TGLGL A IN  S F RKNYFY DLP GYQISQ   PI+GEG V + +     
Sbjct: 65  CVAQAVRTGLGLKARINLESRFDRKNYFYADLPTGYQISQFAHPIIGEGAVEIELA---D 121

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G  RTI  GI R+HLEQDAGKS+HDQ    S IDLNR+GVALMEIV++PD+R+  EA A+
Sbjct: 122 GATRTI--GITRLHLEQDAGKSMHDQDPTRSFIDLNRAGVALMEIVSEPDIRTPEEAGAY 179

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYE 253
           L KLR ILRYLGTCDGNMEEGSMRADVNVSV + GE + TRCE+KNVNSIR++  AIE E
Sbjct: 180 LRKLRMILRYLGTCDGNMEEGSMRADVNVSVRKAGEPFRTRCEIKNVNSIRYVMQAIEVE 239

Query: 254 ARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRA 313
           A RQ+ I E GG + QETRLFDP++ ETRSLR+KEDA DYRYF +PDLLPL I+E ++ +
Sbjct: 240 AVRQVEIWESGGEVDQETRLFDPARGETRSLRSKEDAHDYRYFPDPDLLPLVIEEAWVES 299

Query: 314 IKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDL 373
           +   +PELPDAKR+RF  E+GI  YDA VLV++++ AD++E +A  RD ++ ANWVI DL
Sbjct: 300 LAAVLPELPDAKRQRFQDEYGIPRYDAGVLVAEQATADFYETVARGRDPRLAANWVIGDL 359

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
              LNR+G++I+D+PIS + LG ++DL+ DGTI+GKIAK++F  + E G     IVE  G
Sbjct: 360 FAALNRTGRTIQDSPISADALGGMLDLVTDGTINGKIAKEVFEDMLETGDPAAAIVERKG 419

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           LRQVTD  AI+  V  V+ +N + +A   + K  L  +FVGQVMK   GK NP++V + L
Sbjct: 420 LRQVTDTGAIDAAVQAVLAANADKLAEYRSGKDKLFGFFVGQVMKAMAGKGNPALVNEAL 479

Query: 493 KEKL 496
           K+ L
Sbjct: 480 KKVL 483


>gi|87200844|ref|YP_498101.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Novosphingobium
           aromaticivorans DSM 12444]
 gi|109892042|sp|Q2G4F6|GATB_NOVAD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|87136525|gb|ABD27267.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 497

 Score =  576 bits (1485), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 279/498 (56%), Positives = 357/498 (71%), Gaps = 13/498 (2%)

Query: 11  SESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPIL 70
           SE    G TG+WEVVIG+EVHAQ++  +KLFSGA+  FGAEPNTQVS  DAAMPGMLP+ 
Sbjct: 2   SEYRIQGATGEWEVVIGLEVHAQVTSNAKLFSGAATAFGAEPNTQVSLVDAAMPGMLPVP 61

Query: 71  NGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP 130
           N  C++QAV TG+ +NA INK+S F RKNYFY DLPQGYQISQ   PIVGEG + V +  
Sbjct: 62  NRECIRQAVRTGMAINAQINKWSRFDRKNYFYADLPQGYQISQLYHPIVGEGSIEVQLDD 121

Query: 131 DKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEA 190
                 +TI  GIERIH+EQDAGK +HDQ+  +S +DLNRSGVALMEIV++PDMRS  EA
Sbjct: 122 KNPESLKTI--GIERIHVEQDAGKLMHDQHPTMSYVDLNRSGVALMEIVSRPDMRSPAEA 179

Query: 191 KAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAI 250
            A+L+KLR+ILRY+G+CDGNM++GSMRADVNVSV RPGE +GTR E KNVNS+RF+   +
Sbjct: 180 GAYLSKLRTILRYVGSCDGNMDQGSMRADVNVSVRRPGEPFGTRTETKNVNSVRFVMAVV 239

Query: 251 EYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDF 310
           E EA+RQ+A++EDGG + QETRL+DP +NETRS+R+KEDA DYRYF +PDLLPLE+D+ F
Sbjct: 240 EQEAKRQVALIEDGGTVVQETRLYDPDRNETRSMRSKEDAHDYRYFPDPDLLPLELDDAF 299

Query: 311 IRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKI------ 364
           +   +  +PELPDAKR R+    G+S Y+A VL +D   A +FE L      K       
Sbjct: 300 LEECRASLPELPDAKRHRYETALGLSAYNAGVLTADVETARWFEALLAETAAKAKKPEAE 359

Query: 365 ----VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
                ANW+I++L G LN+ G S+E +P++P    EL+ LI DGTISG IAK +   + E
Sbjct: 360 VAKQAANWLISELFGALNKLGASLETSPVTPAAGAELLALIADGTISGSIAKQVLEKMLE 419

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNT 479
            G     IVE  GL+Q +D  AIE  +D ++ +N + V +  A K  L  +FVGQ MK  
Sbjct: 420 TGDGAAAIVEREGLKQTSDTGAIEAAIDGILAANADKVGQYKAGKEALFGFFVGQTMKAM 479

Query: 480 GGKANPSIVQKMLKEKLG 497
            GKANP +V ++L++KLG
Sbjct: 480 QGKANPGVVNELLRKKLG 497


>gi|307292657|ref|ZP_07572503.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sphingobium
           chlorophenolicum L-1]
 gi|306880723|gb|EFN11939.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sphingobium
           chlorophenolicum L-1]
          Length = 500

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 277/492 (56%), Positives = 361/492 (73%), Gaps = 12/492 (2%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG+WEVVIG+EVHAQ++  +KLFSGA+  FGAEPNTQVS  DAAMPGMLP+ N  C++
Sbjct: 10  GATGEWEVVIGLEVHAQVTSEAKLFSGAATAFGAEPNTQVSLVDAAMPGMLPVPNRECIR 69

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TG+ + A INK+S F RKNYFY DLPQGYQISQ   P+VGEG + +S+  DK+   
Sbjct: 70  QAVRTGMAIEAQINKWSRFDRKNYFYADLPQGYQISQLYHPLVGEGAIEISLD-DKNPDA 128

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            T  +GIERIH+EQDAGK +HDQ+   S +DLNRSGVALMEIV+KPDMRS  EA A+L+K
Sbjct: 129 VTKRIGIERIHVEQDAGKLMHDQHPTRSYVDLNRSGVALMEIVSKPDMRSPAEAGAYLSK 188

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR+ILRY+G+CDGNM++GSMRADVNVSV +PGE +GTR E KNVNS+RF+   +E+EA R
Sbjct: 189 LRTILRYVGSCDGNMDQGSMRADVNVSVRKPGEEFGTRTETKNVNSVRFVMAVVEHEANR 248

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE GG + QETRL+DP +NETRS+R+KEDA DYRYF +PDLLPLE+D+ F+   ++
Sbjct: 249 QVDVLEAGGKVVQETRLYDPDRNETRSMRSKEDAHDYRYFPDPDLLPLELDDAFLEECRQ 308

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK----------KIVA 366
            +PELPDAKR R+  + G+S Y+A+ L +D   A +FE L     +          K  A
Sbjct: 309 SLPELPDAKRRRYEQDLGLSAYNAATLTADADTARWFEALLAEGARIQKKSESEVAKASA 368

Query: 367 NWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK 426
           NW++++L G LNR GKS+ED+P+ P +  EL+ LI DGTISG IAK +F I+ E G    
Sbjct: 369 NWLLSELYGALNRLGKSLEDSPVGPEEGAELLALIADGTISGTIAKQVFEIMLETGERAP 428

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANP 485
           ++VEE GL+Q +D  AIE  V +V+  N + V +  A K  L  +FVGQ MK   GKANP
Sbjct: 429 KVVEEKGLKQTSDTGAIEAAVAKVLADNGDKVEQYKAGKEALFGFFVGQTMKAMQGKANP 488

Query: 486 SIVQKMLKEKLG 497
            +V +++++ LG
Sbjct: 489 QVVNELIRKALG 500


>gi|329113631|ref|ZP_08242409.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acetobacter pomorum DM001]
 gi|326697038|gb|EGE48701.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acetobacter pomorum DM001]
          Length = 484

 Score =  575 bits (1483), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 278/481 (57%), Positives = 358/481 (74%), Gaps = 6/481 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WE+V+G+EVHAQ+   SKLFSGAS  FG +PNTQVS  DAA PGMLP++N  CV 
Sbjct: 7   GKTGPWEIVVGLEVHAQVISQSKLFSGASTKFGGDPNTQVSLVDAAFPGMLPVINKECVA 66

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QA+ TGLGLNA IN +S F RKNYFY DLPQGYQISQ + PI+G G + + +   +SG+ 
Sbjct: 67  QAIRTGLGLNAQINLFSRFDRKNYFYADLPQGYQISQFEHPIIGTGSIEIEL---QSGET 123

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           R  ++GI R+HLEQDAGK +HDQ  + S +DLNR+GVALMEIV++PD+    EA A+L K
Sbjct: 124 R--QIGITRLHLEQDAGKLLHDQDPSKSFVDLNRAGVALMEIVSEPDICEPEEAGAYLRK 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR ILRYLGTCDGNMEEGSMRADVNVSV + GE + TRCE+KNVNSIRF+  AIE EA R
Sbjct: 182 LRQILRYLGTCDGNMEEGSMRADVNVSVRKAGEPFRTRCEIKNVNSIRFVMQAIEVEATR 241

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI I E+GG + QETRLFDP + ETR++R+KEDA DYRYF +PDLLPL +++ ++  +K 
Sbjct: 242 QIEIWENGGEVDQETRLFDPGRGETRTMRSKEDAHDYRYFPDPDLLPLVVEQAWVDDLKS 301

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
           ++PELPDAKR RF  ++GI  YDA VLV+++++AD++E +A  RD K+ A+WVI DL   
Sbjct: 302 KLPELPDAKRARFQKDYGIPSYDAGVLVAEQAVADFYETVAKGRDGKLAASWVIGDLFAA 361

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LNR+  +IE +P+S   LG+++DLI DGTI+GKIAK++F  + E G +P  IVE  GLRQ
Sbjct: 362 LNRTSNTIETSPVSAASLGKMLDLIADGTINGKIAKEVFEDMVETGDSPDAIVERKGLRQ 421

Query: 437 VTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           VTD   I+  +  ++  + + VA     K  L  +FVGQVMK T GKANP++V   LK +
Sbjct: 422 VTDTGVIDSAIAAILEKHADKVAEYRGGKDKLFGFFVGQVMKETKGKANPALVNSALKAQ 481

Query: 496 L 496
           L
Sbjct: 482 L 482


>gi|254419996|ref|ZP_05033720.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Brevundimonas sp. BAL3]
 gi|196186173|gb|EDX81149.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Brevundimonas sp. BAL3]
          Length = 526

 Score =  575 bits (1482), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 289/492 (58%), Positives = 360/492 (73%), Gaps = 16/492 (3%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TGDWE+V+G+E+HAQ++  +KLFSGA+V FGA PN QVS  DA  PGMLP LN  CV+
Sbjct: 13  GRTGDWEIVMGLEIHAQVASKAKLFSGAAVGFGAGPNEQVSLVDAGFPGMLPTLNKHCVE 72

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TGLGL A INK S F RKNYFYPDLP GYQISQ   PIVGEG V V     + G F
Sbjct: 73  QAVKTGLGLRAQINKRSQFDRKNYFYPDLPTGYQISQLYYPIVGEGVVEVEA---EDGSF 129

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
               VGIER+HLEQDAGK IHD     S +DLNR+G ALMEIV++PD+R+  EA A++ K
Sbjct: 130 --FNVGIERLHLEQDAGKLIHDLSPTESYVDLNRAGTALMEIVSRPDLRTPEEAVAYVKK 187

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-----------WGTRCEVKNVNSIRF 245
           +R+IL YLGTCDG+ME+G++RADVNVSVCR G              GTRCE+KNVNS RF
Sbjct: 188 IRTILIYLGTCDGDMEKGNLRADVNVSVCRAGNYEKFKASGDFSFLGTRCEIKNVNSFRF 247

Query: 246 LGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLE 305
           +  AI+YEARRQI ILEDGG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLPL+
Sbjct: 248 ISQAIQYEARRQIEILEDGGSITQETRLFDPTKGETRSMRSKEEAQDYRYFPDPDLLPLD 307

Query: 306 IDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIV 365
           ++E +I  IK  +PELPD KR+R + E+G+S YDA VL+S+++ ADYFE  A  RD K+V
Sbjct: 308 LEEAWIAEIKASLPELPDEKRKRLMSEYGLSQYDAIVLISEQAKADYFEAAAKGRDAKLV 367

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           +NWV N++   L   GK   + P+    + +L++LI    IS KIAK++F+ +W   G+P
Sbjct: 368 SNWVTNEVSARLAADGKDFSENPLPAAHVAQLVELIETNVISSKIAKEVFDHVWNGEGSP 427

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANP 485
            E+VE+ GL+QVTD  AIEK VDE+I +NP+  A +A KP  + WFVGQVMK TGGKANP
Sbjct: 428 AEVVEKHGLKQVTDTGAIEKAVDEIIAANPDKAAAVAEKPQALGWFVGQVMKATGGKANP 487

Query: 486 SIVQKMLKEKLG 497
           + V  +LK KLG
Sbjct: 488 AAVNDILKAKLG 499


>gi|326388347|ref|ZP_08209943.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326207079|gb|EGD57900.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 497

 Score =  574 bits (1480), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 280/491 (57%), Positives = 356/491 (72%), Gaps = 13/491 (2%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG+WEVVIG+EVHAQ++  +KLFSGA+  FGAEPNTQVS  DAAMPGMLP+ N  C++
Sbjct: 8   GATGEWEVVIGLEVHAQVTSSAKLFSGAATAFGAEPNTQVSLIDAAMPGMLPVPNRECIR 67

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TG+ +NA INK+S F RKNYFY DLPQGYQISQ   P+VGEG V +++   K  + 
Sbjct: 68  QAVRTGIAINAQINKWSRFDRKNYFYADLPQGYQISQLYHPLVGEGSVEIAVDEKKPDET 127

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           +TI  G+ERIH+EQDAGK +HDQ+  +S +DLNRSGVALMEIV++PDMRS  EA A+L+K
Sbjct: 128 KTI--GVERIHVEQDAGKLMHDQHPTMSYVDLNRSGVALMEIVSRPDMRSPAEAGAYLSK 185

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR+ILRY+G+CDGNM++GSMRADVNVSV RPGE +GTR E KNVNS+RF+  AIEYEA R
Sbjct: 186 LRTILRYVGSCDGNMDQGSMRADVNVSVRRPGEPFGTRTETKNVNSVRFVMQAIEYEANR 245

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE GG I QETRLFDP    TRS+R+KEDA DYRYF +PDLLPLE+ + FI   + 
Sbjct: 246 QVDVLEGGGKIVQETRLFDPDSGTTRSMRSKEDAHDYRYFPDPDLLPLELTDAFIEDCRA 305

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK----------KIVA 366
            +PELPDAKR R+    G+S Y+A VL ++   A +FEKL     +          +  +
Sbjct: 306 SLPELPDAKRHRYETVLGLSSYNAGVLTAEVETARWFEKLLAESARRQGKSESDVARQAS 365

Query: 367 NWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK 426
           NW+ ++L GVLN+ GK++ED+P+SP    EL+ L+ DGTISG IAK +   + E G  P 
Sbjct: 366 NWLTSELFGVLNKLGKNLEDSPVSPEAGAELLALVGDGTISGSIAKQVLEKMLETGDAPG 425

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANP 485
            IVE  GL+Q TD  AIE  VD V+ +N + VA+    K  L  +FVGQ MK   GK NP
Sbjct: 426 SIVEREGLKQTTDTGAIEAAVDAVLAANADKVAQYKGGKEALFGFFVGQTMKAMQGKGNP 485

Query: 486 SIVQKMLKEKL 496
            +V ++LK+KL
Sbjct: 486 QLVNQVLKDKL 496


>gi|149916239|ref|ZP_01904760.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter sp.
           AzwK-3b]
 gi|149809899|gb|EDM69750.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter sp.
           AzwK-3b]
          Length = 507

 Score =  572 bits (1475), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 282/512 (55%), Positives = 362/512 (70%), Gaps = 18/512 (3%)

Query: 1   MVSLD-THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFF 59
           MV LD T+      + +G   DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ VSF 
Sbjct: 1   MVMLDLTYDPPKPKVIAGAKHDWELVIGMEVHAQVASKAKLFSGASTEFGAEPNSNVSFV 60

Query: 60  DAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIV 119
           DAAMPGMLP++N  C++QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   P+V
Sbjct: 61  DAAMPGMLPVINEFCIEQAVRTGLGLKAKINLWSAFDRKNYFYPDLPQGYQISQLYHPLV 120

Query: 120 GEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIV 179
           GEG++ V + P  +   R     IERIH+EQDAGKSIHD   A+S +DLNR+GVALMEIV
Sbjct: 121 GEGEILVDMEPGIARLVR-----IERIHVEQDAGKSIHDMDPAMSFVDLNRTGVALMEIV 175

Query: 180 TKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPG----------- 228
           ++PD+R   EA A++TKLR ILRYLGTCDGNM+ G++RADVNVS+CRPG           
Sbjct: 176 SRPDIRGPEEAAAYVTKLRQILRYLGTCDGNMQNGNLRADVNVSICRPGAYEKYMETQDF 235

Query: 229 EAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKE 288
              GTRCE+KN+NS+RF+  AIEYEARRQI I+E GG + QETRL+DP K ETRS+R+KE
Sbjct: 236 SHLGTRCEIKNMNSMRFIQQAIEYEARRQIQIVESGGSVVQETRLYDPDKGETRSMRSKE 295

Query: 289 DALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKS 348
           +A DYRYF +PDLLPLEI++ ++  I   +PELPD K+ RFI ++G++ YDA+VL +D  
Sbjct: 296 EAHDYRYFPDPDLLPLEIEQAWVDGIAASLPELPDEKKARFIADYGVTEYDANVLTADVD 355

Query: 349 IADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISG 408
           +A YFE      D K  ANWVIN++LG  N++  S     ++P     ++ ++    IS 
Sbjct: 356 LAQYFEDSVAGGDGKRTANWVINEVLGRANKAEISPRQI-VAPEVNAAILAMVARDEIST 414

Query: 409 KIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLV 468
           KIAKD+  +  E G  P+EIVE  G++QVTD  AIE  VD++I  NP  V +    P L 
Sbjct: 415 KIAKDVLELHIETGRAPEEIVETEGMKQVTDTGAIEAAVDQIIADNPAQVEKAKANPKLA 474

Query: 469 SWFVGQVMKNTGGKANPSIVQKMLKEKLGIKE 500
            WFVGQVMK TGGKANP  V  ++++KLG+ +
Sbjct: 475 GWFVGQVMKATGGKANPKAVNDIIQQKLGLDQ 506


>gi|296115808|ref|ZP_06834434.1| aspartyl/glutamyl-tRNA amidotransferase subunit B
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295977785|gb|EFG84537.1| aspartyl/glutamyl-tRNA amidotransferase subunit B
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 482

 Score =  571 bits (1471), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 286/484 (59%), Positives = 354/484 (73%), Gaps = 6/484 (1%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           L  G TG WE+V+G+EVHAQ+   SKLFSGAS  +G   NT VS  DA  PGMLP++N  
Sbjct: 4   LIEGKTGTWEIVVGLEVHAQVISKSKLFSGASATYGGNANTHVSLVDAGFPGMLPVINRE 63

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV QAV TGLGL A IN  S F RKNYFY DLP GYQISQ   PIVGEG V + +     
Sbjct: 64  CVAQAVRTGLGLKARINLQSRFDRKNYFYADLPTGYQISQFTHPIVGEGTVEIEL---SD 120

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G  R I  GI R+HLEQDAGKS+HDQ    S IDLNR+GVALMEIV++PD+RS  EA A+
Sbjct: 121 GTVRHI--GITRLHLEQDAGKSMHDQDPTRSFIDLNRAGVALMEIVSEPDIRSPEEAGAY 178

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYE 253
           L KLR ILRYLGTCDGNMEEGSMRADVNVSV +  E + TRCE+KNVNSIR++  AIE E
Sbjct: 179 LRKLRMILRYLGTCDGNMEEGSMRADVNVSVRKKDEPFRTRCEIKNVNSIRYVMHAIEVE 238

Query: 254 ARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRA 313
           A RQ+ I E GG + QETRLFDPS+NETRSLR+KEDA DYRYF +PDLLPL I E+++R 
Sbjct: 239 AARQVEIWEAGGSVDQETRLFDPSRNETRSLRSKEDAHDYRYFPDPDLLPLVIGEEWVRN 298

Query: 314 IKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDL 373
           ++K +PELPD KR+RF  E+ I  YDA+VLV++++IADY+E +A  RD ++VANWV  DL
Sbjct: 299 LEKGLPELPDDKRDRFEKEYKIPHYDANVLVAEQAIADYYETVARGRDGRLVANWVTGDL 358

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
              LN+S + I D+PIS   LG ++DL+ DGTI+GKIAK++F  + E G +  +IVE  G
Sbjct: 359 FAALNKSSRHISDSPISAQALGGMLDLVADGTINGKIAKEVFEDMLETGDSAADIVERKG 418

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           L+QVTD  AI+ VV +++  + + VA   + K  L  +FVGQVMK   GKANP++V + L
Sbjct: 419 LKQVTDTGAIDTVVADIMTKHADKVAEYRSGKDRLFGFFVGQVMKAMAGKANPALVNEAL 478

Query: 493 KEKL 496
           K+ L
Sbjct: 479 KKVL 482


>gi|56551678|ref|YP_162517.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|241761201|ref|ZP_04759289.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|56543252|gb|AAV89406.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|241374108|gb|EER63605.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 511

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 279/490 (56%), Positives = 361/490 (73%), Gaps = 13/490 (2%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           +  G TG WE+V+G+EVHAQ+   SKLFSGA+  FGAEPN+QVS  DAAMPGMLP++N  
Sbjct: 26  ILEGATGSWEIVVGLEVHAQVISKSKLFSGAATAFGAEPNSQVSLIDAAMPGMLPVVNRE 85

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           C++QAV TGL + A IN+ S F RKNYFY DLPQGYQISQ   PIVGEG + +    D  
Sbjct: 86  CIRQAVRTGLAIGAVINRVSKFDRKNYFYADLPQGYQISQLYHPIVGEGSLLI----DVD 141

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G+ R  E+GIERIH+EQDAGK +HDQ+   S +DLNR+G+ALMEIV+KPD+RS  EA A+
Sbjct: 142 GEER--EIGIERIHVEQDAGKLMHDQHPDKSYVDLNRAGIALMEIVSKPDIRSPAEAGAY 199

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYE 253
           + KLR+ILRY+G+CDGNMEEGSMRADVNVSV + GE +GTRCE+KNVNS+RF+  AIEYE
Sbjct: 200 IRKLRAILRYVGSCDGNMEEGSMRADVNVSVRKAGEPFGTRCEIKNVNSVRFVQAAIEYE 259

Query: 254 ARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRA 313
           ARRQI ++EDGG I QETRLFD  K ETRSLR+KEDA DYRYF +PDLLPLE+ E FI  
Sbjct: 260 ARRQIEVIEDGGEIIQETRLFDHDKGETRSLRSKEDAHDYRYFPDPDLLPLELPESFIDE 319

Query: 314 IKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA---VNRDKKI---VAN 367
            ++ +PELPD KR+R+I +  ++ Y ASV+ +D   A +FE +       D KI    AN
Sbjct: 320 CRESLPELPDTKRQRYITQLNLTPYTASVITADHETAAWFEAMLEYFKAPDAKIATAAAN 379

Query: 368 WVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKE 427
           W+ +DL G L + G+ I D+P+SP Q  EL+ L+ DGT+SG +AK +F I+ E G  P  
Sbjct: 380 WLTSDLFGALKKLGRDITDSPVSPKQGAELVGLVADGTLSGSLAKQVFEIMLESGQDPAV 439

Query: 428 IVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPS 486
           IVEE GL+Q +D  AIE+V+++++  N + V +  + K  L  +FVGQ M+  GGKANP+
Sbjct: 440 IVEERGLKQTSDTGAIEEVINKILADNQDKVEQYRSGKDKLFGFFVGQTMRAMGGKANPA 499

Query: 487 IVQKMLKEKL 496
           +V ++LK+ L
Sbjct: 500 VVNEILKKLL 509


>gi|332186740|ref|ZP_08388482.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Sphingomonas sp. S17]
 gi|332013073|gb|EGI55136.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Sphingomonas sp. S17]
          Length = 493

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 279/499 (55%), Positives = 358/499 (71%), Gaps = 20/499 (4%)

Query: 11  SESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPIL 70
           SE    G +G+WEVVIG+EVHAQ++  +KLFSGA+  FGAEPNTQVS  DAAMPGMLP+ 
Sbjct: 2   SEYRIQGASGEWEVVIGLEVHAQVTSNAKLFSGAATAFGAEPNTQVSLVDAAMPGMLPVP 61

Query: 71  NGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-- 128
           N  C++QAV TG+ ++A INK+S F RKNYFY DLPQGYQISQ   P+VGEG + +S+  
Sbjct: 62  NMECIRQAVRTGMAIDAQINKWSRFDRKNYFYADLPQGYQISQLYHPLVGEGAIEISLDE 121

Query: 129 ----GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDM 184
               GP KS       +G+ERIH+EQDAGK +HDQ+   S +DLNRSGVALMEIV++PDM
Sbjct: 122 KNPDGPTKS-------IGVERIHVEQDAGKLMHDQHPTRSYVDLNRSGVALMEIVSRPDM 174

Query: 185 RSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIR 244
           RS  EA A+L KLR+ILRY+G+CDGNMEEGSMRADVNVSV + G+ +GTR E KNVNS+R
Sbjct: 175 RSPAEAGAYLRKLRAILRYVGSCDGNMEEGSMRADVNVSVRKVGDEFGTRTETKNVNSVR 234

Query: 245 FLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPL 304
           F+  AIEYEA+RQ+A+LEDGG I QETRLF+     TRS+R+KEDA DYRYF +PDLLPL
Sbjct: 235 FVMAAIEYEAKRQVAVLEDGGKIVQETRLFNVESGTTRSMRSKEDAHDYRYFPDPDLLPL 294

Query: 305 EIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-----AVN 359
           E+ + F+   +  +PELPDAKR R+    G++ Y+A VL ++   A +F+ L       +
Sbjct: 295 ELTDAFVEECRASLPELPDAKRRRYEA-LGLTAYNAGVLTAEVETARWFDALLEALEGTS 353

Query: 360 RDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW 419
                 ANWV  +L G LNR GK I ++P+SP Q  EL+ L+ DGT+SG ++K +F I+ 
Sbjct: 354 AKPAQAANWVAAELFGALNRLGKDITESPVSPAQAAELLALVADGTLSGSLSKQVFEIML 413

Query: 420 EKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKN 478
           E G  P +IVEE GL+Q +D  AIE V+ EV+  NPN + +  A K  L  +FVGQ MK 
Sbjct: 414 ETGDGPSKIVEERGLKQTSDTGAIEAVIAEVLEKNPNQLGQYRAGKEALFGFFVGQTMKA 473

Query: 479 TGGKANPSIVQKMLKEKLG 497
            GGKANP++V  +LK+ L 
Sbjct: 474 MGGKANPAVVNDLLKKALA 492


>gi|260752740|ref|YP_003225633.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
 gi|109892078|sp|Q5NPF4|GATB_ZYMMO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|258552103|gb|ACV75049.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 490

 Score =  569 bits (1466), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 279/490 (56%), Positives = 361/490 (73%), Gaps = 13/490 (2%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           +  G TG WE+V+G+EVHAQ+   SKLFSGA+  FGAEPN+QVS  DAAMPGMLP++N  
Sbjct: 5   ILEGATGSWEIVVGLEVHAQVISKSKLFSGAATAFGAEPNSQVSLIDAAMPGMLPVVNRE 64

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           C++QAV TGL + A IN+ S F RKNYFY DLPQGYQISQ   PIVGEG + +    D  
Sbjct: 65  CIRQAVRTGLAIGAVINRVSKFDRKNYFYADLPQGYQISQLYHPIVGEGSLLI----DVD 120

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
           G+ R  E+GIERIH+EQDAGK +HDQ+   S +DLNR+G+ALMEIV+KPD+RS  EA A+
Sbjct: 121 GEER--EIGIERIHVEQDAGKLMHDQHPDKSYVDLNRAGIALMEIVSKPDIRSPAEAGAY 178

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYE 253
           + KLR+ILRY+G+CDGNMEEGSMRADVNVSV + GE +GTRCE+KNVNS+RF+  AIEYE
Sbjct: 179 IRKLRAILRYVGSCDGNMEEGSMRADVNVSVRKAGEPFGTRCEIKNVNSVRFVQAAIEYE 238

Query: 254 ARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRA 313
           ARRQI ++EDGG I QETRLFD  K ETRSLR+KEDA DYRYF +PDLLPLE+ E FI  
Sbjct: 239 ARRQIEVIEDGGEIIQETRLFDHDKGETRSLRSKEDAHDYRYFPDPDLLPLELPESFIDE 298

Query: 314 IKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA---VNRDKKI---VAN 367
            ++ +PELPD KR+R+I +  ++ Y ASV+ +D   A +FE +       D KI    AN
Sbjct: 299 CRESLPELPDTKRQRYITQLNLTPYTASVITADHETAAWFEAMLEYFKAPDAKIATAAAN 358

Query: 368 WVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKE 427
           W+ +DL G L + G+ I D+P+SP Q  EL+ L+ DGT+SG +AK +F I+ E G  P  
Sbjct: 359 WLTSDLFGALKKLGRDITDSPVSPKQGAELVGLVADGTLSGSLAKQVFEIMLESGQDPAV 418

Query: 428 IVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPS 486
           IVEE GL+Q +D  AIE+V+++++  N + V +  + K  L  +FVGQ M+  GGKANP+
Sbjct: 419 IVEERGLKQTSDTGAIEEVINKILADNQDKVEQYRSGKDKLFGFFVGQTMRAMGGKANPA 478

Query: 487 IVQKMLKEKL 496
           +V ++LK+ L
Sbjct: 479 VVNEILKKLL 488


>gi|103486332|ref|YP_615893.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sphingopyxis
           alaskensis RB2256]
 gi|98976409|gb|ABF52560.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Sphingopyxis alaskensis RB2256]
          Length = 491

 Score =  568 bits (1464), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 277/489 (56%), Positives = 358/489 (73%), Gaps = 4/489 (0%)

Query: 11  SESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPIL 70
           S+    G TG+WEVVIG+EVHAQ++  +KLFSGA+  FGAEPNTQVS  DAAMPGMLP+ 
Sbjct: 5   SDYRVQGETGEWEVVIGLEVHAQITTNAKLFSGAATAFGAEPNTQVSLVDAAMPGMLPVP 64

Query: 71  NGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP 130
           N  C++QAV TG+ + A IN++S F RKNYFY DLPQGYQISQ   P+VGEG ++++   
Sbjct: 65  NRECIRQAVRTGMAIEAQINRWSRFDRKNYFYADLPQGYQISQLYHPLVGEGSLTIA-AD 123

Query: 131 DKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEA 190
           +K+G      +GIERIH+EQDAGK +HDQ+  +S +DLNRSGVALMEIV+KPDMRS  EA
Sbjct: 124 EKAGIPADKVIGIERIHVEQDAGKLMHDQHPTMSYVDLNRSGVALMEIVSKPDMRSPAEA 183

Query: 191 KAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAI 250
            A++ KLRSILRY+G+CDGNMEEGSMRADVNVSV RPGEA+GTR E KNVNS+RF+   I
Sbjct: 184 GAYVRKLRSILRYVGSCDGNMEEGSMRADVNVSVRRPGEAFGTRTETKNVNSVRFVMAVI 243

Query: 251 EYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDF 310
           E EA+RQ+A++E GG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPLE+D+ F
Sbjct: 244 EGEAKRQVALIESGGEVVQETRLYDPDRGETRSMRSKEDAHDYRYFPDPDLLPLELDDAF 303

Query: 311 IRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKI-VANWV 369
           +   +  +PELPDAKR R++   GIS Y+A VL ++   A +F+ L     K +  ANWV
Sbjct: 304 LEECRASLPELPDAKRARYLAA-GISAYNADVLTAEVEAARWFDALLEAGAKPVAAANWV 362

Query: 370 INDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIV 429
            ++L G LNR G+ I D+P+SP Q  EL+ L+ DGTISG IAK +F  + E G     IV
Sbjct: 363 TSELFGALNRLGRDISDSPVSPAQAAELLGLVADGTISGTIAKQVFEKMLESGDGAAAIV 422

Query: 430 EELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIV 488
           +  GL+Q +D  AIE  + +V+ +N + V +    K  L  +FVGQ MK   GKANP +V
Sbjct: 423 DREGLKQTSDTGAIEAEIAKVLAANADKVEQYKGGKEALFGFFVGQTMKAMQGKANPQVV 482

Query: 489 QKMLKEKLG 497
            ++LK+ LG
Sbjct: 483 NELLKKALG 491


>gi|330814157|ref|YP_004358396.1| aspartyl-tRNA(Asn) amidotransferase subunit B / Glutamyl-tRNA(Gln)
           amidotransferase subunit B [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487252|gb|AEA81657.1| aspartyl-tRNA(Asn) amidotransferase subunit B / Glutamyl-tRNA(Gln)
           amidotransferase subunit B [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 487

 Score =  568 bits (1463), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 275/482 (57%), Positives = 361/482 (74%), Gaps = 8/482 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WEVVIG+EVHAQ++  +KLFS +S  FG+ PN+QVSF DAAMPGMLP++N  CV+
Sbjct: 11  GKTGKWEVVIGLEVHAQITSNAKLFSSSSTKFGSNPNSQVSFVDAAMPGMLPVINKYCVE 70

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TGLGL A IN +S F RKNYFY DLPQGYQISQ   PIVGEG++ + +       +
Sbjct: 71  QAVKTGLGLKATINNFSKFDRKNYFYADLPQGYQISQFKFPIVGEGEIVLDM------PY 124

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            T   GIER+HLEQDAGKSIHDQ  + S +DLNRSG+ALMEIV KPD+RS  E   ++ K
Sbjct: 125 GTKIAGIERLHLEQDAGKSIHDQDPSSSFVDLNRSGIALMEIVGKPDLRSPDEVAQYVKK 184

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEAR 255
           LRSI+RYL TCDGNM+EGS+RADVNVSV + G +  GTRCE+KNVNSI+F+  AIEYEA+
Sbjct: 185 LRSIMRYLNTCDGNMDEGSLRADVNVSVRKVGSSDLGTRCEIKNVNSIKFMQQAIEYEAK 244

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI I+E+GG I Q+TRLFD  K ETRS+R+KEDA DYRYF +PDLLPL +++ F+  IK
Sbjct: 245 RQIEIIEEGGTINQQTRLFDTKKIETRSMRSKEDAHDYRYFPDPDLLPLVLEQSFVDKIK 304

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLG 375
             +PELPD K+ R + +F +S YDAS++VSD+ I+ Y+E++A + D K+ ANW+I +L G
Sbjct: 305 NSLPELPDEKKIRLMNDFDLSSYDASIVVSDQDISQYYEEVAKDSDYKLAANWMIVELFG 364

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
           VLN+ GK I+D+P+S   L +LI+LI D TISGKIAK +F  + +    P++IV E G+R
Sbjct: 365 VLNKEGKEIKDSPVSAKNLSKLINLIKDNTISGKIAKTVFEEMVKNNEDPEKIVNEKGMR 424

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q +D   ++K++D ++ +N + V +  A K  L  +FVG+ MKNT GK NP ++  +LKE
Sbjct: 425 QQSDPEELKKIIDTILKNNQDKVEQYKAGKDKLFGFFVGEAMKNTQGKGNPKLINDILKE 484

Query: 495 KL 496
           +L
Sbjct: 485 QL 486


>gi|262277136|ref|ZP_06054929.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [alpha proteobacterium HIMB114]
 gi|262224239|gb|EEY74698.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [alpha proteobacterium HIMB114]
          Length = 488

 Score =  566 bits (1460), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 272/482 (56%), Positives = 361/482 (74%), Gaps = 8/482 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G  G++EVVIG+EVHAQ+   +KLFS ++  FG+EPN+QVS  DAAMPGMLP++N  CV+
Sbjct: 12  GEKGEYEVVIGLEVHAQVLSDAKLFSSSATKFGSEPNSQVSLVDAAMPGMLPVINKFCVE 71

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TGLGLNA IN +S F RKNYFY DLPQGYQISQ   PIVGEGKV + +       +
Sbjct: 72  QAVKTGLGLNAKINTFSKFDRKNYFYADLPQGYQISQFKHPIVGEGKVILDM------PY 125

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            T EVGIER+HLEQDAGKSIHDQ    S +DLNRSG+ALMEIV+KPD+RS  E   ++ K
Sbjct: 126 GTKEVGIERLHLEQDAGKSIHDQDPKNSFVDLNRSGIALMEIVSKPDLRSPGEVGEYIKK 185

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           LRSI+RYL TCDGNME+GS+RADVNVSV + G + +GTRCE+KNVNSI+F+  AI+YEAR
Sbjct: 186 LRSIMRYLNTCDGNMEQGSLRADVNVSVRKKGSKEFGTRCEIKNVNSIKFMQQAIDYEAR 245

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++E+G  + QETRLFD  K ETRS+R+KEDA DYRYF +PDLLPL +++ +I  +K
Sbjct: 246 RQIELIEEGNEVDQETRLFDTKKQETRSMRSKEDAHDYRYFPDPDLLPLRLEDSYIEDLK 305

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLG 375
           K +PELPD K++R I EF +S Y+ASV++SD++++ Y+E++A N D K+ + W++ +L  
Sbjct: 306 KGLPELPDHKKQRLISEFKLSNYEASVIISDQAVSTYYEEVAKNSDYKLASTWLMGELFA 365

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            LN+ GK I ++P+S   L ++I+LI DGTISGKIAK +F  + +    P +IVE+ GL+
Sbjct: 366 TLNKEGKDITESPVSAVNLAKMINLIKDGTISGKIAKTVFEEMIKNDVDPSKIVEDKGLK 425

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q +D   IE +VD+V+ +N + V +  + K  L  +FVGQVMK   GK NP ++  +LK 
Sbjct: 426 QTSDPKEIENIVDKVLETNQDKVEQYKSGKDKLFGFFVGQVMKEMKGKGNPQMINDILKN 485

Query: 495 KL 496
           KL
Sbjct: 486 KL 487


>gi|330994860|ref|ZP_08318782.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Gluconacetobacter sp. SXCC-1]
 gi|329758121|gb|EGG74643.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Gluconacetobacter sp. SXCC-1]
          Length = 467

 Score =  564 bits (1453), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 278/472 (58%), Positives = 351/472 (74%), Gaps = 6/472 (1%)

Query: 26  IGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGL 85
           +G+EVHAQ+   SKLFSGAS ++G EPNT VS  DA  PGMLP+LN  CV QA+ TGLGL
Sbjct: 1   MGLEVHAQVISHSKLFSGASASYGGEPNTHVSLVDAGFPGMLPVLNQECVAQAIRTGLGL 60

Query: 86  NAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIER 145
            A IN  S F RKNYFY DLP GYQISQ   PIVGEG V + +     G  R I  GI R
Sbjct: 61  RARINLESRFDRKNYFYADLPTGYQISQFTHPIVGEGTVEIELA---DGTVRHI--GITR 115

Query: 146 IHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLG 205
           +H+EQDAGKS+HDQ  A S IDLNR+GVALMEIV++PD+RS  EA A+L KLR ILRYLG
Sbjct: 116 LHMEQDAGKSMHDQDPARSFIDLNRAGVALMEIVSEPDIRSPEEAGAYLRKLRQILRYLG 175

Query: 206 TCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGG 265
           TCDGNMEEGSMRADVNVSV + GE + TRCE+KNVNSIR++  AIE EA RQI + E+GG
Sbjct: 176 TCDGNMEEGSMRADVNVSVRKAGEPFRTRCEIKNVNSIRYVMHAIEVEATRQIEVWEEGG 235

Query: 266 HIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAK 325
            + QETRLFDP++NETRSLR+KEDA DYRYF +PDLLPL +++ ++  +++ +PELPD K
Sbjct: 236 EVDQETRLFDPARNETRSLRSKEDAHDYRYFPDPDLLPLVVEQAWVDELERGLPELPDDK 295

Query: 326 RERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIE 385
           R+RF+ ++GI  YDASVLV++++IADY+E++A  RD ++ ANWV  DL G LNR+G++I 
Sbjct: 296 RDRFVRQYGIPRYDASVLVAEQAIADYYEEVAKGRDARLAANWVTGDLFGALNRTGRTIT 355

Query: 386 DTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEK 445
           D+PIS   LG ++DL+ D TI+GKIAK++F  + E G +   IVE  GL+QVTD  AI+ 
Sbjct: 356 DSPISAQALGGMLDLVSDKTINGKIAKEVFEDMLETGDSAAAIVERKGLKQVTDTGAIDA 415

Query: 446 VVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
            V +V+  N + V      K  L  +FVGQVMK   GKANP++V + LK+ L
Sbjct: 416 AVADVLARNADKVEEYRGGKDRLFGFFVGQVMKAMAGKANPAMVNEALKKVL 467


>gi|157964218|ref|YP_001499042.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           massiliae MTU5]
 gi|157843994|gb|ABV84495.1| Glutamyl-tRNA amidotransferase subunit B [Rickettsia massiliae
           MTU5]
          Length = 495

 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 274/481 (56%), Positives = 353/481 (73%), Gaps = 6/481 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WE VIG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  CV 
Sbjct: 7   GNTGKWEYVIGLEIHAQISSKSKLFSGSSTIFAASPNSQVSYIDAAMPGMLPVLNKHCVH 66

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QA+ TGLGL A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +   P  +G  
Sbjct: 67  QAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEI---PTSTGNL 123

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           +TI   I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+ K
Sbjct: 124 KTIR--INRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPAEAAEFVKK 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR++LRY+G+CDG+ME+GSMR D N+SV R GE  GTRCE+KN+NSIR +  AIE+EA+R
Sbjct: 182 LRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIIKAIEFEAKR 241

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE G  I QETRLF+    ETR++R KE+ALDYRYF +PDLLPL I ++ I  +K 
Sbjct: 242 QVDLLESGEEIIQETRLFNADSGETRTMRLKEEALDYRYFPDPDLLPLVISDELINELKA 301

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPD K E++  EF +S YDA V+V+D+S+A+YFEK A   + K++ANW+ ++L G 
Sbjct: 302 NLPELPDQKIEKYTKEFSLSQYDAEVIVADESVAEYFEKAANECNPKMLANWLTSELFGQ 361

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++   I +  I+P+   +L+ LI + TISGKIAK +F I++E G  P +IVEE GL Q
Sbjct: 362 LNKTSIGINECKITPSNFAKLVKLIENDTISGKIAKTVFEIMFETGKAPDKIVEEKGLVQ 421

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D + +  V+DEVI  NP +V   +  K  L  +FVGQVMK TGGKANP++V ++LKEK
Sbjct: 422 VSDNNVLNTVIDEVIAENPESVEGYSNGKDKLFGFFVGQVMKKTGGKANPTLVNQLLKEK 481

Query: 496 L 496
           L
Sbjct: 482 L 482


>gi|91205950|ref|YP_538305.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           bellii RML369-C]
 gi|109892060|sp|Q1RHE8|GATB_RICBR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|91069494|gb|ABE05216.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Rickettsia bellii
           RML369-C]
          Length = 483

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 272/480 (56%), Positives = 354/480 (73%), Gaps = 6/480 (1%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           +G WE VIG+E+HAQ+S  SKLFSG+   F A PN+QVS+ DAAMPGMLP+LN  CV QA
Sbjct: 8   SGKWEYVIGLEIHAQISSKSKLFSGSGTTFAASPNSQVSYVDAAMPGMLPVLNEYCVHQA 67

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           + TGLGL A +NKYSVF RKNYFY DLPQGYQISQ   PIV +G + +   P  +G+ +T
Sbjct: 68  IKTGLGLKAKVNKYSVFDRKNYFYADLPQGYQISQFYYPIVQDGTMEI---PTSTGELKT 124

Query: 139 IEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
           I   I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+ KLR
Sbjct: 125 IR--INRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPDEAAEFVKKLR 182

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           S+LRY+G+CDG+ME+GSMR D NVSV R GE  GTRCE+KN+NSIR +  AIE+EA+RQ+
Sbjct: 183 SLLRYVGSCDGDMEKGSMRCDANVSVRRKGEPLGTRCEIKNINSIRNIVRAIEFEAKRQV 242

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++E+G  + QETRLF+    ETR++R+KE+A DYRYF +PDLLP+ + ++ I  +K  +
Sbjct: 243 DLIENGESVIQETRLFNADSGETRTMRSKEEAADYRYFPDPDLLPVILSDELINELKASL 302

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLN 378
           PELPD K +++I +FG+S YDA V+V+D+S A YFE+ A   D K++ANW+IN+L G LN
Sbjct: 303 PELPDQKIDKYITKFGLSKYDAEVIVADESAAKYFEEAANECDPKLLANWLINELFGQLN 362

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++   I +  I+PN   +LI LI D TISGKIAK +F I++E G    +IVEE GL QV+
Sbjct: 363 KASAEISECKITPNDFAKLIKLIEDNTISGKIAKTVFEIMFETGKAADKIVEEQGLVQVS 422

Query: 439 DLSAIEKVVDEVINSNPNNV-ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D + +  V+DEVI  NP++V      K  L  +FVGQVMK TGGKANP +V ++LKEKLG
Sbjct: 423 DSNVLNTVIDEVIRENPDSVEGYKGGKDKLFGFFVGQVMKKTGGKANPGLVNQLLKEKLG 482


>gi|58040805|ref|YP_192769.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Gluconobacter
           oxydans 621H]
 gi|81556902|sp|Q5FND4|GATB_GLUOX RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|58003219|gb|AAW62113.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Gluconobacter
           oxydans 621H]
          Length = 485

 Score =  561 bits (1446), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 278/483 (57%), Positives = 353/483 (73%), Gaps = 7/483 (1%)

Query: 16  SGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCV 75
           +G+TG+WE+V+G+EVHAQ+   +KLFSGAS  +G EPNT VS  DA  PGMLP+LN  CV
Sbjct: 6   TGSTGEWEIVVGLEVHAQVVSEAKLFSGASAEYGGEPNTHVSLVDAGFPGMLPVLNRECV 65

Query: 76  QQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQ 135
            QAV TGLGL A IN +S F RKNYFY DLP GYQISQ   PI+G+GKV V +  D S  
Sbjct: 66  AQAVRTGLGLEAEINLFSRFDRKNYFYADLPTGYQISQFAHPIIGKGKVLVDLA-DGS-- 122

Query: 136 FRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
             T E+G+ R+HLEQDAGKSIHDQ    S IDLNR+GVALMEIV++PD+RS  EA A+L 
Sbjct: 123 --TREIGVTRLHLEQDAGKSIHDQDPTRSFIDLNRAGVALMEIVSEPDIRSPEEAGAYLR 180

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEA 254
           KLR ILRY+GTCDGNMEEGSMRADVNVSV +PGE  + TRCE+KNVNSIRF+ +AIE EA
Sbjct: 181 KLRQILRYIGTCDGNMEEGSMRADVNVSVRKPGETEYRTRCEIKNVNSIRFVMMAIEVEA 240

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           +RQI + E GG + QETRLFD  + ETRSLR+KEDA DYRYF +PDLLPL I++ ++  +
Sbjct: 241 QRQIEVWEAGGTVDQETRLFDHVRGETRSLRSKEDAHDYRYFPDPDLLPLVIEQSWVDEL 300

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLL 374
           K  +PELP+AKR R   E+G+S Y++SVL  +++IAD++E +A   D ++ ANW++ D  
Sbjct: 301 KAALPELPEAKRARLEQEYGVSRYESSVLCVEQAIADFYETVARGADARLAANWMLGDFF 360

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
             LNR+G+SIED+P+S   L EL+ LI D TI+GKIAK++   + E G +   IVE  GL
Sbjct: 361 AALNRTGRSIEDSPVSAEGLRELLGLISDSTINGKIAKEVLEDMVETGDSASAIVERKGL 420

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           RQVTD  AIE  + E++ +N + V      K  L  +FVGQ MK   GK NP++V + LK
Sbjct: 421 RQVTDTGAIESAIREILAANSDKVEEYKGGKDKLFGFFVGQTMKAMKGKGNPALVNETLK 480

Query: 494 EKL 496
           + L
Sbjct: 481 KLL 483


>gi|34580853|ref|ZP_00142333.1| glutamyl-tRNA amidotransferase subunit B [Rickettsia sibirica 246]
 gi|28262238|gb|EAA25742.1| glutamyl-tRNA amidotransferase subunit B [Rickettsia sibirica 246]
          Length = 483

 Score =  560 bits (1443), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 274/481 (56%), Positives = 352/481 (73%), Gaps = 6/481 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WE VIG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  CV 
Sbjct: 6   GNTGKWEYVIGLEIHAQISSKSKLFSGSSTIFAANPNSQVSYVDAAMPGMLPVLNKHCVH 65

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QA+ TGLGL A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +   P  +G  
Sbjct: 66  QAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEI---PTSTGDL 122

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           +TI   I R+HLEQDAGKSIHDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+ K
Sbjct: 123 KTIR--INRLHLEQDAGKSIHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPEEAAEFVKK 180

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR++LRY+G+CDG+ME+GSMR D N+SV R GE  GTRCE+KN+NSIR +  AIE+EA+R
Sbjct: 181 LRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIIKAIEFEAKR 240

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE G  I QETRLF+    ETR++R KE+ALDYRYF +PDLLPL I ++ I  +K 
Sbjct: 241 QVDLLESGEEIIQETRLFNADSGETRTMRLKEEALDYRYFPDPDLLPLVISDELINELKA 300

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPD K E++  EF +S YDA V+V+D+S+A+YFEK A   + K++ NW+ ++L G 
Sbjct: 301 NLPELPDQKIEKYTKEFSLSKYDAEVIVADESVAEYFEKAANECNPKMLTNWLTSELFGQ 360

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++   I +  I+P+   +L+ LI + TISGKIAK +F I++E G  P +IVEE GL Q
Sbjct: 361 LNKASIGINECKITPSNFAKLVKLIENDTISGKIAKTVFEIMFETGKAPDKIVEEKGLVQ 420

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D + +  V+DEVI  NP +V    + K  L  +FVGQVMK TGGKANP++V ++LKEK
Sbjct: 421 VSDNNVLNTVIDEVIAENPESVEGYRSGKDKLFGFFVGQVMKKTGGKANPTLVNQLLKEK 480

Query: 496 L 496
           L
Sbjct: 481 L 481


>gi|15892116|ref|NP_359830.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           conorii str. Malish 7]
 gi|20454921|sp|Q92J76|GATB_RICCN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|15619243|gb|AAL02731.1| glutamyl-tRNA amidotransferase subunit B [Rickettsia conorii str.
           Malish 7]
          Length = 483

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 273/481 (56%), Positives = 352/481 (73%), Gaps = 6/481 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WE VIG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  CV 
Sbjct: 6   GNTGKWEYVIGLEIHAQISSKSKLFSGSSTIFAANPNSQVSYVDAAMPGMLPVLNKHCVH 65

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QA+ TGLGL A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +   P  +G  
Sbjct: 66  QAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEI---PTSTGDL 122

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           +TI   I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+ K
Sbjct: 123 KTIR--INRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPEEAAEFVKK 180

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR++LRY+G+CDG+ME+GSMR D N+SV R GE  GTRCE+KN+NSIR +  AIE+EA+R
Sbjct: 181 LRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIIKAIEFEAKR 240

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE G  I QETRLF+    ETR++R KE+ALDYRYF +PDLLPL I ++ I  +K 
Sbjct: 241 QVDLLESGEKIIQETRLFNADSGETRTMRLKEEALDYRYFPDPDLLPLVISDELINELKA 300

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPD K E++  EF +S YDA V+V+D+S+A+YFEK A   + K++ NW+ ++L G 
Sbjct: 301 NLPELPDQKIEKYTKEFSLSKYDAEVIVADESVAEYFEKAANECNPKMLTNWLTSELFGQ 360

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++   I +  I+P+   +L+ LI + TISGKIAK +F I++E G  P +IVEE GL Q
Sbjct: 361 LNKASIGINECKITPSNFAKLVKLIENDTISGKIAKTVFEIMFETGKAPDKIVEEKGLVQ 420

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D + +  V+DEVI  NP +V    + K  L  +FVGQVMK TGGKANP++V ++LKEK
Sbjct: 421 VSDNNVLNTVIDEVIAENPESVEGYRSGKDKLFGFFVGQVMKKTGGKANPTLVNQLLKEK 480

Query: 496 L 496
           L
Sbjct: 481 L 481


>gi|229586391|ref|YP_002844892.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           africae ESF-5]
 gi|259647238|sp|C3PMI9|GATB_RICAE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|228021441|gb|ACP53149.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Rickettsia africae
           ESF-5]
          Length = 483

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 273/481 (56%), Positives = 352/481 (73%), Gaps = 6/481 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WE VIG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  CV 
Sbjct: 6   GNTGKWEYVIGLEIHAQISSKSKLFSGSSTIFAANPNSQVSYVDAAMPGMLPVLNKHCVH 65

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QA+ TGLGL A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +   P  +G  
Sbjct: 66  QAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEI---PTSTGDL 122

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           +TI   I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+ K
Sbjct: 123 KTIR--INRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPEEAAEFVKK 180

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR++LRY+G+CDG+ME+GSMR D N+SV R GE  GTRCE+KN+NSIR +  AIE+EA+R
Sbjct: 181 LRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIIKAIEFEAKR 240

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE G  I QETRLF+    ETR++R KE+ALDYRYF +PDLLPL I ++ I  +K 
Sbjct: 241 QVDLLESGEEIIQETRLFNADSGETRTMRLKEEALDYRYFPDPDLLPLVISDELINELKA 300

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPD K E++  EF +S YDA V+V+D+S+A+YFEK A   + K++ NW+ ++L G 
Sbjct: 301 NLPELPDQKIEKYTKEFSLSKYDAEVIVADESVAEYFEKAANECNPKMLTNWLTSELFGQ 360

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++   I +  I+P+   +L+ LI + TISGKIAK +F I++E G  P +IVEE GL Q
Sbjct: 361 LNKASIGINECKITPSNFAKLVKLIENDTISGKIAKTVFEIMFETGKAPDKIVEEKGLVQ 420

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D + +  V+DEVI  NP +V    + K  L  +FVGQVMK TGGKANP++V ++LKEK
Sbjct: 421 VSDNNVLNTVIDEVIAENPESVEGYRSGKDKLFGFFVGQVMKKTGGKANPTLVNQLLKEK 480

Query: 496 L 496
           L
Sbjct: 481 L 481


>gi|157803339|ref|YP_001491888.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           canadensis str. McKiel]
 gi|166198815|sp|A8EXM0|GATB_RICCK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|157784602|gb|ABV73103.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           canadensis str. McKiel]
          Length = 483

 Score =  558 bits (1438), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 272/482 (56%), Positives = 352/482 (73%), Gaps = 6/482 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WE VIG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  CV 
Sbjct: 6   GNTGKWEYVIGLEIHAQISSKSKLFSGSSTTFAAMPNSQVSYVDAAMPGMLPVLNKHCVH 65

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QA+ TGL L A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +      +G  
Sbjct: 66  QAIKTGLALKAQINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMKILTS---TGDL 122

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           +TI   I R+HLEQDAGKSIHDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+ K
Sbjct: 123 KTIR--INRLHLEQDAGKSIHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPEEAAEFVKK 180

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LRS+LRY+G+CDG+ME+GSMR D N+SV R GE  G RCE+KN+NSIR +  AIE+EA+R
Sbjct: 181 LRSLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGIRCEIKNINSIRNIIKAIEFEAKR 240

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ ++E GG + QETRLF+    ETR++R KE+A+DYRYF +PDLLPL I ++ I  +K 
Sbjct: 241 QVDLIESGGIVIQETRLFNADSGETRTIRLKEEAIDYRYFPDPDLLPLIISDELINKLKA 300

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPD K E+++ EFG+S YDA V+V+D+S+A+YFE+ A   + K++ NW+ ++L G 
Sbjct: 301 NLPELPDQKIEKYMKEFGLSKYDAEVIVADESVAEYFEQAANECNPKMLTNWLTSELFGQ 360

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++   I    I+P+   +LI LI + TISGKIAK +F I++E G  P +IVEE GL Q
Sbjct: 361 LNKASIGISKCKITPSNFAKLIKLIENDTISGKIAKTVFEIMFETGKAPDKIVEEKGLVQ 420

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D + +  V+DEVI  NP +V    + K  L S+FVGQ+MK TGGKANP +V ++LKEK
Sbjct: 421 VSDNNVLNTVIDEVITENPKSVEDYRSGKEKLFSFFVGQIMKKTGGKANPILVNQLLKEK 480

Query: 496 LG 497
           LG
Sbjct: 481 LG 482


>gi|157826689|ref|YP_001495753.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           bellii OSU 85-389]
 gi|166198814|sp|A8GV45|GATB_RICB8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|157801993|gb|ABV78716.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           bellii OSU 85-389]
          Length = 483

 Score =  558 bits (1437), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 271/480 (56%), Positives = 353/480 (73%), Gaps = 6/480 (1%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           +G WE VIG+E+HAQ+S  SKLFSG+   F A PN+QVS+ DAAMPGMLP+LN  CV QA
Sbjct: 8   SGKWEYVIGLEIHAQISSKSKLFSGSGTTFAASPNSQVSYVDAAMPGMLPVLNEYCVHQA 67

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           + TGLGL A +NKYSVF RKNYFY DLPQGYQISQ   PIV +G + +   P  +G+ +T
Sbjct: 68  IKTGLGLKAKVNKYSVFDRKNYFYADLPQGYQISQFYYPIVQDGTMEI---PTSTGELKT 124

Query: 139 IEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
           I   I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+ KLR
Sbjct: 125 IR--INRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPDEAAEFVKKLR 182

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           S+LRY+G+CDG+ME+GSMR D NVSV R GE  GTRCE+KN+NSIR +  AIE+EA+RQ+
Sbjct: 183 SLLRYVGSCDGDMEKGSMRCDANVSVRRKGEPLGTRCEIKNINSIRNIVRAIEFEAKRQV 242

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++E+G  + QET LF+    ETR++R+KE+A DYRYF +PDLLP+ + ++ I  +K  +
Sbjct: 243 DLIENGESVIQETCLFNADSGETRTMRSKEEAADYRYFPDPDLLPVILSDELINELKASL 302

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLN 378
           PELPD K +++I +FG+S YDA V+V+D+S A YFE+ A   D K++ANW+IN+L G LN
Sbjct: 303 PELPDQKIDKYITKFGLSKYDAEVIVADESAAKYFEEAANECDPKLLANWLINELFGQLN 362

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++   I +  I+PN   +LI LI D TISGKIAK +F I++E G    +IVEE GL QV+
Sbjct: 363 KASAEISECKITPNDFAKLIKLIEDNTISGKIAKTVFEIMFETGKAADKIVEEQGLVQVS 422

Query: 439 DLSAIEKVVDEVINSNPNNV-ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D + +  V+DEVI  NP++V      K  L  +FVGQVMK TGGKANP +V ++LKEKLG
Sbjct: 423 DSNVLNTVIDEVIRENPDSVEGYKGGKDKLFGFFVGQVMKKTGGKANPGLVNQLLKEKLG 482


>gi|238650362|ref|YP_002916214.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           peacockii str. Rustic]
 gi|259647239|sp|C4K0R5|GATB_RICPU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|238624460|gb|ACR47166.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           peacockii str. Rustic]
          Length = 483

 Score =  557 bits (1436), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 272/481 (56%), Positives = 352/481 (73%), Gaps = 6/481 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WE VIG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  CV 
Sbjct: 6   GDTGKWEYVIGLEIHAQISSKSKLFSGSSTIFAANPNSQVSYVDAAMPGMLPVLNKHCVH 65

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QA+ TGLGL A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +   P  +G  
Sbjct: 66  QAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEI---PTSTGDL 122

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           +TI   I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+ K
Sbjct: 123 KTIR--INRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPEEAAEFVKK 180

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR++LRY+G+CDG+ME+GSMR D N+SV R GE  GTRCE+KN+NSIR +  AIE+EA+R
Sbjct: 181 LRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIIKAIEFEAKR 240

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE G  I QETRLF+    ETR++R KE+ALDYRYF +PDLLPL I ++ I  +K 
Sbjct: 241 QVDLLESGEEIIQETRLFNADSGETRTMRLKEEALDYRYFPDPDLLPLVISDELINELKA 300

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPD K E++  EF +S YDA V+V+D+S+A+YFE+ A   + K++ NW+ ++L G 
Sbjct: 301 NLPELPDQKIEKYTKEFSLSKYDAEVIVADESVAEYFEQAANECNPKMLTNWLTSELFGQ 360

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++   I +  I+P+   +L+ LI + TISGKIAK +F I++E G  P +IVEE GL Q
Sbjct: 361 LNKASIGINECKITPSNFAKLVKLIENDTISGKIAKTVFEIMFETGKAPDKIVEEKGLVQ 420

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D + +  V+DEVI  NP +V    + K  L  +FVGQVMK TGGKANP++V ++LKEK
Sbjct: 421 VSDNNVLNTVIDEVIAENPESVEGYRSGKDKLFGFFVGQVMKKTGGKANPTLVNQLLKEK 480

Query: 496 L 496
           L
Sbjct: 481 L 481


>gi|157828067|ref|YP_001494309.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|166198816|sp|A8GQX6|GATB_RICRS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|157800548|gb|ABV75801.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           rickettsii str. 'Sheila Smith']
          Length = 483

 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/481 (56%), Positives = 351/481 (72%), Gaps = 6/481 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WE VIG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  CV 
Sbjct: 6   GNTGKWEYVIGLEIHAQISSKSKLFSGSSTIFAANPNSQVSYIDAAMPGMLPVLNKHCVH 65

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QA+ TGLGL A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +   P  +G  
Sbjct: 66  QAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEI---PTSTGDL 122

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           +TI   I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+ K
Sbjct: 123 KTIR--INRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPEEAAEFVKK 180

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR++LRY+G+CDG+ME+GSMR D N+SV R GE  GTRCE+KN+NSIR +  AIE+EA+R
Sbjct: 181 LRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIIKAIEFEAKR 240

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE G  I QETRLF+    ETR++R KE+ALDYRYF +PDLLPL I ++ I  +K 
Sbjct: 241 QVDLLESGEEIIQETRLFNADSGETRTMRLKEEALDYRYFPDPDLLPLVISDELINELKA 300

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPD K E++  EF +S YDA V+V+D+S+A+YFEK A   + K++ NW+ ++L G 
Sbjct: 301 NLPELPDQKIEKYTKEFSLSKYDAEVIVADESVAEYFEKAANECNPKMLTNWLTSELFGQ 360

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++   I +  I+P+   +L+ LI + TISGKIAK +F I++E G  P +I+EE GL Q
Sbjct: 361 LNKASIGINECKITPSNFAKLVKLIENDTISGKIAKTVFEIMFETGKAPDKIIEEKGLVQ 420

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D + +  V+DEVI  NP +V    + K  L  +FVGQVMK T GKANP++V ++LKEK
Sbjct: 421 VSDNNVLNTVIDEVIAENPESVEGYRSGKDKLFGFFVGQVMKKTDGKANPTLVNQLLKEK 480

Query: 496 L 496
           L
Sbjct: 481 L 481


>gi|165932765|ref|YP_001649554.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           rickettsii str. Iowa]
 gi|189045149|sp|B0BWC2|GATB_RICRO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|165907852|gb|ABY72148.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rickettsia rickettsii str. Iowa]
          Length = 483

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/481 (56%), Positives = 351/481 (72%), Gaps = 6/481 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WE VIG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  CV 
Sbjct: 6   GNTGKWEYVIGLEIHAQISSKSKLFSGSSTIFAANPNSQVSYVDAAMPGMLPVLNKHCVH 65

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QA+ TGLGL A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +   P  +G  
Sbjct: 66  QAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEI---PTSTGDL 122

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           +TI   I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+ K
Sbjct: 123 KTIR--INRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPEEAAEFVKK 180

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR++LRY+G+CDG+ME+GSMR D N+SV R GE  GTRCE+KN+NSIR +  AIE+EA+R
Sbjct: 181 LRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIIKAIEFEAKR 240

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE G  I QETRLF+    ETR++R KE+ALDYRYF +PDLLPL I ++ I  +K 
Sbjct: 241 QVDLLESGEEIIQETRLFNADSGETRTMRLKEEALDYRYFPDPDLLPLVISDELINELKA 300

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPD K E++  EF +S YDA V+V+D+S+A+YFEK A   + K++ NW+ ++L G 
Sbjct: 301 NLPELPDQKIEKYTKEFSLSKYDAEVIVADESVAEYFEKAANECNPKMLTNWLTSELFGQ 360

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++   I +  I+P+   +L+ LI + TISGKIAK +F I++E G  P +I+EE GL Q
Sbjct: 361 LNKASIGINECKITPSNFAKLVKLIENDTISGKIAKTVFEIMFETGKAPDKIIEEKGLVQ 420

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D + +  V+DEVI  NP +V    + K  L  +FVGQVMK T GKANP++V ++LKEK
Sbjct: 421 VSDNNVLNTVIDEVIAENPESVEGYRSGKDKLFGFFVGQVMKKTDGKANPTLVNQLLKEK 480

Query: 496 L 496
           L
Sbjct: 481 L 481


>gi|67459522|ref|YP_247146.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia felis
           URRWXCal2]
 gi|75536071|sp|Q4UKF0|GATB_RICFE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|67005055|gb|AAY61981.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Rickettsia felis
           URRWXCal2]
          Length = 483

 Score =  555 bits (1431), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/481 (56%), Positives = 353/481 (73%), Gaps = 6/481 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WE +IG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  CV 
Sbjct: 6   GNTGKWEYIIGLEIHAQISSKSKLFSGSSTIFAANPNSQVSYVDAAMPGMLPVLNKHCVY 65

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QA+ TGLGL A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +   P  +G  
Sbjct: 66  QAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEI---PTSTGDL 122

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           +TI   I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+ K
Sbjct: 123 KTIR--INRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPDEAAEFVKK 180

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR++LRY+G+CDG+ME+GSMR D N+SV R GE  GTRCE+KN+NSIR +  AIE+EA+R
Sbjct: 181 LRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIIKAIEFEAKR 240

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE+G  I QETRLF+    ET+++R KE+ALDYRYF +PDLLPL I ++ I  +K 
Sbjct: 241 QVDLLENGEAIIQETRLFNADSGETKTMRLKEEALDYRYFPDPDLLPLVISDELINELKA 300

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPD K E++  EFG+S YDA V+V+D+S+A+YFEK A   + K++ NW+ ++L G 
Sbjct: 301 NLPELPDQKIEKYTKEFGLSKYDAEVIVADESVAEYFEKAANECNPKMLTNWLTSELFGQ 360

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++   I +  I+P+   +L+ LI + TISGKIAK +F I++E G  P +IVEE GL Q
Sbjct: 361 LNKASIGINECKITPSNFAKLVKLIENDTISGKIAKTVFEIMFETGKAPDKIVEEKGLVQ 420

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D + +  V+DEVI  NP +V      K  L  +FVGQVMK TGGKANP++V ++LK+K
Sbjct: 421 VSDNNVLNTVIDEVIAENPESVEGYKRGKDKLFGFFVGQVMKKTGGKANPTLVNQLLKDK 480

Query: 496 L 496
           L
Sbjct: 481 L 481


>gi|157825332|ref|YP_001493052.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia akari
           str. Hartford]
 gi|157799290|gb|ABV74544.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia akari
           str. Hartford]
          Length = 483

 Score =  553 bits (1424), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 271/481 (56%), Positives = 349/481 (72%), Gaps = 6/481 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WE VIG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  CV 
Sbjct: 6   GNTGKWEYVIGLEIHAQISSKSKLFSGSSTIFAASPNSQVSYVDAAMPGMLPVLNQHCVH 65

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QA+ TGLGL A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +   P  +G  
Sbjct: 66  QAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEI---PTSTGDL 122

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           +TI   I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+ K
Sbjct: 123 KTIR--INRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPYEAAEFVKK 180

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR++LRY+G+CDG+ME+GSMR D N+SV R GE  GTRCE+KN+NSIR +  AIE+EA+R
Sbjct: 181 LRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIVKAIEFEAKR 240

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE G  I QETRLF+    ETR++R KE+ALDYRYF +PDLLPL I +  I  +K 
Sbjct: 241 QVDLLESGEAIIQETRLFNADSGETRTMRFKEEALDYRYFPDPDLLPLVISDKLIDELKA 300

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPD K E++  EFG+S Y+A V+V+D+S+ADYFEK     + K++ NW+ ++L G 
Sbjct: 301 NLPELPDQKIEKYTKEFGLSKYEAEVIVADESVADYFEKAVNECNPKMLTNWLTSELFGQ 360

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++   I +  I+P+   +LI LI +G ISGKIAK +F I++  G  P +IVEE GL Q
Sbjct: 361 LNKASIGINECKITPSDFAKLIKLIENGIISGKIAKTVFEIMFATGKAPDKIVEEQGLVQ 420

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D + ++ V+DEVI  NP  V    + K  L  +FVGQVMK TGGKANP+++ ++L EK
Sbjct: 421 VSDNNVLKTVIDEVIAENPELVEGYRSGKDKLFGFFVGQVMKKTGGKANPTLLNQLLNEK 480

Query: 496 L 496
           L
Sbjct: 481 L 481


>gi|71083764|ref|YP_266484.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|109892045|sp|Q4FLQ8|GATB_PELUB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|71062877|gb|AAZ21880.1| glutamyl-tRNA(gln) amidotransferase chain B [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 492

 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 281/492 (57%), Positives = 358/492 (72%), Gaps = 12/492 (2%)

Query: 11  SESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPIL 70
           SE L       +EVVIG+EVHAQ++  SKLFS +S  FGAEPNTQVS  DAA PGMLP++
Sbjct: 6   SEYLIERRDNVYEVVIGLEVHAQVTSNSKLFSSSSTTFGAEPNTQVSLVDAAFPGMLPVI 65

Query: 71  NGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP 130
           N  CV+QA+ TG+GL A INK SVF RKNYFY DLPQGYQISQ   PIVGEG V + +  
Sbjct: 66  NEYCVKQAIKTGIGLRAQINKRSVFDRKNYFYADLPQGYQISQFKYPIVGEGTVILDMA- 124

Query: 131 DKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEA 190
              GQ    EVGIER+HLEQDAGKSIHD     + +DLNRSGVALMEIV+KPDMR+  E 
Sbjct: 125 --HGQ---KEVGIERLHLEQDAGKSIHDMDPQNTLVDLNRSGVALMEIVSKPDMRTPDEV 179

Query: 191 KAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSV-CRPGEAWGTRCEVKNVNSIRFLGLA 249
            A++ KLRSI+RYLGTCDGNM+EGS+RADVN+SV  +  +  GTRCE+KNVNSI+F+ +A
Sbjct: 180 SAYIKKLRSIMRYLGTCDGNMQEGSLRADVNISVRIKGSDKLGTRCEIKNVNSIKFMQMA 239

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           I+YEA RQ+ ++EDG  I QETRLFD  KNETRS+R+KEDA DYRYF +PDLLPLE+ ++
Sbjct: 240 IDYEANRQVDLIEDGKTIDQETRLFDTKKNETRSMRSKEDAHDYRYFPDPDLLPLEVTDE 299

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKIV 365
           FI  +K  IPELPD K++RFI EF +S Y+A++LVSD   A YFE    K+  N+D K+ 
Sbjct: 300 FIEKLKADIPELPDDKKKRFIDEFKVSAYEATILVSDIETAKYFEEVVAKMGKNKDMKLA 359

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
            NW+  +L  VLN     I ++P+S   L +LI+LI +GTISGKIAK IF ++ +    P
Sbjct: 360 VNWITGELFAVLNNKNLEISESPVSAKNLAKLINLIKNGTISGKIAKTIFELMIDGDIDP 419

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKAN 484
           + IVEE GL+Q +D  A+E ++D++I++N          K  L  +FVGQ MK +GGKAN
Sbjct: 420 QIIVEEKGLKQESDPKALEALIDKIIDTNREKAIEYKNGKEKLFGFFVGQAMKVSGGKAN 479

Query: 485 PSIVQKMLKEKL 496
           P ++ ++LK+KL
Sbjct: 480 PQLINEILKKKL 491


>gi|91763200|ref|ZP_01265164.1| glutamyl-tRNA(Gln) amidotransferase chain B [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|91717613|gb|EAS84264.1| glutamyl-tRNA(Gln) amidotransferase chain B [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 492

 Score =  549 bits (1414), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 280/492 (56%), Positives = 358/492 (72%), Gaps = 12/492 (2%)

Query: 11  SESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPIL 70
           SE L       +EVVIG+EVHAQ++  SKLFS +S  FGAEPNTQVS  DAA PGMLP++
Sbjct: 6   SEYLIERRDNVYEVVIGLEVHAQVTSNSKLFSSSSTTFGAEPNTQVSLVDAAFPGMLPVI 65

Query: 71  NGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP 130
           N  CV+QA+ TG+GL A INK SVF RKNYFY DLPQGYQISQ   PIVGEG V + +  
Sbjct: 66  NEYCVKQAIKTGIGLRAQINKRSVFDRKNYFYADLPQGYQISQFKYPIVGEGTVILDMA- 124

Query: 131 DKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEA 190
              GQ    EVGIER+HLEQDAGKSIHD     + +DLNRSGVALMEIV+KPDMR+  E 
Sbjct: 125 --HGQ---KEVGIERLHLEQDAGKSIHDMDPQNTLVDLNRSGVALMEIVSKPDMRTPDEV 179

Query: 191 KAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSV-CRPGEAWGTRCEVKNVNSIRFLGLA 249
            A++ KLRSI+RYLGTCDGNM+EGS+RADVN+SV  +  +  GTRCE+KNVNSI+F+ +A
Sbjct: 180 SAYIKKLRSIMRYLGTCDGNMQEGSLRADVNISVRIKGSDKLGTRCEIKNVNSIKFMQMA 239

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           I+YEA RQ+ ++E+G  I QETRLFD  KNETRS+R+KEDA DYRYF +PDLLPLE+ ++
Sbjct: 240 IDYEANRQVDLIEEGKTIDQETRLFDTKKNETRSMRSKEDAHDYRYFPDPDLLPLEVTDE 299

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKIV 365
           FI  +K  IPELPD K++RFI EF +S Y+A++LVSD   A YFE    K+  N+D K+ 
Sbjct: 300 FIEKLKADIPELPDDKKKRFIDEFKVSAYEATILVSDIETAKYFEEVVAKMGKNKDMKLA 359

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
            NW+  +L  VLN     I ++P+S   L +LI+LI +GTISGKIAK IF ++ +    P
Sbjct: 360 VNWITGELFAVLNNKNLEISESPVSAKNLAKLINLIKNGTISGKIAKTIFELMIDGDIDP 419

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKAN 484
           + IVEE GL+Q +D  A+E ++D++I++N          K  L  +FVGQ MK +GGKAN
Sbjct: 420 QIIVEEKGLKQESDPKALEALIDKIIDTNREKAIEYKNGKEKLFGFFVGQAMKVSGGKAN 479

Query: 485 PSIVQKMLKEKL 496
           P ++ ++LK+KL
Sbjct: 480 PQLINEILKKKL 491


>gi|254456258|ref|ZP_05069687.1| glutamyl-tRNA(gln) amidotransferase chain B [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207083260|gb|EDZ60686.1| glutamyl-tRNA(gln) amidotransferase chain B [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 491

 Score =  549 bits (1414), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 282/493 (57%), Positives = 360/493 (73%), Gaps = 12/493 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +S+ L       +EVVIG+EVHAQ++  SKLFS +S  FGAEPNTQVS  DAA PGMLP+
Sbjct: 5   KSKYLIERYDNVYEVVIGLEVHAQVTSNSKLFSSSSTKFGAEPNTQVSLVDAAFPGMLPV 64

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QA+ TG+GL A INK SVF RKNYFY DLPQGYQISQ   PIVGEGKV + + 
Sbjct: 65  INEFCVKQAIKTGIGLKAQINKRSVFDRKNYFYADLPQGYQISQFKYPIVGEGKVVLDM- 123

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
              +GQ    EVGIER+HLEQDAGKSIHD     + +DLNRSGVALMEIV+KPD+RS  E
Sbjct: 124 --PNGQ---KEVGIERLHLEQDAGKSIHDIDPQNTLVDLNRSGVALMEIVSKPDLRSPDE 178

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSV-CRPGEAWGTRCEVKNVNSIRFLGL 248
             A++ KLRSI+RYLGTCDGNM+EGS+RADVNVSV  +  +  GTRCE+KNVNSI+F+ +
Sbjct: 179 VSAYIKKLRSIMRYLGTCDGNMQEGSLRADVNVSVRLKDSKELGTRCEIKNVNSIKFMQM 238

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AI+YEA RQ+ ++E+G  I QETRLFD  KNETRS+R+KEDA DYRYF +PDLLPLE+ +
Sbjct: 239 AIDYEANRQVDLIEEGKSIDQETRLFDTKKNETRSMRSKEDAHDYRYFPDPDLLPLEVTD 298

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKI 364
           +FI  +KK IPELPD K++RFI EF +S Y+A++LVSD   A YFE    K+  N+D K+
Sbjct: 299 EFIENLKKDIPELPDDKKKRFIDEFKVSPYEATILVSDIDTAKYFEEVVAKMGKNQDIKL 358

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
             NW+  +L  VLN     I  +PIS   L +L++LI +GTISGKIAK IF ++ +    
Sbjct: 359 AVNWITGELFAVLNNKNLEISQSPISAKNLAKLVNLIKNGTISGKIAKTIFELMMDGDKD 418

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKA 483
           P+ IVEE GL+Q +D  A+E ++D++I+ N          K  L  +FVGQ MK +GGKA
Sbjct: 419 PQIIVEEKGLKQESDPKALEALIDKIIDDNREKAIEYKNGKEKLFGFFVGQAMKVSGGKA 478

Query: 484 NPSIVQKMLKEKL 496
           NP ++ ++LK+KL
Sbjct: 479 NPQLINEILKKKL 491


>gi|51473350|ref|YP_067107.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia typhi
           str. Wilmington]
 gi|81610827|sp|Q68XL7|GATB_RICTY RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|51459662|gb|AAU03625.1| Glu-AdT [Rickettsia typhi str. Wilmington]
          Length = 483

 Score =  548 bits (1412), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 269/481 (55%), Positives = 348/481 (72%), Gaps = 6/481 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WE VIG+E+HAQ+S  +KLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  CV 
Sbjct: 6   GNTGKWEYVIGLEIHAQISSKTKLFSGSSTLFAASPNSQVSYVDAAMPGMLPVLNKHCVH 65

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QA+ TGL L A INKYSVF RKNYFY DLPQGYQISQ   PIV +G + +      +G  
Sbjct: 66  QAIKTGLALKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQDGMIEIQTS---TGNL 122

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           +TI   I R+HLEQDAGKSIHDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+ K
Sbjct: 123 KTIR--INRLHLEQDAGKSIHDQSPYYSMIDLNRAGIGLMEIVTEPDISSPEEAAEFVKK 180

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR++LRY+G+CDG+ME+GS+R D N+SV R GEA GTRCE+KN+NSIR +  AIE+EA+R
Sbjct: 181 LRNLLRYIGSCDGDMEKGSLRCDANISVRRSGEALGTRCEIKNINSIRNIIKAIEFEAKR 240

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE G  I QETRLF+    ET+++R KE+ALDYRYF +PDLLPL I ++ I  +K 
Sbjct: 241 QVDLLESGEAIIQETRLFNVDSCETKTMRLKEEALDYRYFPDPDLLPLVIHDELINELKS 300

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPD K E++  +FG+S YDA ++VSD+SIA+YFEK A   + K++ NW+I +L G 
Sbjct: 301 SLPELPDQKIEKYTKKFGLSKYDAGIIVSDESIAEYFEKAANECNPKMLTNWLITELFGQ 360

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++   I +  I+P+   +LI LI + TISGKIAK +F I++  G  P +IVEE GL Q
Sbjct: 361 LNKASIGISECKITPSDFAKLIKLIENNTISGKIAKTVFEIMFATGKAPDKIVEEKGLVQ 420

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           ++D   +  V+DEVI  N  +V    + K  L  +FVGQVMK T  KANP++V K+LKEK
Sbjct: 421 ISDNKILNTVIDEVIAENSKSVKCYKSGKDKLFGFFVGQVMKKTKCKANPTLVNKLLKEK 480

Query: 496 L 496
           L
Sbjct: 481 L 481


>gi|15604027|ref|NP_220542.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           prowazekii str. Madrid E]
 gi|7674047|sp|Q9ZE11|GATB_RICPR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|3860718|emb|CAA14619.1| GLUTAMYL-tRNA AMIDOTRANSFERASE SUBUNIT B (gatB) [Rickettsia
           prowazekii]
 gi|292571746|gb|ADE29661.1| Glutamyl-tRNA(Gln)amidotransferase subunit B [Rickettsia prowazekii
           Rp22]
          Length = 483

 Score =  545 bits (1405), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 270/481 (56%), Positives = 349/481 (72%), Gaps = 6/481 (1%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG WE VIG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  CV 
Sbjct: 6   GNTGKWEYVIGLEIHAQISSKSKLFSGSSTLFAASPNSQVSYVDAAMPGMLPVLNKHCVY 65

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QA+ TGL L A INKYSVF RKNYFY DLPQGYQISQ   PIV +G + +   P  +G  
Sbjct: 66  QAIKTGLVLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQDGMIEI---PTSTGDL 122

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           +TI   I R+HLEQDAGKSIHDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+ K
Sbjct: 123 KTIR--INRLHLEQDAGKSIHDQSPYYSLIDLNRAGIGLMEIVTEPDISSPEEAAEFVKK 180

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR++LRY+G+CDG+ME+GSMR D N+SV R GEA GTRCE+KN+NSIR +  AIE+EA+R
Sbjct: 181 LRNLLRYIGSCDGDMEKGSMRCDANISVRRIGEALGTRCEIKNINSIRNIIKAIEFEAKR 240

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE G  I QETRLF+    ET+++R KE+ALDYRYF +PDLLPL I ++ I  +K 
Sbjct: 241 QVDLLESGETIIQETRLFNVDSCETKTMRLKEEALDYRYFPDPDLLPLIIPDELINELKA 300

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPD K E++I +FG+S YDA ++VSD+++A+YFEK A   + K++ NW+I +L G 
Sbjct: 301 SLPELPDQKIEKYIKKFGLSQYDAGIIVSDEAVAEYFEKAANECNPKMLTNWLITELFGQ 360

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++   I +  I+P+   +LI LI   TISGKIAK +F I++E G  P +IVEE  L Q
Sbjct: 361 LNKASIGIRECKITPSDFAKLIKLIEHDTISGKIAKTVFEIMFETGKAPDKIVEEKRLVQ 420

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           ++D   +  V+DEVI  N  +V    + K  L  +FVGQVMK T  KANP++V K+LK+K
Sbjct: 421 ISDNKILNTVIDEVIAENSKSVKCYKSGKDKLFGFFVGQVMKKTECKANPTLVNKLLKDK 480

Query: 496 L 496
           L
Sbjct: 481 L 481


>gi|149187017|ref|ZP_01865324.1| glutamyl-tRNA(gln) amidotransferase subunit B [Erythrobacter sp.
           SD-21]
 gi|148829306|gb|EDL47750.1| glutamyl-tRNA(gln) amidotransferase subunit B [Erythrobacter sp.
           SD-21]
          Length = 499

 Score =  537 bits (1383), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 268/497 (53%), Positives = 346/497 (69%), Gaps = 12/497 (2%)

Query: 11  SESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPIL 70
           +E    G TG+WEVVIG+EVHAQ++  +KLFSGAS  FGAEPNTQVS  DAAMPGMLP+ 
Sbjct: 2   TEYRIQGATGEWEVVIGLEVHAQVTSNAKLFSGASTAFGAEPNTQVSLVDAAMPGMLPVP 61

Query: 71  NGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP 130
           N  C++QAV TG+ + A INK+S F RKNYFY DLPQGYQISQ   PIVGEG + +    
Sbjct: 62  NRECIRQAVRTGMAIEAQINKWSRFDRKNYFYADLPQGYQISQLYHPIVGEGALHIE-AD 120

Query: 131 DKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEA 190
           +K+G      +GIERIH+EQDAGK +HDQ+  +S +DLNR+G+ALMEIV+KPDMRS  EA
Sbjct: 121 EKAGIAEDKVIGIERIHVEQDAGKLMHDQHPTMSYVDLNRTGIALMEIVSKPDMRSPAEA 180

Query: 191 KAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAI 250
            A++ KLRSILRY+G+CDGNMEEGSMRADVNVSV RPGE +GTR E KNVNS+RF+   I
Sbjct: 181 GAYVRKLRSILRYVGSCDGNMEEGSMRADVNVSVRRPGEEFGTRTETKNVNSVRFVMQVI 240

Query: 251 EYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDF 310
           EYEA RQ+ ++E+GG + QETRLFDP+   TR++R+KEDA DYRYF +PDLLPLE+D+ F
Sbjct: 241 EYEANRQVDVIENGGTVDQETRLFDPNTGTTRTMRSKEDAHDYRYFPDPDLLPLELDDSF 300

Query: 311 IRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKI------ 364
           I   +  +PELPDAKR R+  E G++ Y+A  L ++  I   FE L      KI      
Sbjct: 301 IEECRASLPELPDAKRARYENELGLTPYNARELTAEVEIFGRFETLLAATAAKIGKPEAK 360

Query: 365 ----VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
               VANW ++   GV+   G+       +      ++ +   G ISG  AK+I+ I+ +
Sbjct: 361 VATQVANWALSVAPGVVKSLGEEANMANATAGAQASILAMQDKGEISGGQAKEIYEIVLK 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNT 479
           +GG P+ I +E GL+QV+D  AIE  +DE+I +N + VA     K  L  +FVGQ MK  
Sbjct: 421 EGGEPEAIADERGLKQVSDTGAIEAKIDEIIAANEDKVAEYRGGKDKLFGFFVGQTMKAM 480

Query: 480 GGKANPSIVQKMLKEKL 496
            GKANP++V ++LK KL
Sbjct: 481 QGKANPAVVNQLLKAKL 497


>gi|300113768|ref|YP_003760343.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Nitrosococcus
           watsonii C-113]
 gi|299539705|gb|ADJ28022.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Nitrosococcus
           watsonii C-113]
          Length = 477

 Score =  536 bits (1380), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 258/480 (53%), Positives = 349/480 (72%), Gaps = 9/480 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQL+  SK+FSGA+  +GA PNTQ    D  +PG+LP+LN   V  AV  
Sbjct: 3   WEPVIGLEIHAQLATKSKIFSGAATAYGASPNTQACAVDLGLPGVLPVLNQAVVCMAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A I K+SVFARKNYFYPDLP+GYQISQ++ PIV +G V + +   + G  + IE 
Sbjct: 63  GLAIEAKITKHSVFARKNYFYPDLPKGYQISQYELPIVADGHVIIEL---EDGTEKRIE- 118

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            I R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV+ PD+RS+ EA  ++ K+ +++
Sbjct: 119 -IIRAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSSPDLRSTKEAVIYMKKIHTLV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM+EGS R D NVS+   G E  GTR E+KN+NS RF+  A++YE  RQ  +
Sbjct: 178 RYLGICDGNMQEGSFRCDANVSIRPQGQETLGTRTELKNINSFRFVERALQYEIERQAEV 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LE G  + QETRLFDP+KNETR +RTKE+A DYRYF +PDLLPL +++ FI  +++ +PE
Sbjct: 238 LESGDKVIQETRLFDPAKNETRPMRTKEEATDYRYFPDPDLLPLVLEDSFIEEVRETLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL--AVNRDKKIVANWVINDLLGVLN 378
           LPDAKR+RF+ E+ +S YDASVL + + +ADY+E +    N + K+ ANWV+ DL G LN
Sbjct: 298 LPDAKRKRFMVEYALSAYDASVLTASRELADYYEAVVKTANGEGKLSANWVMGDLAGALN 357

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           + GKSIED+P+SP QLG+LI  I D TISGKIAK +F  ++ +GG   EI+   GL+QVT
Sbjct: 358 KEGKSIEDSPVSPEQLGQLIKRITDKTISGKIAKTVFETMYAQGGKVDEIIAHQGLKQVT 417

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D ++IEK++DEV+ +NP  V +  A K  L  +FVGQVMK + GKANP  + ++LK+KLG
Sbjct: 418 DTASIEKLIDEVLAANPQQVMQYQAGKDKLFGFFVGQVMKVSKGKANPQQLNELLKKKLG 477


>gi|77165480|ref|YP_344005.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrosococcus
           oceani ATCC 19707]
 gi|254433161|ref|ZP_05046669.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Nitrosococcus oceani AFC27]
 gi|109892040|sp|Q3J9M1|GATB_NITOC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|76883794|gb|ABA58475.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Nitrosococcus oceani ATCC 19707]
 gi|207089494|gb|EDZ66765.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Nitrosococcus oceani AFC27]
          Length = 477

 Score =  535 bits (1378), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 255/479 (53%), Positives = 347/479 (72%), Gaps = 9/479 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQL+  SK+FSGA+  +GA PNTQ    D  +PG+LP+LN   V+ AV  
Sbjct: 3   WEPVIGLEIHAQLATKSKIFSGAATAYGAPPNTQACAVDLGLPGVLPVLNQAVVRMAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A I K+SVFARKNYFYPDLP+GYQISQ++ PIV +G V + +   + G  + IE 
Sbjct: 63  GLAIEAKIAKHSVFARKNYFYPDLPKGYQISQYELPIVADGHVIIEL---EDGVEKRIE- 118

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            I R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV+ PD+RS+ EA  ++ K+ +++
Sbjct: 119 -IVRAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSGPDLRSTKEAVTYMKKIHTLV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM+EGS R D N+S+   G E  GTR E+KN+NS RF+  A++YE  RQ  +
Sbjct: 178 RYLGICDGNMQEGSFRCDANISIRPQGQETLGTRTELKNINSFRFVERALQYEIERQTEV 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LE GG + QETRLFDP+KNETR +RTKE+A DYRYF +PDLLPL +++ FI  +++ +PE
Sbjct: 238 LESGGQVLQETRLFDPAKNETRPMRTKEEATDYRYFPDPDLLPLVLEDSFIDEVRETLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRD--KKIVANWVINDLLGVLN 378
           LPDAKR+RF+ E+ +S YDASVL + + +ADY+E +    D   K+ ANWV+ DL G LN
Sbjct: 298 LPDAKRKRFVMEYALSAYDASVLTASRELADYYEAVVKTADGEAKLSANWVMGDLAGALN 357

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           + GKSI D+P+SP QLG+LI  I D TISGKIAK +F  ++ +GG   EI+   GL+QVT
Sbjct: 358 KEGKSIADSPVSPEQLGQLIKRIADETISGKIAKTVFETMYAQGGKADEIIARQGLKQVT 417

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           D ++IEK++DEV+ +NP  V +    K  L  +FVGQVMK + GKANP  + ++LK+KL
Sbjct: 418 DTASIEKLIDEVLAANPQQVTQYQGGKDKLFGFFVGQVMKTSKGKANPQQLNELLKKKL 476


>gi|292493277|ref|YP_003528716.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Nitrosococcus
           halophilus Nc4]
 gi|291581872|gb|ADE16329.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Nitrosococcus
           halophilus Nc4]
          Length = 479

 Score =  533 bits (1373), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 252/481 (52%), Positives = 350/481 (72%), Gaps = 13/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQL+  SK+FSGA+  +GA PNTQ    D  +PG+LP+LN   V+ AV  
Sbjct: 3   WEPVIGLEIHAQLATKSKIFSGAATAYGAPPNTQACAIDLGLPGVLPVLNETAVRMAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI--GPDKSGQFRTI 139
           GL + A I + S+FARKNYFYPDLP+GYQISQ++ P+V  G   + +  G +K       
Sbjct: 63  GLAIGAKITERSIFARKNYFYPDLPKGYQISQYELPVVANGHTIIELEEGVEK------- 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + I R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV+ PD+RS+ EA A++ K+ +
Sbjct: 116 HITIIRAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSGPDLRSTKEAVAYMKKIHT 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYLG CDGNM+EGS R D NVS+   G EA+GTR E+KN+NS RF+  A++YE  RQI
Sbjct: 176 LVRYLGICDGNMQEGSFRCDANVSIRPQGQEAFGTRTELKNINSFRFVERALQYEIERQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE GG + QETRLFDP+KNETR +RTKE+A DYRYF +PDLLPL +D+ FI  ++K +
Sbjct: 236 EVLESGGRVIQETRLFDPNKNETRPMRTKEEATDYRYFPDPDLLPLVLDDSFIEEVQKTL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL--AVNRDKKIVANWVINDLLGV 376
           PELPD KR+RF+ E+ +S YDASVL + + +ADY+E +      + K+ ANWV+ DL G 
Sbjct: 296 PELPDDKRKRFMAEYNLSAYDASVLTTSRELADYYEAVVKTAGGEAKLCANWVMGDLAGA 355

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN+ GK+IE++P++P QLG+LI  ++D TISGKIAK +F  ++ +GG   EI+E  GL+Q
Sbjct: 356 LNKEGKNIENSPVTPEQLGQLIKRVVDKTISGKIAKTVFETMYTQGGNADEIIERQGLKQ 415

Query: 437 VTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           VTD ++IEK++DEV+ ++P  + +  A K  L  +FVGQVMK + GKANP  V ++LK+K
Sbjct: 416 VTDTASIEKLIDEVLATHPQQLEQYQAGKNKLFGFFVGQVMKASKGKANPEQVNELLKKK 475

Query: 496 L 496
           L
Sbjct: 476 L 476


>gi|88810577|ref|ZP_01125834.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrococcus
           mobilis Nb-231]
 gi|88792207|gb|EAR23317.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrococcus
           mobilis Nb-231]
          Length = 477

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 255/480 (53%), Positives = 346/480 (72%), Gaps = 8/480 (1%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE VIG+EVH QL+  +K+FSGA+  +GA PNTQ    D  MPG+LP+LN + V+ AV 
Sbjct: 2   NWEAVIGLEVHIQLATKTKIFSGAATAYGAAPNTQACAIDLGMPGVLPVLNEQAVRMAVK 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL L A I   SVFARKNYFYPDLP+GYQISQ++ P+V +G++++ +  D S +     
Sbjct: 62  LGLALGATIAPRSVFARKNYFYPDLPKGYQISQYELPVVADGELTIELDADVSKR----- 116

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           +GI R HLE+DAGKS+H+ +  V+ IDLNR+G  L+E+V+ PDMRS+ EA A++ KL S+
Sbjct: 117 IGIIRAHLEEDAGKSLHEGFEQVTAIDLNRAGTPLIEVVSAPDMRSAKEAVAYMKKLHSL 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +RYL   DGNM+EGS R D N+SV   GE   GTR EVKNVNS RF+  AI YE +RQI 
Sbjct: 177 VRYLEISDGNMQEGSFRCDANISVRPLGEQRLGTRTEVKNVNSFRFVERAINYEIQRQIE 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           +LEDGG + QETRLFD S+NETR +RTKE+A DYRYF +PDLLPLEI+   I  ++K +P
Sbjct: 237 LLEDGGKVVQETRLFDTSRNETRPMRTKEEANDYRYFPDPDLLPLEIEPALIEEVRKTLP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVLN 378
           ELPDAKRERF+ ++G+  YD++VL + +++ADYFE +A    D K+  NWV+ +L G LN
Sbjct: 297 ELPDAKRERFMRDYGLDAYDSTVLTASRALADYFEAVAAQCADAKLAGNWVMGELAGALN 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++G  I +TP+S   LG L+  I D T+SGKIAK++F  +W   G    ++E  GL+Q+T
Sbjct: 357 KAGLDITETPVSSEMLGVLLQRIKDNTLSGKIAKEVFEAMWNGEGGADAVIERRGLKQLT 416

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D SA+E +++EVI +NPN   +  A K  L+ +FVGQVMK T G+ANP +V ++L+EKLG
Sbjct: 417 DRSALEAIIEEVIAANPNQTQQYRAGKEKLLGFFVGQVMKATKGQANPQLVNELLQEKLG 476


>gi|42520049|ref|NP_965964.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|47115637|sp|P61349|GATB_WOLPM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|42409786|gb|AAS13898.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Wolbachia
           endosymbiont of Drosophila melanogaster]
          Length = 474

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 262/482 (54%), Positives = 347/482 (71%), Gaps = 12/482 (2%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
           T  DWE VIG+EVHAQ+S  +KLFS +S  FGAE NTQVS  DAAMPG LPILN  C++Q
Sbjct: 2   TKEDWEAVIGLEVHAQVSSNTKLFSSSSTEFGAEHNTQVSLVDAAMPGTLPILNYYCIEQ 61

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           A+ TGL L+A INKYS F RKNYFYPDLPQGYQI+Q  +PIV  G+V ++   D   + R
Sbjct: 62  AIRTGLALSAEINKYSYFDRKNYFYPDLPQGYQITQFFEPIVKNGRVFIN---DNEKEIR 118

Query: 138 TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
                I RIHLEQDAGKS+H++  + + +DLNR+GVALMEIV++PD+RSS EA   + KL
Sbjct: 119 -----IARIHLEQDAGKSVHEE--SKTYVDLNRAGVALMEIVSEPDLRSSAEAAECMKKL 171

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARR 256
           R ILRY+G+CDG+ME+GS+R D NVSV   G + +GTRCE+KN+NSIR++  AI+YE +R
Sbjct: 172 RQILRYIGSCDGDMEKGSLRCDANVSVRLKGSSTFGTRCEIKNLNSIRYIVQAIDYEIQR 231

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI ILE G  I Q+T LFD +  +T+ +R+KEDA DYRYF EPDLLP+E+ +D I  I+ 
Sbjct: 232 QIEILESGEEISQDTLLFDVASGKTKVMRSKEDASDYRYFPEPDLLPVEVSQDKIDLIQS 291

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPD K+ R+I E GI+ YDA+V+ SDK+IADYFE+L    D K+   W+  +L G 
Sbjct: 292 SLPELPDQKKLRYIEELGINEYDANVITSDKAIADYFEELIKKHDSKLAVTWLTVELFGR 351

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++G  I  +PI  N L EL+D I+DGTIS K+ K +F+ ++E G     I+EE GL+Q
Sbjct: 352 LNKAGIDIVSSPIKANALSELLDFIVDGTISAKLGKQVFDSMFETGKPASLIIEEQGLKQ 411

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           +TD   I +V+D++IN+N + V    + K  L  +FVG+VMK T GKA+P +V  +L E+
Sbjct: 412 ITDRGQISEVIDKIINNNQDKVQEYKSGKTKLYGFFVGEVMKLTKGKASPDVVNSILSER 471

Query: 496 LG 497
           L 
Sbjct: 472 LS 473


>gi|198283876|ref|YP_002220197.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218665662|ref|YP_002426511.1| glutamyl-tRNA(Gln)/aspartyl-tRNA(Asn) amidotransferase, B subunit
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198248397|gb|ACH83990.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218517875|gb|ACK78461.1| glutamyl-tRNA(Gln)/aspartyl-tRNA(Asn) amidotransferase, B subunit
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 478

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 255/477 (53%), Positives = 346/477 (72%), Gaps = 6/477 (1%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           DWEVVIG+EVHAQL+  +K+F G    FGAEPN+       AMPG LP+LN   V +A+ 
Sbjct: 4   DWEVVIGLEVHAQLNTATKIFCGCPTAFGAEPNSHTCPVCLAMPGALPVLNAAAVDKAIA 63

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL + A +N++S+FARKNYFYPDLP+GYQISQ++ P+VG+G ++V + PD   +     
Sbjct: 64  LGLAIGAELNRHSIFARKNYFYPDLPKGYQISQYELPVVGKGTLTVQL-PDGGEKV---- 118

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           VG+ R HLE+DAGKS+H+ +   S IDLNR+G  L+EIV++PDMRSS EA A+L KL ++
Sbjct: 119 VGVTRAHLEEDAGKSLHEAFIGQSGIDLNRAGTPLLEIVSEPDMRSSAEAVAYLKKLHTL 178

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           +RYL  CDGNM+EGS R D NVS+ RPG  +GTR E+KN+NS RFL  AIEYE  RQ  I
Sbjct: 179 VRYLDICDGNMQEGSFRCDANVSLRRPGAPYGTRAEIKNLNSFRFLEKAIEYEIGRQRDI 238

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LE GG I QETRL+D +++ETRS+R KE+A DYRYF +PDLLPL +DE  I  +++ +PE
Sbjct: 239 LESGGQIVQETRLYDANRDETRSMRGKEEANDYRYFPDPDLLPLVLDESRIERVRETLPE 298

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRS 380
           LPDA+R RF+ ++ + +YDA VL + +++ADY+E++AV+ D K+ ANWV+ DLLG LN++
Sbjct: 299 LPDARRIRFMRQYALPVYDAGVLTAGRTLADYYEQVAVDVDGKLAANWVMGDLLGALNKA 358

Query: 381 GKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDL 440
              IED P+S  +L  L+  I D TISGKIAK+IF  ++ +GG    I+E+ GLRQ+TD+
Sbjct: 359 SIEIEDCPVSAEKLRLLVQRIEDQTISGKIAKEIFEEIFYRGGEVDAIIEDRGLRQITDV 418

Query: 441 SAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +AI  +VD ++ +NP   A   A K  L+ +FVGQVMK + GKANP  V  +L E+L
Sbjct: 419 AAIAAMVDAIVTANPQQAADFRAGKDKLLGFFVGQVMKASQGKANPDQVNAILLERL 475


>gi|296284576|ref|ZP_06862574.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Citromicrobium
           bathyomarinum JL354]
          Length = 498

 Score =  529 bits (1363), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 263/492 (53%), Positives = 345/492 (70%), Gaps = 12/492 (2%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG+WEVVIG+EVHAQ++  +KLFSGAS  FGAEPNTQVS  DAAMPGMLP+ N  C++
Sbjct: 8   GATGEWEVVIGLEVHAQVTSNAKLFSGASTEFGAEPNTQVSLIDAAMPGMLPVPNRECIR 67

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TG+ + A IN +S F RKNYFY DLPQGYQISQ   PIVGEG++ +    +K+G  
Sbjct: 68  QAVRTGMAIEAQINAWSRFDRKNYFYADLPQGYQISQLYHPIVGEGQLLIE-ADEKAGIP 126

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
               +GIERIH+EQDAGK +HDQ+  +S +DLNR+G+ALMEIV+KPDMRS  EA A++ K
Sbjct: 127 EDKVIGIERIHVEQDAGKLMHDQHPTMSYVDLNRTGIALMEIVSKPDMRSPAEAGAYVRK 186

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LRSILRY+G+CDGNMEEGSMRADVNVSV +PGE +GTR E KNVNS+RF+   IEYEA R
Sbjct: 187 LRSILRYVGSCDGNMEEGSMRADVNVSVRKPGEEFGTRTETKNVNSVRFVMQVIEYEANR 246

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE+GG + QETRLFD +   TR++R+KEDA DYRYF +PDLLPLE+D+ F+   ++
Sbjct: 247 QVDVLENGGTVDQETRLFDVATGTTRTMRSKEDAHDYRYFPDPDLLPLELDDAFLSECRE 306

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKI----------VA 366
            +PELPDAKR R+ GE G++ Y+A  L ++      FE L      KI          VA
Sbjct: 307 SLPELPDAKRARYEGELGLTPYNARELTAEVETFGRFETLLSATAAKIGKPEKAVATQVA 366

Query: 367 NWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK 426
           NW ++   GV+   G+  +    +      ++ +   G ISG  AK+I+ I+ + G  P+
Sbjct: 367 NWALSVAPGVMKSLGEEADPAHATAEAQASILAMQDKGEISGGQAKEIYEIVLKTGRDPE 426

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANP 485
           EI +  GL+QV+D  AIE+ +D +I +N + VA     K  L  +FVGQ MK   GKANP
Sbjct: 427 EIADSEGLKQVSDTGAIEEAIDAIIAANEDKVAEYRGGKDKLFGFFVGQTMKAMQGKANP 486

Query: 486 SIVQKMLKEKLG 497
           ++V ++LK+KLG
Sbjct: 487 AVVNQILKDKLG 498


>gi|190570557|ref|YP_001974915.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|213019197|ref|ZP_03335004.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|229487479|sp|B3CN64|GATB_WOLPP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|190356829|emb|CAQ54196.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|212995306|gb|EEB55947.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 473

 Score =  528 bits (1361), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 261/483 (54%), Positives = 346/483 (71%), Gaps = 14/483 (2%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
           T  +WE VIG+EVHAQ+S  +KLFS +   FG E NTQVS  DAAMPG LPILN  C++Q
Sbjct: 2   TKENWETVIGLEVHAQVSSKTKLFSSSLTEFGTEHNTQVSLVDAAMPGTLPILNYFCIEQ 61

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           A+ TGL ++A INK S F RKNYFYPDLPQGYQI+Q  +PIV  GKV ++          
Sbjct: 62  AICTGLAISAEINKCSYFDRKNYFYPDLPQGYQITQFFEPIVKNGKVFINNNEK------ 115

Query: 138 TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
             E+ I RIHLEQDAGKSIH++  + + +DLNR+GVALMEIV++PD+RSS EA  F+ KL
Sbjct: 116 --EIRIARIHLEQDAGKSIHEE--SKTYVDLNRAGVALMEIVSEPDLRSSAEAAEFMKKL 171

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           R ILRY+G+CDG+ME+GS+R D NVSV RP    A+GTRCE+KN+NSIR++  AI+YEA+
Sbjct: 172 RQILRYIGSCDGDMEKGSLRCDANVSV-RPNGSSAFGTRCEIKNLNSIRYIVQAIDYEAQ 230

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ILE GG I Q+T LFD +  +T+ +R+KED+ DYRYF EPDLLP+EI +D I +IK
Sbjct: 231 RQIKILESGGEISQDTLLFDVTLGKTKVMRSKEDSSDYRYFPEPDLLPVEISQDKIDSIK 290

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLG 375
             +PELPD K+ R+I E GI+ YDA V+ SDK+ ADYFE+L    D KI   W+  +L G
Sbjct: 291 SSLPELPDQKKLRYINELGINEYDADVITSDKATADYFEELIKKHDSKIAVTWLTVELFG 350

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            LN++   I  +PI  + L EL+D I+DGTIS K+ K +F+I++E G     I+EE  L+
Sbjct: 351 RLNKANIDIVSSPIKADALSELLDFIVDGTISAKLGKQVFDIMFETGKPASLIIEEQDLK 410

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q+TD   I +++D ++N+N + V    + K  L  +FVG+VMK+T GKA+P +V  +L E
Sbjct: 411 QITDRDQISEIIDTIVNNNQDKVQEYKSGKTKLYGFFVGEVMKSTKGKASPDVVNLVLSE 470

Query: 495 KLG 497
           +LG
Sbjct: 471 RLG 473


>gi|85373105|ref|YP_457167.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Erythrobacter
           litoralis HTCC2594]
 gi|122545273|sp|Q2ND71|GATB_ERYLH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|84786188|gb|ABC62370.1| glutamyl-tRNA(gln) amidotransferase subunit B [Erythrobacter
           litoralis HTCC2594]
          Length = 498

 Score =  526 bits (1354), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 261/492 (53%), Positives = 344/492 (69%), Gaps = 12/492 (2%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG+WEVVIG+EVHAQ++  +KLFSGAS  FGAEPN QVS  DAAMPGMLP+ N  C++
Sbjct: 8   GATGEWEVVIGLEVHAQVTSNAKLFSGASTEFGAEPNAQVSLVDAAMPGMLPVPNRECIR 67

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TG+ + A IN +S F RKNYFY DLPQGYQISQ   P+VGEG++ +    +K+G  
Sbjct: 68  QAVRTGMAIEAQINTWSRFDRKNYFYADLPQGYQISQLYHPLVGEGQLLIE-ADEKAGIS 126

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
               +GIERIH+EQDAGK +HDQ+  +S +DLNR GVALMEIV++PDMRS  EA A++ K
Sbjct: 127 EDKVIGIERIHVEQDAGKLMHDQHPTMSYVDLNRCGVALMEIVSRPDMRSPAEAGAYVRK 186

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LR+ILRY+G+CDGNMEEGSMRADVNVSV RPGE +GTR E KNVNS+RF+   IEYEA R
Sbjct: 187 LRAILRYVGSCDGNMEEGSMRADVNVSVRRPGEEFGTRTETKNVNSVRFVMQVIEYEANR 246

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ ++E GG + QETRLFDP    TR++R+KEDA DYRYF +PDLLPLE+++ F+   + 
Sbjct: 247 QVDLIESGGAVEQETRLFDPGTGTTRTMRSKEDAHDYRYFPDPDLLPLELEDSFLDECRA 306

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL------AVNRDKK----IVA 366
            +PELPDAKR+R+  E G++ Y+A  L ++      FE L      A+  D+K     VA
Sbjct: 307 SLPELPDAKRQRYENELGLTPYNARELTAEVETFARFETLLAATAKAIGEDEKKVATQVA 366

Query: 367 NWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK 426
           NW ++   GV+   G        +  +   ++ +   G ISG  AK+IF I+ ++GG P 
Sbjct: 367 NWALSVAPGVIKSLGDEAHVENATAERQAAILKMQDAGEISGGQAKEIFEIVLKEGGDPA 426

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANP 485
            I +E GL+QV+D  AIE  +DE++ +N + V +    K  L  +FVGQ MK   GKANP
Sbjct: 427 TIADEKGLKQVSDTGAIEAAIDEILANNEDKVEQYKCGKDKLFGFFVGQTMKAMQGKANP 486

Query: 486 SIVQKMLKEKLG 497
           ++V ++LK+KLG
Sbjct: 487 AVVNQILKDKLG 498


>gi|58698687|ref|ZP_00373577.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225629961|ref|YP_002726752.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Wolbachia sp.
           wRi]
 gi|254790976|sp|C0R5B9|GATB_WOLWR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|58534799|gb|EAL58908.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225591942|gb|ACN94961.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Wolbachia sp.
           wRi]
          Length = 473

 Score =  525 bits (1352), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 261/482 (54%), Positives = 344/482 (71%), Gaps = 12/482 (2%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
           T  DWE VIG+EVHAQ+S  +KLFS +S  FGAE NTQVS  DAAMPG LPILN  C++Q
Sbjct: 2   TKEDWEAVIGLEVHAQVSSNTKLFSSSSTEFGAEHNTQVSLVDAAMPGTLPILNYYCIEQ 61

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           A+ TGL L+A INKYS F RKNYFYPDLPQGYQI+Q  +PIV  G+V ++   D   + R
Sbjct: 62  AIRTGLALSAEINKYSYFDRKNYFYPDLPQGYQITQFFEPIVKNGRVFIN---DNEKEIR 118

Query: 138 TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
                I RIHLEQDAGKS+H++  + + +DLNR+GVAL+EIV++PD+RSS EA   + KL
Sbjct: 119 -----IARIHLEQDAGKSVHEE--SKTYVDLNRAGVALIEIVSEPDLRSSAEAAECMKKL 171

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-AWGTRCEVKNVNSIRFLGLAIEYEARR 256
           R ILRY G+CDG+ME+GS+R D NVSV   G   +GTRCE+KN+NSIR +  AI+YE +R
Sbjct: 172 RQILRYTGSCDGDMEKGSLRCDANVSVRLKGSNTFGTRCEIKNLNSIRHIVQAIDYEIQR 231

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI ILE G  I Q+T LFD +  +T+ +R+KEDA DYRYF EPDLLP+E+ ++ I  I+ 
Sbjct: 232 QIEILESGEEISQDTLLFDVASGKTKVMRSKEDASDYRYFPEPDLLPVEVSQEKIDLIQS 291

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPD K+ R+I E GI+ YDA+V+ SDK+IADYFE+L    D K+   W+  +L G 
Sbjct: 292 SLPELPDQKKLRYIEELGINEYDANVITSDKAIADYFEELIKKHDSKLAVTWLTVELFGR 351

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++   I  +PI  N L EL+D I+DGTIS K+ K +F+I++E G     I+EE  L+Q
Sbjct: 352 LNKANIDIVSSPIKANALSELLDFIVDGTISAKLGKQVFDIMFETGKPASLIIEEQDLKQ 411

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           +TD   I +V+D++INSN + V    + K  L  +FVG+VMK T GKA+P +V  +L E+
Sbjct: 412 ITDKCQISEVIDKIINSNQDKVQEYKSGKTRLYGFFVGEVMKLTKGKASPDVVNSILSER 471

Query: 496 LG 497
           LG
Sbjct: 472 LG 473


>gi|254479878|ref|ZP_05093126.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [marine gamma proteobacterium
           HTCC2148]
 gi|214039440|gb|EEB80099.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [marine gamma proteobacterium
           HTCC2148]
          Length = 480

 Score =  525 bits (1351), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 259/483 (53%), Positives = 346/483 (71%), Gaps = 12/483 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+EVH QL+  SK+FSG+S+ FGAE NTQ S  D AMPGMLP+LN + V+ AVM 
Sbjct: 3   WETVIGLEVHLQLATKSKIFSGSSITFGAEANTQASAVDLAMPGMLPVLNEQAVRMAVMF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG+ A+I   SVF RKNYFYPDLP+GYQISQ   PIVGEG+  + +   + G  R  ++
Sbjct: 63  GLGIGANIGMRSVFDRKNYFYPDLPKGYQISQFADPIVGEGQFEIQL---EDGSIR--QI 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RSS EA A+L  + S++
Sbjct: 118 GITRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDIRSSEEAVAYLKAMHSLV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            YLG  DGNM EGSMR D+N+S+   G+  +GTR E+KNVNS RF+  AI +E  RQ  I
Sbjct: 178 TYLGISDGNMAEGSMRCDINISLRPVGQVEYGTRAEIKNVNSFRFVERAIRHEVERQADI 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LEDGG I QETRL+D  ++ETR +R+KE A DYRYF EPDLLP+ IDE ++ AI K +PE
Sbjct: 238 LEDGGKIVQETRLYDADRDETRPMRSKEVANDYRYFPEPDLLPIVIDEAYVAAIGKTLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP AKR RFI ++ +S YDASVL   +++ADY+E  +A   D KI ANWV  +LLG LN+
Sbjct: 298 LPTAKRNRFIKQYSLSAYDASVLAGSRALADYYETVVAACEDAKIAANWVQVELLGQLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           + ++I D+P++ NQLG LI  I+D +ISGKIAK +F  +W+  GT  EI+   GL+QV+D
Sbjct: 358 NEQAIGDSPVTANQLGGLIARILDNSISGKIAKQVFEAMWQGEGTADEIIAAKGLQQVSD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             A+E +VDEVI +N   V +      A +  L+ +FVGQ+MK + G+ANP ++ ++L +
Sbjct: 418 TGALEAMVDEVIAANTAQVEQYQAADDAKRKKLLGFFVGQIMKASKGQANPQMINQLLAK 477

Query: 495 KLG 497
           KL 
Sbjct: 478 KLA 480


>gi|220933702|ref|YP_002512601.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thioalkalivibrio
           sp. HL-EbGR7]
 gi|254790975|sp|B8GL96|GATB_THISH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|219995012|gb|ACL71614.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thioalkalivibrio
           sp. HL-EbGR7]
          Length = 477

 Score =  524 bits (1350), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 252/480 (52%), Positives = 341/480 (71%), Gaps = 9/480 (1%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE VIG+EVHAQL+  SK+FSGAS  +GA PN+Q    D  +PG+LP+LN   V+ AV 
Sbjct: 2   EWETVIGLEVHAQLATKSKIFSGASTAYGAAPNSQACAIDLGLPGVLPVLNREAVRMAVK 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL + A I+  SVFARKNYFYPDLP+GYQISQ++ P+VG GK+ + +   + G+ + I 
Sbjct: 62  FGLAIGAEISPRSVFARKNYFYPDLPKGYQISQYELPVVGLGKLEIEL---EDGETKVI- 117

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
            GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PDMRS+ EA A+L KL ++
Sbjct: 118 -GITRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDMRSAKEAVAYLKKLHAL 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +RYL  CDGNM+EGS R D NVSV R G E +GTR E+KN+NS RF+  AI YE  RQI 
Sbjct: 177 VRYLEICDGNMQEGSFRCDANVSVRRKGTEKFGTRAEIKNINSFRFVERAINYEVERQID 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ILE GG + QETRL+DP K ETRS+R+KE+A DYRYF +PDLLPLEID  FI  ++  +P
Sbjct: 237 ILEGGGAVVQETRLYDPDKGETRSMRSKEEANDYRYFPDPDLLPLEIDASFIEGVRGTLP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL--AVNRDKKIVANWVINDLLGVL 377
           ELPD K+ RF+  +G+S YDA VL + + + DY+E +  A     K+ ANWV+ +L   L
Sbjct: 297 ELPDEKKHRFMTHYGLSAYDAGVLTASREMGDYYEAVVKACGGHAKLAANWVMGELSAAL 356

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+  + I ++P+S   LG++++ I D TISGKIAKD+F  +W   G+   ++E+ GL+Q+
Sbjct: 357 NKDNREITESPVSAAALGQMLERIEDNTISGKIAKDVFEAMWNGEGSADAVIEKKGLKQI 416

Query: 438 TDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           TD  AIE ++D+V+  NP  + +  + K  L  +FVGQVMK TGGKANP  V  +LK+KL
Sbjct: 417 TDTGAIEAIIDKVMADNPGQLEQYRSGKDKLFGFFVGQVMKATGGKANPGQVNDLLKKKL 476


>gi|229588404|ref|YP_002870523.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           fluorescens SBW25]
 gi|259647236|sp|C3K6Y3|GATB_PSEFS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|229360270|emb|CAY47127.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Pseudomonas fluorescens SBW25]
          Length = 481

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 250/482 (51%), Positives = 349/482 (72%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QL+  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AVM 
Sbjct: 3   WEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNQEAVRMAVMF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +   P + G  +   V
Sbjct: 63  GLAIDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGYLDI---PLEDGTIK--RV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+H++++  + IDLNR+G  L+EIV++PDMRS+ EA A++  + +++
Sbjct: 118 GVTRAHLEEDAGKSLHEEFNGATGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKTIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVSV   G+A +GTRCE+KNVNS RF+  AI  E RRQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSVRPKGQAEYGTRCEIKNVNSFRFIEKAINTEVRRQIEL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q+TRL+DP+K+ETR++R+KE+A DYRYF +PDLLP+ I++ F+  I+  +PE
Sbjct: 238 IEDGGKVIQQTRLYDPNKDETRAMRSKEEANDYRYFPDPDLLPVVIEDSFLNDIRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  +FG+S+YDASVL S +  ADYFEK +++  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKRERFQAQFGLSVYDASVLASSREQADYFEKVVSIAGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I++ P++  QLG ++  I D TISGKIAK +F  +    G+  EI+E+ GL+QVTD
Sbjct: 358 QGLEIDEAPVTAEQLGGMLLRIKDNTISGKIAKTVFEAMASGEGSADEIIEKRGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AI  V+DE++ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 SGAISAVLDEMLAANAEQVKQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKS 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|312958975|ref|ZP_07773494.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Pseudomonas fluorescens WH6]
 gi|311286745|gb|EFQ65307.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Pseudomonas fluorescens WH6]
          Length = 481

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 249/482 (51%), Positives = 348/482 (72%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QL+  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AVM 
Sbjct: 3   WEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNQEAVRMAVMF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +   P + G  +   V
Sbjct: 63  GLAIDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDI---PLEDGTIK--RV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+H+++   + IDLNR+G  L+EIV++PDMRS+ EA A++  + +++
Sbjct: 118 GVTRAHLEEDAGKSLHEEFPGATGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKTIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVSV   G+A +GTRCE+KNVNS RF+  AI  E RRQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSVRPKGQAEYGTRCEIKNVNSFRFIEKAINTEVRRQIEL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q+TRL+DP+K+ETR++R+KE+A DYRYF +PDLLP+ +++ F+  ++  +PE
Sbjct: 238 IEDGGKVIQQTRLYDPNKDETRAMRSKEEANDYRYFPDPDLLPVVLEDSFLNDVRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  +FG+S+YDASVL S +  A+YFEK +++  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPQQKRERFQAQFGLSVYDASVLASSREQANYFEKVVSIAGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I+D P++  QLG ++  I D TISGKIAK +F  +    GT  EI+E+ GL+QVTD
Sbjct: 358 QGLEIDDAPVTAEQLGGMLLRIKDNTISGKIAKTVFEAMAAGEGTADEIIEKRGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AI  V+DE++ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 SGAISAVLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKS 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|85707675|ref|ZP_01038741.1| glutamyl-tRNA(gln) amidotransferase subunit B [Erythrobacter sp.
           NAP1]
 gi|85689209|gb|EAQ29212.1| glutamyl-tRNA(gln) amidotransferase subunit B [Erythrobacter sp.
           NAP1]
          Length = 498

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 261/492 (53%), Positives = 343/492 (69%), Gaps = 12/492 (2%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G TG+WEVVIG+EVHAQ++  +KLFSGAS  FGAEPN+QVS  DAAMPGMLP+ N  C++
Sbjct: 8   GATGEWEVVIGLEVHAQVTSNAKLFSGASTAFGAEPNSQVSLVDAAMPGMLPVPNRECIR 67

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
           QAV TG+ + A IN++S F RKNYFY DLPQGYQISQ   P+VGEG++ +    +K+G  
Sbjct: 68  QAVRTGMAIEAEINQWSRFDRKNYFYADLPQGYQISQLYHPLVGEGQLLIE-ADEKTGIP 126

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
               +GIERIH+EQDAGK +HDQ+  +S +DLNRSGVALMEIV++PDMRS  EA A++ K
Sbjct: 127 EDKIIGIERIHVEQDAGKLMHDQHPTMSYVDLNRSGVALMEIVSRPDMRSPAEAGAYVRK 186

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           LRSILRY+G+CDGNMEEGSMRADVNVSV +PGE  GTR E KNVNS+RF+   IEYEA R
Sbjct: 187 LRSILRYVGSCDGNMEEGSMRADVNVSVRKPGEELGTRTETKNVNSVRFVMQVIEYEANR 246

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q+ +LE GG + QETRLFD +   TR++R+KEDA DYRYF +PDLLPL +++DF+   + 
Sbjct: 247 QVDVLESGGTVDQETRLFDVATGTTRTMRSKEDAHDYRYFPDPDLLPLVLEDDFLDECRA 306

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL------AVNRDKKI----VA 366
            +PELPDAKR R+  E G++ Y+A  L ++      FE L      A  +D+K     VA
Sbjct: 307 SLPELPDAKRTRYESELGLTPYNARELTAEVETFARFETLLTATAEATGKDEKTVATQVA 366

Query: 367 NWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK 426
           NW ++   GV+   G        +  +   ++ +   G ISG  AK+IF I+ ++G  P 
Sbjct: 367 NWALSVAPGVIKSLGDDANVEHATAERQAAILAMQDKGEISGGQAKEIFEIVLKEGREPA 426

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANP 485
           EI E  GL+QV+D  AIE  +D+++  N + V +    K  L  +FVGQ MK   GKANP
Sbjct: 427 EIAETEGLKQVSDTGAIEAAIDDILAKNEDKVEQYKGGKDKLFGFFVGQTMKAMKGKANP 486

Query: 486 SIVQKMLKEKLG 497
           ++V ++LK+KLG
Sbjct: 487 AVVNQILKDKLG 498


>gi|58584961|ref|YP_198534.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|75497655|sp|Q5GRT2|GATB_WOLTR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|58419277|gb|AAW71292.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 474

 Score =  518 bits (1334), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 259/482 (53%), Positives = 341/482 (70%), Gaps = 12/482 (2%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
           T GDWE VIG+EVHAQ+S  +KLFS +S  FGAE NTQVS  DAAMPG LPILN   ++Q
Sbjct: 2   TKGDWEAVIGLEVHAQVSSKTKLFSSSSTEFGAEHNTQVSLVDAAMPGTLPILNYYSIEQ 61

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           A+ TGL L+A INK S F RKNYFYPDLPQGYQI+Q  +PIV  G++ ++          
Sbjct: 62  AIRTGLALSAEINKSSYFDRKNYFYPDLPQGYQITQFFEPIVKNGRIFINNNKK------ 115

Query: 138 TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
             EV I RIHLEQDAGKSIH++  + + +DLNR+GVALMEIV++PD+RSS EA  F+ KL
Sbjct: 116 --EVRIARIHLEQDAGKSIHEE--SKTYVDLNRAGVALMEIVSEPDLRSSEEAAEFMKKL 171

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARR 256
           R ILRY+G+CDG+ME+GS+R D NVSV   G + +GTRCE+KN+NSI ++  AI+YE +R
Sbjct: 172 RQILRYIGSCDGDMEKGSLRCDANVSVRPKGSSTFGTRCEIKNLNSICYIMQAIDYEIQR 231

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI ILE G  I Q+T LFD S  +T+ +R KEDA DYRYF EPDLLP+EI +D I +I+ 
Sbjct: 232 QIEILESGEKISQDTLLFDVSLGKTKVMRNKEDASDYRYFPEPDLLPVEISQDKIDSIRS 291

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGV 376
            +PELPD K+ R+I E  I+ YDA V+ SDK+IA+YFE+L    D K+   W+  +L G 
Sbjct: 292 SLPELPDQKKLRYIRELSINKYDADVITSDKAIANYFEELIKKHDSKLAVTWLTVELFGR 351

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++G  I  +PI  N L EL+D I+DGTIS ++ K +F+I++E G     I++E  L+Q
Sbjct: 352 LNKAGIDIVSSPIKANALSELLDFIVDGTISARLGKQVFDIMFETGKPASLIIKEQDLKQ 411

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           +TD   I +++D++IN N + V      K  L  +FVG+VMK T GKA+P +V  +L EK
Sbjct: 412 ITDKGQISEIIDKIINDNQDKVQEYQNGKTKLYGFFVGEVMKLTKGKASPDVVNFILSEK 471

Query: 496 LG 497
           L 
Sbjct: 472 LS 473


>gi|77457062|ref|YP_346567.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           fluorescens Pf0-1]
 gi|109892050|sp|Q3KI28|GATB_PSEPF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|77381065|gb|ABA72578.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Pseudomonas fluorescens Pf0-1]
          Length = 481

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/482 (52%), Positives = 347/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QL+  SK+FSG+S  FG+EPNTQ S  D  MPG+LP+LN   V+ AVM 
Sbjct: 3   WEVVIGLEIHTQLTTRSKIFSGSSTQFGSEPNTQASLIDLGMPGVLPVLNQEAVRMAVMF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +++   + G  +   V
Sbjct: 63  GLAIDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDIAL---EDGTVK--RV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+++S  + IDLNR+G  L+EIV++PDMRS+ EA A++  + +++
Sbjct: 118 GITRAHLEEDAGKSLHEEFSGATGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+A +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQAEFGTRCEIKNVNSFRFIEKAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q+TRL+DP+K+ETR +R+KE+A DYRYF +PDLLP+ I++ F+  ++  +PE
Sbjct: 238 IEDGGKVIQQTRLYDPNKDETRPMRSKEEANDYRYFPDPDLLPVVIEDSFLNDVRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF   FG+S YDA+VL + +  ADYFEK+A +  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKRERFQSAFGLSAYDANVLATSREQADYFEKVASIGGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
               IED+P+S  QLG ++  I D TISGKIAK +F  +    G+  EI+E+ GL+QVTD
Sbjct: 358 QNLDIEDSPVSAEQLGGMLQRIKDNTISGKIAKVVFEAMANGEGSADEIIEKCGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNV-----ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AI  V+DE++ +N   V     A  A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 TGAISAVLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKS 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|330950290|gb|EGH50550.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae Cit 7]
          Length = 481

 Score =  517 bits (1331), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/482 (52%), Positives = 346/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV  
Sbjct: 3   WEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL +NA I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +   P + G  + I  
Sbjct: 63  GLAVNAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDI---PLEDGTVKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +I+
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHAIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+A +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQAEFGTRCEIKNVNSFRFIEKAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ F+   +  +PE
Sbjct: 238 IEDGGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFLEETRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  +FG+S YDASVL S +  ADYFE+ ++++ D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKRERFQSQFGLSTYDASVLASSREQADYFEQVVSISGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I+ +P+S  QLG ++  I D TISGKIAK +F  +    G+  EI+E+ GL+QVTD
Sbjct: 358 QGLEIDQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAMANGEGSADEIIEKRGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIE ++DEV+ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 SGAIESMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKT 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|304310261|ref|YP_003809859.1| Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase, subunit B [gamma
           proteobacterium HdN1]
 gi|301795994|emb|CBL44198.1| Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase, subunit B [gamma
           proteobacterium HdN1]
          Length = 482

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 258/485 (53%), Positives = 340/485 (70%), Gaps = 13/485 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE VIG+EVH QLS  SK+FSG+   FGAEPNTQ S  D  MPG LP+LN   + +AV 
Sbjct: 2   EWETVIGLEVHVQLSTRSKIFSGSDTTFGAEPNTQASLIDLGMPGTLPVLNAEAITKAVR 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GLG+ A I   SVF RKNYFYPDLP+GYQISQ  +PIVG+G + +S+   + G+ +TI 
Sbjct: 62  FGLGIQAEIGHTSVFDRKNYFYPDLPKGYQISQFSRPIVGKGSLEISL---EDGRKKTI- 117

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
            GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++P++RS+ EA A+L  L SI
Sbjct: 118 -GITRAHLEEDAGKSLHEDFRGMTGIDLNRAGTPLLEIVSEPEIRSAEEAVAYLKTLHSI 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSV-CRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +RYL   DGNM EGSMR DVN+S+  R  EA+GTR E+KNVNS RF+  AI++E  RQ  
Sbjct: 177 IRYLDISDGNMAEGSMRCDVNISLRPRGQEAFGTRAEIKNVNSFRFVEKAIQHEMERQAD 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           +LE GG + QETRL+D +KNETRS+R+KE+A DYRYF +PDLLP+ +  +FI  ++  +P
Sbjct: 237 LLESGGKVVQETRLYDANKNETRSMRSKEEANDYRYFPDPDLLPVVLTSEFIEQVRATLP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK--KIVANWVINDLLGVL 377
           ELP  K +RF  E+G+S YDA +L + + +ADYFE +  +     K+ ANWV  DLLG L
Sbjct: 297 ELPTQKIQRFQAEYGLSEYDARILAASRDLADYFESVTEHSGAGPKVSANWVSGDLLGAL 356

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N++   I+ +PIS  QL  L+  I D TISGKIAK IF ILW +GG    I+E  GL+Q 
Sbjct: 357 NKADLDIKQSPISALQLAALLKRIHDNTISGKIAKQIFEILWAEGGEVDAIIEAKGLKQE 416

Query: 438 TDLSAIEKVVDEVINSNPNNVAR-IATKPN----LVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIE +VD++I  NP+ VA+ +A   N    L+ +FVGQ+MK + GKANP IV  +L
Sbjct: 417 TDTGAIEAIVDQIIQGNPDQVAQYLAADENKRKKLIGFFVGQIMKASKGKANPQIVNDLL 476

Query: 493 KEKLG 497
             KLG
Sbjct: 477 GAKLG 481


>gi|330877213|gb|EGH11362.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
          Length = 481

 Score =  515 bits (1326), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/482 (52%), Positives = 345/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV  
Sbjct: 3   WEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +   P + G  +   V
Sbjct: 63  GLAVDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDI---PLEDGTVK--RV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +I+
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHAIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ FI   +  +PE
Sbjct: 238 IEDGGRVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFIEETRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  +FG+S YDASVL S +  ADYFEK ++++ D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKRERFQSQFGLSTYDASVLASSREQADYFEKVVSISGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I+ +P+S  QLG ++  I D TISGKIAK +F  +    G+  E++E+ GL+QVTD
Sbjct: 358 QGVEIDQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAMANGEGSADEVIEKRGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNV-----ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIE ++DEV+ +N   V     A  A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 SGAIESMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKA 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|255022181|ref|ZP_05294183.1| Aspartyl-tRNA(Asn)/Glutamyl-tRNA(Gln) amidotransferase subunit B
           [Acidithiobacillus caldus ATCC 51756]
 gi|254968363|gb|EET25923.1| Aspartyl-tRNA(Asn)/Glutamyl-tRNA(Gln) amidotransferase subunit B
           [Acidithiobacillus caldus ATCC 51756]
          Length = 477

 Score =  515 bits (1326), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 250/476 (52%), Positives = 336/476 (70%), Gaps = 6/476 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+EVH QL+  SK+F      +GAEPN        A+PG LP+LN   V +A+  
Sbjct: 3   WEVVIGLEVHVQLNTQSKIFCNCPTRYGAEPNRHTCPVCLALPGALPVLNAAAVDKAIAF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A I++ SVFARKNYFYPDLP+GYQISQ++ PIVG G++++++  D + +     V
Sbjct: 63  GLAVGAEIHQRSVFARKNYFYPDLPKGYQISQYEIPIVGRGQLALTLA-DGTEKI----V 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +SA + IDLNR+G  L+EIV++PDMRS  EA A+L KL +++
Sbjct: 118 GITRAHLEEDAGKSLHEAFSAETGIDLNRAGTPLLEIVSEPDMRSPAEAVAYLKKLHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           RYL   DGNM+EGS R D NVS+ RPGE +GTR E+KN+NS RFL  AIEYE  RQ  +L
Sbjct: 178 RYLDISDGNMQEGSFRCDANVSLRRPGEPFGTRAEIKNLNSFRFLEKAIEYEMERQQDLL 237

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E G  + QETRLFD +K ETRS+R+KE+A DYRYF +PDLLPL ++   I A++  +PEL
Sbjct: 238 ESGAEVVQETRLFDANKGETRSMRSKEEANDYRYFPDPDLLPLVLEPAQIEAVRASLPEL 297

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRSG 381
           PDA++ RF+ ++ +  YDA VL S +++ADY+E +A   D K+ ANW++ DLLG LNRS 
Sbjct: 298 PDARKRRFMEQYALPAYDAGVLTSSRALADYYEVVAEGVDAKLAANWIMGDLLGALNRSN 357

Query: 382 KSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLS 441
             IE  P+   Q+  L+  I D TISGKIAKD+F +L+EKG     I+E  GLRQ+TD+ 
Sbjct: 358 GEIESCPVPAEQMRRLLQRIEDQTISGKIAKDVFEVLFEKGEDVDTIIERKGLRQITDVE 417

Query: 442 AIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           AI K++D V+  NP  VA   + K  L  +FVGQVMK + GKANP  + ++L+E+L
Sbjct: 418 AITKLIDAVLAKNPGQVADYRSGKEKLFGFFVGQVMKASQGKANPEQLNRLLRERL 473


>gi|70728275|ref|YP_258024.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           fluorescens Pf-5]
 gi|109892049|sp|Q4KIA9|GATB_PSEF5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|68342574|gb|AAY90180.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Pseudomonas
           fluorescens Pf-5]
          Length = 481

 Score =  514 bits (1325), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/482 (52%), Positives = 346/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QL+  SK+FSG+S  FGAEPNTQ S  D  MPG+LP+LN   V+ AVM 
Sbjct: 3   WEVVIGLEIHTQLTTQSKIFSGSSTAFGAEPNTQASLIDLGMPGVLPVLNQEAVRMAVMF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +   P + G  +   V
Sbjct: 63  GLAVDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDI---PLEDGTMK--RV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H++++  + IDLNR+G  L+EIV++PDMRS+ EA A++  + +++
Sbjct: 118 GITRAHLEEDAGKSLHEEFNGATGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKSIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E RRQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIRRQIEL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q+TRL+DP+K+ETR +R+KE+A DYRYF +PDLLP+ I++ F+  ++  +PE
Sbjct: 238 IEDGGKVIQQTRLYDPNKDETRPMRSKEEANDYRYFPDPDLLPVVIEDSFLDQVRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  +FG+S+YDASVL + +  ADYFEK+A +  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKRERFQEQFGLSVYDASVLATSREQADYFEKVASIAGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I++ P+S  QLG ++  I D TISGKIAK +F  +    G   EI+++ GL+QVTD
Sbjct: 358 QGLEIDEAPVSAEQLGGMLLRIKDNTISGKIAKTVFEAMANGEGNADEIIDKRGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNV-----ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AI  V+DE++ +N   V     A  A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 SGAISAVLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKS 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|146281398|ref|YP_001171551.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           stutzeri A1501]
 gi|166198809|sp|A4VIA8|GATB_PSEU5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|145569603|gb|ABP78709.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas stutzeri
           A1501]
          Length = 481

 Score =  514 bits (1325), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 253/482 (52%), Positives = 344/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQLS  SK+FSG++  FGAEPNTQ S  D  MPG LP+LN   V+ A   
Sbjct: 3   WETVIGLEIHAQLSTQSKIFSGSATTFGAEPNTQASLVDLGMPGTLPVLNAEAVRMACKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I + +VFARKNYFYPDLP+GYQ SQ D PIVG+G + +++   + G  R I  
Sbjct: 63  GLAIDAEIAEKNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITL---EDGSTRRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RS+ EA A++  + +++
Sbjct: 118 GITRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVSV   G+A +GTR E+KNVNS RF+  AI +E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSVRPKGQAEFGTRAEIKNVNSFRFIEKAINHEVQRQIEL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP+K+ETRS+R+KE+A DYRYF  PDLLP+ I++ F+  ++  +PE
Sbjct: 238 IEDGGKVVQETRLYDPNKDETRSMRSKEEANDYRYFPCPDLLPVVIEQSFLDEVRASLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  EFG+S YDASVL + + +ADYFE++ A   D K+ ANWV+ +L  +LN+
Sbjct: 298 LPGQKRERFEREFGLSTYDASVLSASREMADYFEQVNATCGDAKLAANWVMGELSSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  IE +P++  QLG +I  I D TISGKIAK +F  +    G+  EI+E+ GL+QVTD
Sbjct: 358 EGLDIEQSPVTAEQLGGMILRIKDDTISGKIAKMVFEAMAAGEGSADEIIEKKGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIE ++DEV+ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK+
Sbjct: 418 SGAIEAMLDEVLAANAEQVEQYRASDEAKRGKMFGFFVGQAMKASKGKANPGQVNQLLKK 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|331016665|gb|EGH96721.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 481

 Score =  513 bits (1322), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 249/482 (51%), Positives = 345/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV  
Sbjct: 3   WEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +   P + G  +   V
Sbjct: 63  GLAVDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDI---PLEDGTVK--RV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +I+
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHAIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +E+GG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ FI   +  +PE
Sbjct: 238 IEEGGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFIEETRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  +FG+S YDASVL S +  ADYFEK ++++ D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKRERFQSQFGLSTYDASVLASSREQADYFEKVVSISGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I+ +P+S  QLG ++  I D TISGKIAK +F  +    G+  E++E+ GL+QVTD
Sbjct: 358 QGVEIDQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAMANGEGSADEVIEKRGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIE ++DEV+ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 SGAIESMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKA 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|330958035|gb|EGH58295.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. maculicola str. ES4326]
          Length = 481

 Score =  513 bits (1322), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 248/482 (51%), Positives = 345/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV  
Sbjct: 3   WEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +++   + G  + I  
Sbjct: 63  GLAVDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDITL---EDGTVKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +I+
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHAIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ F+   +  +PE
Sbjct: 238 IEDGGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFLEETRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  +FG+S YDASVL S +  ADYFEK ++++ D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKRERFQSQFGLSTYDASVLASSREQADYFEKVVSISGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  IE +P+S  QLG ++  I D TISGKIAK +F  +    G+  E++E+ GL+QVTD
Sbjct: 358 QGVEIEQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAMANGEGSADEVIEKRGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARIAT-----KPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIE ++DEV+ +N   V +        +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 SGAIESMLDEVLAANAEQVEQYRAADEIKRGKMFGFFVGQAMKASKGKANPQQVNELLKA 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|66047393|ref|YP_237234.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. syringae B728a]
 gi|289676048|ref|ZP_06496938.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. syringae FF5]
 gi|75500716|sp|Q4ZNS6|GATB_PSEU2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|63258100|gb|AAY39196.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Pseudomonas syringae
           pv. syringae B728a]
 gi|330895291|gb|EGH27629.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. japonica str. M301072PT]
 gi|330937961|gb|EGH41748.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. pisi str. 1704B]
 gi|330969666|gb|EGH69732.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. aceris str. M302273PT]
          Length = 481

 Score =  513 bits (1321), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 248/482 (51%), Positives = 345/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV  
Sbjct: 3   WEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL +NA I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +   P + G  + I  
Sbjct: 63  GLAVNAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDI---PLEDGTVKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMR++ EA A++  + +I+
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRNAKEAVAYVKAIHAIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ F+   +  +PE
Sbjct: 238 IEDGGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFLEETRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  +FG+S YDASVL S +  ADYFE+ ++++ D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKRERFQSQFGLSTYDASVLASSREQADYFEQVVSISGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I+ +P+S  QLG ++  I D TISGKIAK +F  +    G+  E++E+ GL+QVTD
Sbjct: 358 QGLEIDQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAMANGEGSADEVIEKRGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIE ++DEV+ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 SGAIESMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKA 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|146305888|ref|YP_001186353.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           mendocina ymp]
 gi|166198807|sp|A4XQK5|GATB_PSEMY RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|145574089|gb|ABP83621.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Pseudomonas mendocina ymp]
          Length = 481

 Score =  513 bits (1321), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 252/482 (52%), Positives = 343/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQLS  SK+FS ++ +FGAEPNTQ S  D  MPG LP+LN   V+ AV  
Sbjct: 3   WETVIGLEIHAQLSTQSKIFSASATSFGAEPNTQASLIDLGMPGTLPVLNAEAVRMAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++AHI   +VFARKNYFYPDLP+GYQ SQ D PIVG+G + +++   + G  + I  
Sbjct: 63  GLAIDAHIAPQNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITL---EDGTVKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RS+ EA A++  + +++
Sbjct: 118 GITRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVSV   G EA+GTR E+KNVNS RF+  AI +E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSVRPKGQEAFGTRAEIKNVNSFRFIEKAINHEIQRQIEL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP+K+ETRS+R KE+A DYRYF  PDLLP+ I++ F+  ++ Q+PE
Sbjct: 238 IEDGGKVIQETRLYDPNKDETRSMRGKEEANDYRYFPCPDLLPVVIEQSFLDEVRSQLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  ++G+S YDASVL + + +A+YFE++A V  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPTQKRERFQSQYGLSTYDASVLSASREMAEYFEEVAKVCGDAKLAANWVMGELSSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  IE +P+S   LG +I  I D TISGKIAK +F  +    G+   I+E  GL+QVTD
Sbjct: 358 EGLEIEQSPVSAEHLGGMILRIKDNTISGKIAKMVFEAMAAGEGSADAIIESKGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIE ++DEV+ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK+
Sbjct: 418 SGAIEAMLDEVLAANAEQVEQYRASDEAKRGKMFGFFVGQAMKASKGKANPGQVNELLKK 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|302185334|ref|ZP_07262007.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. syringae 642]
          Length = 481

 Score =  512 bits (1319), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 248/482 (51%), Positives = 346/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV  
Sbjct: 3   WEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL +NA I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +   P + G  + I  
Sbjct: 63  GLAVNAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDI---PLEDGTVKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMR++ EA A++  + +I+
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRNAKEAVAYVKAIHAIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ F+   +  +PE
Sbjct: 238 IEDGGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFLDETRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  +FG+S YDASVL S +  ADYFE+ ++++ D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKRERFQSQFGLSTYDASVLASSREQADYFEQVVSISGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I+++P+S  QLG ++  IID TISGKIAK +F  +    G+  E++E+ GL+QVTD
Sbjct: 358 QGLEIDESPVSAEQLGGMLKRIIDNTISGKIAKMVFEAMANGEGSADEVIEKRGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIE ++DE++ +N   V +      A +  +  +FVGQ MK + GKANP  V  +LK 
Sbjct: 418 SGAIESMLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNALLKA 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|28871610|ref|NP_794229.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|47115776|sp|Q87WR8|GATB_PSESM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|28854862|gb|AAO57924.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Pseudomonas
           syringae pv. tomato str. DC3000]
          Length = 481

 Score =  512 bits (1319), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 249/482 (51%), Positives = 344/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ    D  MPG+LP+LN   V+ AV  
Sbjct: 3   WEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQACLVDLGMPGVLPVLNKEAVRMAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +   P + G  +   V
Sbjct: 63  GLAVDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDI---PLEDGTVK--RV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +I+
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHAIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ FI   +  +PE
Sbjct: 238 IEDGGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFIEETRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  +FG+S YDASVL S +  ADYFEK ++++ D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKRERFQSQFGLSTYDASVLASSREQADYFEKVVSISGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I+ +P+S  QLG ++  I D TISGKIAK +F  +    G+  E++E+ GL+QVTD
Sbjct: 358 QGVEIDQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAMANGEGSADEVIEKRGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIE ++DEV+ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 SGAIESMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKA 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|330963988|gb|EGH64248.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. actinidiae str. M302091]
          Length = 487

 Score =  512 bits (1319), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 253/488 (51%), Positives = 346/488 (70%), Gaps = 18/488 (3%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV  
Sbjct: 3   WEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +   P + G  +   V
Sbjct: 63  GLAVDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDI---PLEDGTVK--RV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +I+
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHAIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ FI   +  +PE
Sbjct: 238 IEDGGRVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFIEETRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  +FG+S YDASVL S +  ADYFEK ++++ D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKRERFQSQFGLSTYDASVLASSREQADYFEKVVSISGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK------GGTPKEIVEELG 433
            G  I+D+P+S  QLG ++  I D TISGKIAK +F  + +        G+  EI+E  G
Sbjct: 358 HGIEIKDSPVSAEQLGGMLKRITDNTISGKIAKTVFEAIADSEAVAIGEGSADEIIERRG 417

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNV-----ARIATKPNLVSWFVGQVMKNTGGKANPSIV 488
           L+QVTD  AIE ++DEV+ +N   V     A  A +  +  +FVGQ MK + GKANP  V
Sbjct: 418 LKQVTDSGAIESMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQV 477

Query: 489 QKMLKEKL 496
            ++LK KL
Sbjct: 478 NELLKAKL 485


>gi|239502366|ref|ZP_04661676.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           baumannii AB900]
          Length = 489

 Score =  512 bits (1318), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 251/482 (52%), Positives = 343/482 (71%), Gaps = 11/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+LN + V+ A+  
Sbjct: 13  WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPVLNEKVVELAIRF 72

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G   T  +
Sbjct: 73  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGT--TKRI 127

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 128 GVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKAIHTLV 187

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 188 RWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 247

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I ++ I AIK  +PEL
Sbjct: 248 EWGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIPDEQIEAIKATMPEL 307

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN----RDKKIVANWVINDLLGVL 377
           P A+R RFI +FG++ YDA VL   + +AD++E +       +  KI ANWV+ +  G L
Sbjct: 308 PAARRARFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGVKQGKIAANWVMGEFSGAL 367

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLRQ 436
           N++G  + D+P+S  QLG +I  I+D TISGKIAK +F  +WE +G +  +I+ E GL+Q
Sbjct: 368 NKAGLELTDSPVSAEQLGGMIARIVDNTISGKIAKQVFGFMWESEGKSADDIIAEKGLKQ 427

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
            TD  AIE ++ EV+ +N   V    + K    +  VGQVMK + GKANP+ V +++K+ 
Sbjct: 428 ETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKANPAQVNELMKKL 487

Query: 496 LG 497
           +G
Sbjct: 488 IG 489


>gi|107099931|ref|ZP_01363849.1| hypothetical protein PaerPA_01000952 [Pseudomonas aeruginosa PACS2]
 gi|116052516|ref|YP_792829.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|313107071|ref|ZP_07793272.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           39016]
 gi|122257477|sp|Q02GV7|GATB_PSEAB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|115587737|gb|ABJ13752.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|310879774|gb|EFQ38368.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           39016]
          Length = 481

 Score =  512 bits (1318), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 251/482 (52%), Positives = 347/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQL+  SK+FSG+S  FGA PNTQ S  D AMPG LP+LN   V+ A + 
Sbjct: 3   WETVIGLEIHAQLATQSKIFSGSSTAFGAAPNTQASLVDLAMPGTLPVLNEEAVRMACLF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I++ +VFARKNYFYPDLP+GYQ SQ D PIVG+G + +++   + G   T  +
Sbjct: 63  GLAIDARIDRQNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITL---EDGT--TKRI 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RS+ EA A++  + +++
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVSV   G+A +GTR E+KNVNS RF+  AI +E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSVRPKGQAEFGTRAEIKNVNSFRFIEKAINHEIQRQIEL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP+K+ETRS+R KE+A DYRYF  PDLLP+ I+ +++  +++Q+PE
Sbjct: 238 IEDGGKVVQETRLYDPNKDETRSMRGKEEANDYRYFPCPDLLPVVIEPEYLAKLREQLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  ++G+S YDASVL + + +ADYFEK+  +  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPVQKRERFESQYGLSAYDASVLSASREMADYFEKVQGICGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  IE +P+S  QLG +I  I D TISGKIAK +F  +    G+  +I+E  GL+QVTD
Sbjct: 358 DGLEIEQSPVSAEQLGGMILRIKDNTISGKIAKMVFEAMANGEGSADQIIEAKGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIEK++DEV+ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK+
Sbjct: 418 SGAIEKMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKK 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|254238855|ref|ZP_04932178.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           C3719]
 gi|126170786|gb|EAZ56297.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           C3719]
          Length = 481

 Score =  511 bits (1317), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 250/482 (51%), Positives = 346/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQL+  SK+FSG+S  FGA PNTQ S  D AMPG LP+LN   V+ A + 
Sbjct: 3   WETVIGLEIHAQLATQSKIFSGSSTAFGAAPNTQASLVDLAMPGTLPVLNEEAVRMACLF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I++ +VFARKNYFYPDLP+GYQ SQ D PIVG+G + +++    S +     +
Sbjct: 63  GLAIDARIDRQNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITLEDGTSKR-----I 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RS+ EA A++  + +++
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVSV   G+A +GTR E+KNVNS RF+  AI +E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSVRPKGQAEFGTRAEIKNVNSFRFIEKAINHEIQRQIEL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP+K+ETRS+R KE+A DYRYF  PDLLP+ I+ +++  +++Q+PE
Sbjct: 238 IEDGGKVVQETRLYDPNKDETRSMRGKEEANDYRYFPCPDLLPVVIEPEYLAKLREQLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  ++G+S YDASVL + + +ADYFEK+  +  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPVQKRERFESQYGLSAYDASVLSASREMADYFEKVQGICGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  IE +P+S  QLG +I  I D TISGKIAK +F  +    G+  +I+E  GL+QVTD
Sbjct: 358 DGLEIEQSPVSAEQLGGMILRIKDNTISGKIAKMVFEAMANGEGSADQIIEAKGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIEK++DEV+ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK+
Sbjct: 418 SGAIEKMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKK 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|71736850|ref|YP_276297.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|257482246|ref|ZP_05636287.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. tabaci ATCC 11528]
 gi|289627547|ref|ZP_06460501.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|289646975|ref|ZP_06478318.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. aesculi str. 2250]
 gi|298488470|ref|ZP_07006501.1| Aspartyl-tRNA(Asn) amidotransferase subunit B; Glutamyl-tRNA(Gln)
           amidotransferase subunit B [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|109892048|sp|Q48E91|GATB_PSE14 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|71557403|gb|AAZ36614.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|298157095|gb|EFH98184.1| Aspartyl-tRNA(Asn) amidotransferase subunit B; Glutamyl-tRNA(Gln)
           amidotransferase subunit B [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320330017|gb|EFW86004.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330868260|gb|EGH02969.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. aesculi str. 0893_23]
 gi|330875178|gb|EGH09327.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330987070|gb|EGH85173.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. lachrymans str. M301315]
 gi|331011513|gb|EGH91569.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 481

 Score =  511 bits (1317), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 246/482 (51%), Positives = 346/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV  
Sbjct: 3   WEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +++   + G  + I  
Sbjct: 63  GLAVDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDITL---EDGTVKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +I+
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHAIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ F+   +  +PE
Sbjct: 238 IEDGGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFLEETRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  +FG+S YDASVL S +  ADYFE+ ++++ D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKRERFQSQFGLSTYDASVLASSREQADYFEQVVSISGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  IE +P+S  QLG ++  I D TISGKIAK +F  +    G+  E++++ GL+QVTD
Sbjct: 358 QGLEIEQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAMANGEGSADEVIDKRGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIE ++DE++ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 SGAIESMLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKA 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|184159355|ref|YP_001847694.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           baumannii ACICU]
 gi|332874204|ref|ZP_08442126.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Acinetobacter baumannii 6014059]
 gi|183210949|gb|ACC58347.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit [Acinetobacter
           baumannii ACICU]
 gi|322509267|gb|ADX04721.1| gatB [Acinetobacter baumannii 1656-2]
 gi|323519295|gb|ADX93676.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           baumannii TCDC-AB0715]
 gi|332737563|gb|EGJ68468.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Acinetobacter baumannii 6014059]
          Length = 489

 Score =  511 bits (1317), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 252/482 (52%), Positives = 342/482 (70%), Gaps = 11/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+LN + V+ A+  
Sbjct: 13  WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPVLNEKVVELAIRF 72

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G   T  +
Sbjct: 73  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGT--TKRI 127

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 128 GVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKAIHTLV 187

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 188 RWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 247

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I ++ I AIK  +PEL
Sbjct: 248 EWGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIPDEQIEAIKATMPEL 307

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKIVANWVINDLLGVL 377
           P A+R RFI +FG++ YDA VL   + +AD++E         +  KI ANWV+ +  G L
Sbjct: 308 PAARRARFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKIAANWVMGEFSGAL 367

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLRQ 436
           N++G  + D+P+S  QLG +I  IID TISGKIAK +F  +WE +G +  +I+ E GL+Q
Sbjct: 368 NKAGLELTDSPVSAEQLGGMIARIIDNTISGKIAKQVFGFMWESEGKSADDIIAEKGLKQ 427

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
            TD  AIE ++ EV+ +N   V    + K    +  VGQVMK + GKANP+ V +++K+ 
Sbjct: 428 ETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKANPAQVNELMKKL 487

Query: 496 LG 497
           +G
Sbjct: 488 IG 489


>gi|327479576|gb|AEA82886.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           stutzeri DSM 4166]
          Length = 481

 Score =  511 bits (1317), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 252/482 (52%), Positives = 343/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQLS  SK+FSG++  FGAEPNTQ S  D  MPG LP+LN   V+ A   
Sbjct: 3   WETVIGLEIHAQLSTQSKIFSGSATTFGAEPNTQASLVDLGMPGTLPVLNAEAVRMACKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I + +VFARKNYFYPDLP+GYQ SQ D PIVG+G + +++   + G  R I  
Sbjct: 63  GLAIDAEIAEKNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITL---EDGSTRRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RS+ EA A++  + +++
Sbjct: 118 GITRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVSV   G+A +GTR E+KNVNS RF+  AI +E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSVRPKGQAEFGTRAEIKNVNSFRFIEKAINHEVQRQIEL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP+K+ETRS+R+KE+A DYRYF  PDLLP+ I++ F+  ++  +PE
Sbjct: 238 IEDGGKVVQETRLYDPNKDETRSMRSKEEANDYRYFPCPDLLPVVIEQSFLDEVRASLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  EFG+S YDASVL + + +ADYFE++ A   D K+ ANWV+ +L  +LN+
Sbjct: 298 LPGQKRERFEREFGLSTYDASVLSASREMADYFEQVNATCGDAKLAANWVMGELSSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  IE +P++  QLG +I  I D TISGKIAK +F  +    G+  EI+E+  L+QVTD
Sbjct: 358 EGLDIEQSPVTAEQLGGMILRIKDDTISGKIAKMVFEAMAAGEGSADEIIEKKCLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIE ++DEV+ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK+
Sbjct: 418 SGAIEAMLDEVLAANAEQVEQYRASDEAKRGKMFGFFVGQAMKASKGKANPGQVNQLLKK 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|237798578|ref|ZP_04587039.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|331021431|gb|EGI01488.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. oryzae str. 1_6]
          Length = 481

 Score =  511 bits (1316), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 248/482 (51%), Positives = 346/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV  
Sbjct: 3   WEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +++   + G  +   V
Sbjct: 63  GLAVDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDITL---EDGTVK--RV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +I+
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHAIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPRGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ FI   +  +PE
Sbjct: 238 IEDGGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFIEETRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  +FG+S YDASVL S +  ADYFEK ++++ D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKRERFQSQFGLSTYDASVLASSREQADYFEKVVSISGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I+ +P+S  QLG ++  I D TISGKIAK +F  +    G+  E++E+ GL+QVTD
Sbjct: 358 QGVEIDQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAMANGEGSADEVIEKRGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNV-----ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AI+ ++D+V+ +N   V     A  A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 SGAIKSMLDDVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKA 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|260548908|ref|ZP_05823130.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter sp. RUH2624]
 gi|260408076|gb|EEX01547.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter sp. RUH2624]
          Length = 489

 Score =  511 bits (1316), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 251/482 (52%), Positives = 342/482 (70%), Gaps = 11/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+LN + V  A+  
Sbjct: 13  WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPVLNEKVVDLAIRF 72

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G   T  +
Sbjct: 73  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGT--TKRI 127

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 128 GVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKAIHTLV 187

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 188 RWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 247

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I ++ I AIK  +PEL
Sbjct: 248 EWGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIPDEQIEAIKATMPEL 307

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV----NRDKKIVANWVINDLLGVL 377
           P A+R RFI +FG++ YDA VL   + +AD++E +       +  KI ANWV+ +  G L
Sbjct: 308 PAARRARFIADFGVTEYDAHVLTLSREMADFYEDVVAAAGGAKQGKIAANWVMGEFSGAL 367

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLRQ 436
           N++G  + D+P+S  QLG +I  I+D TISGKIAK +F  +WE +G +  +I+ E GL+Q
Sbjct: 368 NKAGLELTDSPVSAEQLGGMIARIVDNTISGKIAKQVFGFMWESEGKSADDIIAEKGLKQ 427

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
            TD  AIE ++ EV+ +N   V    + K    +  VGQVMK + GKANP+ V +++K+ 
Sbjct: 428 ETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKANPAQVNELMKKL 487

Query: 496 LG 497
           +G
Sbjct: 488 IG 489


>gi|296391194|ref|ZP_06880669.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           aeruginosa PAb1]
          Length = 481

 Score =  511 bits (1316), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 251/482 (52%), Positives = 347/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQL+  SK+FSG+S  FGA PNTQ S  D AMPG LP+LN   V+ A + 
Sbjct: 3   WETVIGLEIHAQLATQSKIFSGSSTAFGAAPNTQASLVDLAMPGTLPVLNEEAVRMACLF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I++ +VFARKNYFYPDLP+GYQ SQ D PIVG+G + +++   + G   T  +
Sbjct: 63  GLAIDARIDRQNVFARKNYFYPDLPKGYQTSQMDHPIVGKGYLDITL---EDGT--TKRI 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RS+ EA A++  + +++
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVSV   G+A +GTR E+KNVNS RF+  AI +E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSVRPKGQAEFGTRAEIKNVNSFRFIEKAINHEIQRQIEL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP+K+ETRS+R KE+A DYRYF  PDLLP+ I+ +++  +++Q+PE
Sbjct: 238 IEDGGKVVQETRLYDPNKDETRSMRGKEEANDYRYFPCPDLLPVVIEPEYLAKLREQLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  ++G+S YDASVL + + +ADYFEK+  +  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPVQKRERFESQYGLSAYDASVLSASREMADYFEKVQGICGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  IE +P+S  QLG +I  I D TISGKIAK +F  +    G+  +I+E  GL+QVTD
Sbjct: 358 DGLEIEQSPVSAEQLGGMILRIKDNTISGKIAKMVFEAMANGEGSADQIIEAKGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIEK++DEV+ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK+
Sbjct: 418 SGAIEKMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKK 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|330807532|ref|YP_004351994.1| Amidase, (aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase),
           subunit B [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375640|gb|AEA66990.1| Amidase, (aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase),
           subunit B [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 481

 Score =  511 bits (1316), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 246/482 (51%), Positives = 346/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QL+  SK+FSG+S  FG+EPNTQ S  D  MPG+LP+LN   V+ AVM 
Sbjct: 3   WEVVIGLEIHTQLTTRSKIFSGSSTTFGSEPNTQASLVDLGMPGVLPVLNAEAVRMAVMF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +++   + G  +   V
Sbjct: 63  GLAIDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDIAL---EDGTVK--RV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H++++  + IDLNR+G  L+EIV++PDMRS+ EA A++  + +++
Sbjct: 118 GITRAHLEEDAGKSLHEEFNGATGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQIEL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q+TRL+DP+K+ETR +R+KE+A DYRYF +PDLLP+ I+  F+  ++  +PE
Sbjct: 238 IEDGGKVIQQTRLYDPNKDETRPMRSKEEANDYRYFPDPDLLPVVIENSFLDEVRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  +FG+S YDA+VL + +  ADYFEK +++  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKRERFQAQFGLSSYDANVLATSREQADYFEKVVSIGGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I+ +P+S  QLG ++  I D TISGKIAK +F  +    G+  EI+E+ GL+QVTD
Sbjct: 358 QGLEIDQSPVSAEQLGGMLVRIKDNTISGKIAKMVFEAMANGEGSADEIIEKRGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AI  V+DE++ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 TGAISAVLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKS 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|169794870|ref|YP_001712663.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           baumannii AYE]
 gi|213157803|ref|YP_002320601.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Acinetobacter
           baumannii AB0057]
 gi|215482418|ref|YP_002324600.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Acinetobacter baumannii AB307-0294]
 gi|260557236|ref|ZP_05829452.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter baumannii ATCC 19606]
 gi|301344938|ref|ZP_07225679.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           baumannii AB056]
 gi|301594360|ref|ZP_07239368.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           baumannii AB059]
 gi|169147797|emb|CAM85660.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter baumannii AYE]
 gi|213056963|gb|ACJ41865.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Acinetobacter
           baumannii AB0057]
 gi|213986020|gb|ACJ56319.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Acinetobacter baumannii AB307-0294]
 gi|260409342|gb|EEX02644.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter baumannii ATCC 19606]
          Length = 489

 Score =  511 bits (1316), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 251/482 (52%), Positives = 342/482 (70%), Gaps = 11/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+LN + V+ A+  
Sbjct: 13  WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPVLNEKVVELAIRF 72

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G   T  +
Sbjct: 73  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGT--TKRI 127

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 128 GVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKAIHTLV 187

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 188 RWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 247

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I ++ I AIK  +PEL
Sbjct: 248 EWGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIPDEQIEAIKATMPEL 307

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKIVANWVINDLLGVL 377
           P A+R RFI +FG++ YDA VL   + +AD++E         +  KI ANWV+ +  G L
Sbjct: 308 PAARRARFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKIAANWVMGEFSGAL 367

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLRQ 436
           N++G  + D+P+S  QLG +I  I+D TISGKIAK +F  +WE +G +  +I+ E GL+Q
Sbjct: 368 NKAGLELTDSPVSAEQLGGMIARIVDNTISGKIAKQVFGFMWESEGKSADDIIAEKGLKQ 427

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
            TD  AIE ++ EV+ +N   V    + K    +  VGQVMK + GKANP+ V +++K+ 
Sbjct: 428 ETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKANPAQVNELMKKL 487

Query: 496 LG 497
           +G
Sbjct: 488 IG 489


>gi|15599680|ref|NP_253174.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           aeruginosa PAO1]
 gi|218893576|ref|YP_002442445.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           aeruginosa LESB58]
 gi|254244703|ref|ZP_04938025.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           2192]
 gi|24418437|sp|Q9HVT7|GATB_PSEAE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|226709606|sp|B7V024|GATB_PSEA8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|9950722|gb|AAG07872.1|AE004862_6 Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           PAO1]
 gi|126198081|gb|EAZ62144.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           2192]
 gi|218773804|emb|CAW29618.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           LESB58]
          Length = 481

 Score =  511 bits (1315), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 250/482 (51%), Positives = 347/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQL+  SK+FSG+S  FGA PNTQ S  D AMPG LP+LN   V+ A + 
Sbjct: 3   WETVIGLEIHAQLATQSKIFSGSSTAFGAAPNTQASLVDLAMPGTLPVLNEEAVRMACLF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I++ +VFARKNYFYPDLP+GYQ SQ D PIVG+G + +++   + G   T  +
Sbjct: 63  GLAIDARIDRQNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITL---EDGT--TKRI 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RS+ EA A++  + +++
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVSV   G+A +GTR E+KNVNS RF+  AI +E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSVRPKGQAEFGTRAEIKNVNSFRFIEKAINHEIQRQIEL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP+K+ETRS+R KE+A DYRYF  PDLLP+ I+ +++  +++Q+PE
Sbjct: 238 IEDGGKVVQETRLYDPNKDETRSMRGKEEANDYRYFPCPDLLPVVIEPEYLAKLREQLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  ++G+S YDASVL + + +ADYFEK+  +  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPVQKRERFESQYGLSAYDASVLSASREMADYFEKVQGICGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  IE +P+S  QLG +I  I D TISGK+AK +F  +    G+  +I+E  GL+QVTD
Sbjct: 358 DGLEIEQSPVSAEQLGGMILRIKDNTISGKLAKMVFEAMANGEGSADQIIEAKGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIEK++DEV+ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK+
Sbjct: 418 SGAIEKMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKK 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|114319328|ref|YP_741011.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|122312679|sp|Q0ACB6|GATB_ALHEH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|114225722|gb|ABI55521.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 478

 Score =  511 bits (1315), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 246/480 (51%), Positives = 339/480 (70%), Gaps = 9/480 (1%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE VIG+E+HAQL+  SK+FSGA+  +GAEPN Q    D  MPG+LP+LN   V+ A  
Sbjct: 2   EWETVIGLEIHAQLATKSKIFSGAATAYGAEPNRQACAVDLGMPGVLPVLNKGAVRMATK 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL + A I   SVFARKNYFYPDLP+GYQISQ++ PIV  G++ + +   + G+ + I 
Sbjct: 62  FGLAIGAKIAPRSVFARKNYFYPDLPKGYQISQYELPIVEGGELWIEL---EDGERKRI- 117

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
            G+ R HLE+DAGKS+H+ +  ++ +DLNR+G  L+EIV++PD+RS+ EA A++ KL ++
Sbjct: 118 -GVTRAHLEEDAGKSLHEDFHGMTGVDLNRAGTPLLEIVSEPDLRSAAEAAAYMKKLHAL 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGE-AWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +RYL  CDGNM+EGS R D NVSV   GE  +GTR E+KN+NS RF+  AI YE  RQIA
Sbjct: 177 VRYLEICDGNMQEGSFRCDANVSVRPKGEEKFGTRAELKNLNSFRFVERAINYEVERQIA 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++E GG + QETRL+D  K ETRS+RTKE+A DYRYF +PDLLP+E+D  FI  +++ +P
Sbjct: 237 LIESGGTVVQETRLYDADKGETRSMRTKEEANDYRYFPDPDLLPVELDPTFIEEVRETLP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRD--KKIVANWVINDLLGVL 377
           ELPD KR RF+ E+G+S YDA VL + + +A+++E +        K  ANWV  D LG L
Sbjct: 297 ELPDEKRARFVEEYGLSDYDAGVLTATRELAEFYESVVTESGGFAKRSANWVQGDFLGAL 356

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N++G  + D+P++P  LG L+  I D TISG++AK++F  +W   G P +I+E  GL+QV
Sbjct: 357 NKAGLELADSPVTPEMLGRLVARIEDETISGRVAKEVFEAMWNGEGEPDQIIEAKGLKQV 416

Query: 438 TDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           TD  AIE ++DEV+ +NP  V +    K  L+ +FVGQVMK + GKANP  V ++LKEKL
Sbjct: 417 TDTGAIEAMIDEVLAANPKQVEQYKGGKDKLLGFFVGQVMKASRGKANPGQVNELLKEKL 476


>gi|89093931|ref|ZP_01166876.1| Glu-tRNA(Gln) amidotransferase subunit B [Oceanospirillum sp.
           MED92]
 gi|89081817|gb|EAR61044.1| Glu-tRNA(Gln) amidotransferase subunit B [Oceanospirillum sp.
           MED92]
          Length = 483

 Score =  511 bits (1315), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 256/485 (52%), Positives = 347/485 (71%), Gaps = 16/485 (3%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE VIG+E+HAQL+  SK+FSGAS  FGAEPNTQ    D A+PG LP+ N   ++ AV 
Sbjct: 2   EWEAVIGLEIHAQLATKSKIFSGASTAFGAEPNTQACAVDLALPGTLPVFNEEALRMAVK 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI--GPDKSGQFRT 138
            GL ++A I + SVF RKNYFYPDLP+GYQ SQ   PIVG G + +++  G +K      
Sbjct: 62  FGLAVDAEIGRKSVFDRKNYFYPDLPKGYQTSQLFHPIVGVGHIDITLEDGTEK------ 115

Query: 139 IEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
             +G+ R HLE+DAGKS+HD++  +S IDLNR+G  L+EIV++PDMRS+ EA A++ K+ 
Sbjct: 116 -RIGVTRAHLEEDAGKSVHDEFPGMSGIDLNRAGTPLLEIVSEPDMRSAEEAVAYVRKIH 174

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           SI+  LG CDGNM EGS R D NVSV   GE  +GTR E KN+NS RF+  AI  E  RQ
Sbjct: 175 SIVTSLGICDGNMAEGSFRCDCNVSVRLKGEEEFGTRTETKNINSFRFIEKAITGEIERQ 234

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I +LEDGG + QETRL+D  K+ETRS+R+KE+A DYRYF  PDLLP+ ID+ +I A++  
Sbjct: 235 IDLLEDGGRVVQETRLYDADKDETRSMRSKEEANDYRYFPCPDLLPIVIDDTYIDAVRGS 294

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGV 376
           +PELPDA++ RFI E+ +S YDA VL  D+++A+YFE +A  ++D K+ ANWV+ +L  +
Sbjct: 295 LPELPDARKARFIEEYKLSDYDAMVLSGDRTLAEYFETVAKASKDAKLAANWVMGELSKM 354

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++   I D+P+S  QLG L++ I D TISGKIAK +F ++W++GG+  EI+E  GL+Q
Sbjct: 355 LNQNDTIIADSPVSAEQLGGLLERIKDNTISGKIAKQVFEVMWKEGGSADEIIEAKGLKQ 414

Query: 437 VTDLSAIEKVVDEVI-NSNPNNVARIATKPN----LVSWFVGQVMKNTGGKANPSIVQKM 491
           VTD  AIEK+VD+VI NS+      I  +P+    ++ +F+GQVMK + GKANP  VQ +
Sbjct: 415 VTDSGAIEKIVDDVIANSSAQVEQYINAEPDKRGKMIGFFMGQVMKASQGKANPGQVQGV 474

Query: 492 LKEKL 496
           LK+KL
Sbjct: 475 LKKKL 479


>gi|169632545|ref|YP_001706281.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           baumannii SDF]
 gi|169151337|emb|CAP00053.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter baumannii]
          Length = 489

 Score =  511 bits (1315), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 251/482 (52%), Positives = 342/482 (70%), Gaps = 11/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+LN + V+ A+  
Sbjct: 13  WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPVLNEKVVELAIRF 72

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G   T  +
Sbjct: 73  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGT--TKRI 127

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 128 GVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAIAYIKAIHTLV 187

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 188 RWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 247

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I ++ I AIK  +PEL
Sbjct: 248 EWGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIPDEQIEAIKATMPEL 307

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKIVANWVINDLLGVL 377
           P A+R RFI +FG++ YDA VL   + +AD++E         +  KI ANWV+ +  G L
Sbjct: 308 PAARRARFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKIAANWVMGEFSGAL 367

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLRQ 436
           N++G  + D+P+S  QLG +I  I+D TISGKIAK +F  +WE +G +  +I+ E GL+Q
Sbjct: 368 NKAGLELTDSPVSAEQLGGMIARIVDNTISGKIAKQVFGFMWESEGKSADDIIAEKGLKQ 427

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
            TD  AIE ++ EV+ +N   V    + K    +  VGQVMK + GKANP+ V +++K+ 
Sbjct: 428 ETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKANPAQVNELMKKL 487

Query: 496 LG 497
           +G
Sbjct: 488 IG 489


>gi|320322514|gb|EFW78607.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. glycinea str. B076]
          Length = 481

 Score =  510 bits (1314), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 246/482 (51%), Positives = 345/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV  
Sbjct: 3   WEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I + +VFARKNYFYPDLP+GYQISQ + PIVG+G + +++   + G  + I  
Sbjct: 63  GLAVDAEIGQQNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDITL---EDGTVKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +I+
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHAIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ F+   +  +PE
Sbjct: 238 IEDGGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFLEETRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  +FG+S YDASVL S +  ADYFE+ ++++ D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKRERFQSQFGLSTYDASVLASSREQADYFEQVVSISGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  IE +P+S  QLG ++  I D TISGKIAK +F  +    G+  E++++ GL+QVTD
Sbjct: 358 QGLEIEQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAMANGEGSADEVIDKRGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIE ++DE++ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 SGAIESMLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKA 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|152989653|ref|YP_001350434.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           aeruginosa PA7]
 gi|166198805|sp|A6VBJ9|GATB_PSEA7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|150964811|gb|ABR86836.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           PA7]
          Length = 481

 Score =  510 bits (1314), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 251/482 (52%), Positives = 346/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQL+  SK+FSG+   FGA PNTQ S  D AMPG LP+LN   V+ A + 
Sbjct: 3   WETVIGLEIHAQLATQSKIFSGSPTAFGAAPNTQASLVDLAMPGTLPVLNEEAVRMACLF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I++ +VFARKNYFYPDLP+GYQ SQ D PIVG+G + +++   + G  R I  
Sbjct: 63  GLAIDARIDRQNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITL---EDGTTRRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RS+ EA A++  + +++
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVSV   G+A +GTR E+KNVNS RF+  AI +E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSVRPKGQAEFGTRAEIKNVNSFRFIEKAINHEIQRQIEL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP+K+ETRS+R KE+A DYRYF  PDLLP+ I+ +++  +++Q+PE
Sbjct: 238 IEDGGKVVQETRLYDPNKDETRSMRGKEEANDYRYFPCPDLLPVIIEPEYLAKLREQLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  ++G+S YDASVL + + +ADYFEK+  +  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPVQKRERFESQYGLSAYDASVLSASREMADYFEKVQEICGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  IE +P+S  QLG +I  I D TISGKIAK +F  +    G+  +I+E  GL+QVTD
Sbjct: 358 DGLEIEQSPVSAEQLGGMILRIKDNTISGKIAKMVFEAMANGEGSADQIIEAKGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIEK++DEV+ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK+
Sbjct: 418 SGAIEKMLDEVLTANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKK 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|193078236|gb|ABO13196.2| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter baumannii ATCC 17978]
          Length = 489

 Score =  510 bits (1313), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 250/482 (51%), Positives = 342/482 (70%), Gaps = 11/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+LN + V+ A+  
Sbjct: 13  WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPVLNEKVVELAIRF 72

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G   T  +
Sbjct: 73  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGT--TKRI 127

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 128 GVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKAIHTLV 187

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 188 RWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 247

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I ++ I AIK  +PEL
Sbjct: 248 EWGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIPDEQIEAIKATMPEL 307

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKIVANWVINDLLGVL 377
           P A+R RFI +FG++ YDA VL   + +AD++E         +  KI ANWV+ +  G L
Sbjct: 308 PAARRARFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKIAANWVMGEFSGAL 367

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLRQ 436
           N++G  + D+P+S  QLG +I  I+D TISGKIAK +F  +WE +G +  +I+ E GL+Q
Sbjct: 368 NKAGLELTDSPVSAEQLGGMIARIVDNTISGKIAKQVFGFMWESEGKSADDIIAEKGLKQ 427

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
            TD  AIE ++ +V+ +N   V    + K    +  VGQVMK + GKANP+ V +++K+ 
Sbjct: 428 ETDTGAIEAIIKDVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKANPAQVNELMKKL 487

Query: 496 LG 497
           +G
Sbjct: 488 IG 489


>gi|53802671|ref|YP_112636.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Methylococcus
           capsulatus str. Bath]
 gi|81683215|sp|Q60CK9|GATB_METCA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|53756432|gb|AAU90723.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylococcus
           capsulatus str. Bath]
          Length = 476

 Score =  509 bits (1312), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 246/480 (51%), Positives = 337/480 (70%), Gaps = 10/480 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE VIG+E+HAQL+  SK+FSGA   +GAEPNTQ    D  +PG+LP+LN   V+ AV 
Sbjct: 2   EWETVIGLEIHAQLATRSKIFSGAPTAYGAEPNTQACAIDLGLPGVLPVLNREAVRMAVK 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL + A I   SVFARKNYFYPDLP+GYQISQ+D P+V  GK+S+++        + + 
Sbjct: 62  FGLAIGAEIAPVSVFARKNYFYPDLPKGYQISQYDLPVVARGKLSINV------DGKALT 115

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           +GI R HLE+DAGKS+H+ +   + IDLNR+G  L+EIV++PD+RS+ EA A++ KL ++
Sbjct: 116 IGITRAHLEEDAGKSLHEDFHGYTGIDLNRAGTPLLEIVSEPDLRSAKEAVAYMKKLHAL 175

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +RYL  CDGNM+EGS R D NVSV   G+  +GTR E+KN+NS RF+  AI +E  RQI 
Sbjct: 176 VRYLEICDGNMQEGSFRCDANVSVRPKGQTKFGTRAEIKNLNSFRFVEKAINHEIARQIE 235

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ILE GG + QETRL+D  K+ETRS+R+KE+A DYRYF +PDLLPLEI   FI  +K  +P
Sbjct: 236 ILEGGGEVIQETRLYDSVKDETRSMRSKEEANDYRYFPDPDLLPLEISSGFIEEVKATLP 295

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA--VNRDKKIVANWVINDLLGVL 377
           ELPDAKR+RF  ++G+S YDA VL + + +AD++E +      D K+ ANWV+ +L G+L
Sbjct: 296 ELPDAKRDRFKAQYGLSDYDAEVLTASREMADFYETVVREAAGDPKLCANWVMVELSGLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  I  + I    L  L+  I D TISGKIAK +   +W +GG+  +I+E  GL+Q+
Sbjct: 356 NKDGLEITASKIDAAGLASLVRRIADATISGKIAKQVLETMWNEGGSADDIIERQGLKQI 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           TD  AIE ++D++I +NP  +A+  A K  L  +FVGQ MK T GKANP+ + ++LK+KL
Sbjct: 416 TDTGAIESIIDQIIAANPEQLAQYRAGKDKLFGFFVGQAMKATQGKANPAQLNELLKKKL 475


>gi|330501855|ref|YP_004378724.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           mendocina NK-01]
 gi|328916141|gb|AEB56972.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           mendocina NK-01]
          Length = 481

 Score =  509 bits (1312), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 251/482 (52%), Positives = 342/482 (70%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQLS  SK+FS ++ +FGAEPNTQ S  D  MPG LP+LN   V+ A   
Sbjct: 3   WETVIGLEIHAQLSTQSKIFSASATSFGAEPNTQASLIDLGMPGTLPVLNAEAVRMACKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I   +VFARKNYFYPDLP+GYQ SQ D PIVG+G + +++   + G  + I  
Sbjct: 63  GLAIDAEIGARNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITL---EDGTVKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RS+ EA A++  + +++
Sbjct: 118 GITRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVSV   G EA+GTR E+KNVNS RF+  AI +E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSVRPKGQEAFGTRAEIKNVNSFRFIEKAINHEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP+K+ETRS+R KE+A DYRYF  PDLLP+ I++ F+  ++ Q+PE
Sbjct: 238 IEDGGKVIQETRLYDPNKDETRSMRGKEEANDYRYFPCPDLLPVVIEQSFLDEVRSQLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  ++G+S YDASVL + + +A+YFE++A V  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPTQKRERFQSQYGLSTYDASVLSASREMAEYFEEVAKVCGDAKLAANWVMGELSSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  IE +P+S   LG +I  I D TISGKIAK +F  +    G+   I+E  GL+QVTD
Sbjct: 358 EGLEIEQSPVSAEHLGGMILRIKDNTISGKIAKMVFEAMAAGEGSADAIIESKGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIEK++DEV+ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK+
Sbjct: 418 SGAIEKMLDEVLAANAEQVEQYRASDEAKRGKMFGFFVGQAMKASKGKANPGQVNELLKK 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|332853447|ref|ZP_08434766.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Acinetobacter baumannii 6013150]
 gi|332870570|ref|ZP_08439312.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Acinetobacter baumannii 6013113]
 gi|332728653|gb|EGJ60021.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Acinetobacter baumannii 6013150]
 gi|332732130|gb|EGJ63399.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Acinetobacter baumannii 6013113]
          Length = 489

 Score =  509 bits (1312), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 251/482 (52%), Positives = 341/482 (70%), Gaps = 11/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  SK+FSG+   FG +PNTQ S  D AMPG+LP+LN + V+ A+  
Sbjct: 13  WEVVIGIEIHTQLATNSKIFSGSPTEFGQDPNTQASLVDLAMPGVLPVLNEKVVELAIRF 72

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G   T  +
Sbjct: 73  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGT--TKRI 127

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 128 GVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKAIHTLV 187

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 188 RWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 247

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I ++ I AIK  +PEL
Sbjct: 248 EWGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIPDEQIEAIKATMPEL 307

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKIVANWVINDLLGVL 377
           P A+R RFI +FG++ YDA VL   + +AD++E         +  KI ANWV+ +  G L
Sbjct: 308 PAARRARFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKIAANWVMGEFSGAL 367

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLRQ 436
           N++G  + D+P+S  QLG +I  IID TISGKIAK +F  +WE +G +  +I+ E GL+Q
Sbjct: 368 NKAGLELTDSPVSAEQLGGMIARIIDNTISGKIAKQVFGFMWESEGKSADDIIAEKGLKQ 427

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
            TD  AIE ++ EV+ +N   V    + K    +  VGQVMK + GKANP+ V +++K+ 
Sbjct: 428 ETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKANPAQVNELMKKL 487

Query: 496 LG 497
           +G
Sbjct: 488 IG 489


>gi|40063055|gb|AAR37911.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [uncultured marine
           bacterium 560]
          Length = 476

 Score =  509 bits (1311), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 247/478 (51%), Positives = 338/478 (70%), Gaps = 8/478 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+H+QL+  SK+FSGAS  FGAEPNTQ    D  +PG+LP+LN   V  A+  
Sbjct: 3   WETVIGLEIHSQLNTKSKIFSGASTEFGAEPNTQACAVDLGLPGVLPVLNKEAVNMALRF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL +NA IN++S+FARKNYFYPDLP+GYQISQ + PIVG+G ++++I    S       V
Sbjct: 63  GLAVNAKINQHSIFARKNYFYPDLPKGYQISQFEIPIVGKGVININIEEGASKM-----V 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKSIHD Y   S IDLNR+G  L+EIV++PD+RS+ EA  +  K+ +++
Sbjct: 118 GITRAHLEEDAGKSIHDLYEDYSAIDLNRAGTPLLEIVSEPDLRSAKEAVTYAKKIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           +Y+G CDGNM+EGS R D NVSV + G +  GTR E+KN+NS +FL  AI  E  RQ  I
Sbjct: 178 QYIGICDGNMQEGSFRCDANVSVRKKGTKKLGTRAELKNINSFKFLEKAINIEIERQQDI 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LEDGG + QETRL+D  KNETRS+R+KE+A DYRYF +PDLLP++I+++ +  IK  +PE
Sbjct: 238 LEDGGEVVQETRLYDSVKNETRSMRSKEEANDYRYFPDPDLLPVDIEDEMLTEIKNSLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVLNR 379
           LP  K+ RF+ EFG+S YDA  L + KS+ADY+E +  +  + K+ ANWV+ +L   LN+
Sbjct: 298 LPTEKKNRFVSEFGLSDYDAENLTAQKSLADYYEAMLNDGAEAKLAANWVMGELSAALNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           +   ++++PI   +L EL+  I D TISGKIAKD+F  +WE  G   +I+E  GL+Q+TD
Sbjct: 358 NQMDVQNSPILAKELSELVKRISDDTISGKIAKDVFKTMWEGKGRVDDIIESQGLKQMTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           + AIE ++D +I +N   V +  +    L+ +FVGQVMK T GKANP  V ++L +KL
Sbjct: 418 VGAIEDIIDGIIANNSEQVKQFKSGNTKLLGYFVGQVMKATQGKANPKQVNQILNDKL 475


>gi|330888643|gb|EGH21304.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. mori str. 301020]
          Length = 481

 Score =  509 bits (1310), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 245/482 (50%), Positives = 345/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV  
Sbjct: 3   WEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +++   + G  + I  
Sbjct: 63  GLAVDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDITL---EDGTVKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +I+
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHAIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +ED G + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ F+   +  +PE
Sbjct: 238 IEDSGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFLEETRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  +FG+S YDASVL S +  ADYFE+ ++++ D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKRERFQSQFGLSTYDASVLASSREQADYFEQVVSISGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  IE +P+S  QLG ++  I D TISGKIAK +F  +    G+  E++++ GL+QVTD
Sbjct: 358 QGLEIEQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAMANGEGSADEVIDKRGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIE ++DE++ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 SGAIESMLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELLKA 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|213966633|ref|ZP_03394784.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Pseudomonas
           syringae pv. tomato T1]
 gi|301383143|ref|ZP_07231561.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. tomato Max13]
 gi|302063731|ref|ZP_07255272.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. tomato K40]
 gi|302133795|ref|ZP_07259785.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|213928483|gb|EEB62027.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Pseudomonas
           syringae pv. tomato T1]
          Length = 487

 Score =  508 bits (1309), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 251/488 (51%), Positives = 344/488 (70%), Gaps = 18/488 (3%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV  
Sbjct: 3   WEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +   P + G  +   V
Sbjct: 63  GLAVDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDI---PLEDGTVK--RV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +I+
Sbjct: 118 GITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHAIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ FI   +  +PE
Sbjct: 238 IEDGGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFIEETRATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP  KRERF  +FG+S YDASVL S +  ADYFEK ++++ D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKRERFQSQFGLSTYDASVLASSREQADYFEKVVSISGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE------KGGTPKEIVEELG 433
            G  I+ +P+S  QLG ++  I D TISGKIAK +F  +          G+  EI+E  G
Sbjct: 358 QGVEIDQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAIAAGEAVVIGEGSADEIIERKG 417

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIV 488
           L+QVTD  AIE ++DEV+ +N   V +      A +  +  +FVGQ MK + GKANP  V
Sbjct: 418 LKQVTDSGAIESMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQV 477

Query: 489 QKMLKEKL 496
            ++LK KL
Sbjct: 478 NELLKAKL 485


>gi|170723446|ref|YP_001751134.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           putida W619]
 gi|229486430|sp|B1JDP2|GATB_PSEPW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|169761449|gb|ACA74765.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Pseudomonas putida
           W619]
          Length = 481

 Score =  508 bits (1309), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 249/482 (51%), Positives = 342/482 (70%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QL+  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ A M 
Sbjct: 3   WEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNQEAVRMACMF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I K +VFARKNYFYPDLP+GYQISQ D PIVG+G + +++   + G  + I  
Sbjct: 63  GLAIDAQIGKRNVFARKNYFYPDLPKGYQISQMDLPIVGKGHLDIAL---EDGTIKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+H+ +S  + IDLNR+G  L+EIV++PDMRS+ EA A++  + +++
Sbjct: 118 GVTRAHLEEDAGKSLHEDFSGSTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+A +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQAEFGTRCEIKNVNSFRFIERAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP+K+ETRS+R+KE+A DYRYF +PDLLP+ I++ F+  I+  +PE
Sbjct: 238 IEDGGKVVQETRLYDPNKDETRSMRSKEEANDYRYFPDPDLLPVVIEDSFLETIRTGLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP  K ERF  ++G+S YDA+VL S +  ADYFE++  +  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKVERFQSQYGLSAYDANVLASSREQADYFEQVVKIGGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I+  P+S  QLG ++  I D TISGKIAK +F  +    G    I+E  GL+QVTD
Sbjct: 358 LGIEIDQAPVSAEQLGGMLLRIRDNTISGKIAKTVFEAMAAGEGDADSIIESKGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNV-----ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AI+K++DEV+ +N   V     A  A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 TGAIDKMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPGQVNQLLKA 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|262371804|ref|ZP_06065083.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter junii SH205]
 gi|262311829|gb|EEY92914.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter junii SH205]
          Length = 489

 Score =  508 bits (1308), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 249/482 (51%), Positives = 338/482 (70%), Gaps = 11/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+LN   V  A+  
Sbjct: 13  WEVVIGIEIHTQLATKSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPVLNAEVVDLAIRF 72

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G  + I  
Sbjct: 73  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGTVKRI-- 127

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKSIHDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 128 GVTRAHLEEDAGKSIHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKAIHTLV 187

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 188 RWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 247

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I  + I A +  +PEL
Sbjct: 248 EYGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIISNEQIEAARAALPEL 307

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKIVANWVINDLLGVL 377
           P A+RERFI +FG++ YDA VL   + +AD++E         +  K+ ANWV+ +  G L
Sbjct: 308 PAARRERFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKVSANWVMGEFSGAL 367

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLRQ 436
           N++G  + D+P+S  QLG +I  I+D TI+GKIAK +F  +WE +G +  EI+ E GL+Q
Sbjct: 368 NKAGLELADSPVSAEQLGGMIARIVDNTINGKIAKQVFGFMWEAEGKSADEIIAEKGLKQ 427

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
            TD  AIE ++ +V+ +N   V    + K    +  VGQVMK   GKANP+ V +++K+ 
Sbjct: 428 ETDTGAIEAIIKDVLAANEKMVEEYKSGKEKAFNGLVGQVMKAAKGKANPAQVNELMKKL 487

Query: 496 LG 497
           +G
Sbjct: 488 IG 489


>gi|325123302|gb|ADY82825.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter calcoaceticus PHEA-2]
          Length = 489

 Score =  508 bits (1307), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 251/482 (52%), Positives = 340/482 (70%), Gaps = 11/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+LN + V  A+  
Sbjct: 13  WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPVLNEKVVDLAIRF 72

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G   T  +
Sbjct: 73  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGT--TKRI 127

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKSIHDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 128 GVTRAHLEEDAGKSIHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKSIHTLV 187

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 188 RWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 247

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I ++ I A +  +PEL
Sbjct: 248 EYGGSIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIADEQIEAARAALPEL 307

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK----KIVANWVINDLLGVL 377
           P A+R RFI +FG++ YDA VL   + +AD+FE +          K+ ANWV+ +  G L
Sbjct: 308 PAARRARFIADFGVTEYDAHVLTLSREMADFFEAVVAAAGGAAQGKVSANWVMGEFSGAL 367

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLRQ 436
           N++G  + D+P+S  QLG +I  IID TISGKIAK +F  +WE +G +  +I+ E GL+Q
Sbjct: 368 NKAGLDLADSPVSAEQLGGMIARIIDNTISGKIAKQVFGFMWESEGKSADDIIAEKGLKQ 427

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
            TD  AIE ++ EV+ +N   V    + K    +  VGQVMK + GKANP+ V +++K+ 
Sbjct: 428 ETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKANPAQVNELMKKL 487

Query: 496 LG 497
           +G
Sbjct: 488 IG 489


>gi|262378969|ref|ZP_06072126.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter radioresistens SH164]
 gi|262300254|gb|EEY88166.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter radioresistens SH164]
          Length = 491

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 249/481 (51%), Positives = 339/481 (70%), Gaps = 10/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+LN   V  A+  
Sbjct: 16  WEVVIGIEIHTQLATKSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPVLNKEVVDLAIRF 75

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G  + I  
Sbjct: 76  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGTVKRI-- 130

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKSIHDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 131 GVTRAHLEEDAGKSIHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKAIHTLV 190

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 191 RWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 250

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E  G I QETRLFDP K ETRS+R+KE+A DYRYF +PDLLP+ I ++ I AIK  +PEL
Sbjct: 251 EWDGTIDQETRLFDPVKMETRSMRSKEEANDYRYFPDPDLLPVIIADEQIEAIKATMPEL 310

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV----NRDKKIVANWVINDLLGVL 377
           P A+R RF+ +FG++ YDA VL   + +++++E++          KI ANWV+ +  G L
Sbjct: 311 PAARRARFVADFGMTEYDAHVLTLTREMSEFYEEVVKAAGGAAQGKIAANWVMGEFSGAL 370

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N++G  + D+P+S  +LG +I  I+D TISGKIAK +F  +WE+G T  EI+ E GL+Q 
Sbjct: 371 NKAGLDLADSPVSAEKLGGMIARIVDNTISGKIAKQVFGFMWEEGKTADEIIAEKGLKQE 430

Query: 438 TDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           TD  AIE ++ EV+ +N   V    + K    +  VGQVMK + GKANP+ V +++K+ +
Sbjct: 431 TDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKANPAQVNELMKKLI 490

Query: 497 G 497
           G
Sbjct: 491 G 491


>gi|262375780|ref|ZP_06069012.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter lwoffii SH145]
 gi|262309383|gb|EEY90514.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter lwoffii SH145]
          Length = 493

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 250/481 (51%), Positives = 338/481 (70%), Gaps = 10/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  +K+FSG+S  FG +PNTQ S  D AMPG+LP+LN   V  A+  
Sbjct: 18  WEVVIGIEIHTQLATNTKIFSGSSTVFGNDPNTQASLVDLAMPGVLPVLNKEVVDLAIRF 77

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G  + I  
Sbjct: 78  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGTVKRI-- 132

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKSIHDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 133 GVTRAHLEEDAGKSIHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKAIHTLV 192

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS R D NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 193 RWLGISDGNMAEGSFRCDCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 252

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E  G I QETRLFDP K ETRS+R+KE+A DYRYF +PDLLP+ I ++ I AIK  +PEL
Sbjct: 253 EWDGTIDQETRLFDPVKMETRSMRSKEEANDYRYFPDPDLLPVVIADEQIEAIKATMPEL 312

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKIVANWVINDLLGVL 377
           P A+RERF+ +FG++ YDA VL   + +AD++E          + KI ANWV+ +  G L
Sbjct: 313 PAARRERFVADFGVTEYDAHVLTLTREMADFYEAVVTAAGGAANGKIAANWVMGEFSGAL 372

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N++G  + D+P+S  +LG +I  I+D TISGKIAK +F  +WE+G T  EI+ E GL+Q 
Sbjct: 373 NKAGLDLADSPVSTEKLGGMIARIVDNTISGKIAKQVFGFMWEEGKTADEIIAEKGLKQE 432

Query: 438 TDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           TD  AIE ++ EV+ +N   V    + K    +  VGQVMK + GKANP+ V +++K+ +
Sbjct: 433 TDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASRGKANPAQVNELMKKLI 492

Query: 497 G 497
           G
Sbjct: 493 G 493


>gi|293610984|ref|ZP_06693283.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826636|gb|EFF85002.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 489

 Score =  507 bits (1305), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 249/482 (51%), Positives = 340/482 (70%), Gaps = 11/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+LN + V  A+  
Sbjct: 13  WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPVLNEKVVDLAIRF 72

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G   T  +
Sbjct: 73  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGT--TKRI 127

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 128 GVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKAIHTLV 187

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 188 RWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 247

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I ++ I A +  +PEL
Sbjct: 248 EYGGSIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIADEQIEAARAALPEL 307

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKIVANWVINDLLGVL 377
           P A+R RFI +FG++ YDA VL   + +AD++E         +  K+ ANWV+ +  G L
Sbjct: 308 PAARRARFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKVSANWVMGEFSGAL 367

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLRQ 436
           N++G  + D+P+S  QLG +I  IID TISGKIAK +F  +WE +G +  +I+ E GL+Q
Sbjct: 368 NKAGLDLADSPVSAEQLGGMIARIIDNTISGKIAKQVFGFMWESEGKSADDIIAEKGLKQ 427

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
            TD  AIE ++ EV+ +N   V    + K    +  VGQVMK + GKANP+ V +++K+ 
Sbjct: 428 ETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKANPAQVNELMKKL 487

Query: 496 LG 497
           +G
Sbjct: 488 IG 489


>gi|325275937|ref|ZP_08141781.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas sp.
           TJI-51]
 gi|324098932|gb|EGB96934.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas sp.
           TJI-51]
          Length = 481

 Score =  507 bits (1305), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 249/482 (51%), Positives = 343/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QL+  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ A M 
Sbjct: 3   WEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNQEAVRMACMF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I K +VFARKNYFYPDLP+GYQISQ D PIVG+G + +++   + G  + I  
Sbjct: 63  GLAIDAEIGKRNVFARKNYFYPDLPKGYQISQMDLPIVGKGHLDIAL---EDGTIKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+H+ +S  + IDLNR+G  L+EIV++PDMRS+ EA A++  + +++
Sbjct: 118 GVTRAHLEEDAGKSLHEDFSGSTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+A +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQAEFGTRCEIKNVNSFRFIERAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP+K+ETRS+R+KE+A DYRYF +PDLLP+ I++ ++ +I+  +PE
Sbjct: 238 IEDGGKVVQETRLYDPNKDETRSMRSKEEANDYRYFPDPDLLPVVIEDSYLDSIRAALPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP  K ERF  ++G+S YDA+VL S +  ADYFE++  +  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKVERFQRQYGLSAYDANVLASSREQADYFEEVVKIGGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I+  P+S  QLG ++  I D TISGKIAK +F  +    G    I+E  GL+QVTD
Sbjct: 358 LGVEIDQAPVSAAQLGGMLLRIRDNTISGKIAKTVFEAMAGGEGDADSIIESKGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNV-----ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AIEK++DE++ +N   V     A  A +  +  +FVGQ MK + GKANP  V +MLK 
Sbjct: 418 TGAIEKMLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPGQVNQMLKA 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|226943390|ref|YP_002798463.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Azotobacter
           vinelandii DJ]
 gi|259647228|sp|C1DQ36|GATB_AZOVD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|226718317|gb|ACO77488.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Azotobacter
           vinelandii DJ]
          Length = 482

 Score =  506 bits (1304), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 250/483 (51%), Positives = 343/483 (71%), Gaps = 13/483 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQL+  SK+FSG++  FGAEPNTQ S  D  MPG LP+LN   V+ AV  
Sbjct: 3   WETVIGLEIHAQLATRSKIFSGSATAFGAEPNTQASLIDLGMPGTLPVLNEETVRMAVRF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A I   +VFARKNYFYPDLP+GYQ SQ DKPIVG+G + +++   + G  + I  
Sbjct: 63  GLAIEAEIGHTNVFARKNYFYPDLPKGYQTSQMDKPIVGKGHLDITL---EDGTLKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PD+RS+ EA A++  + +++
Sbjct: 118 GITRAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSV-CRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVSV  R  EA+GTR E+KNVNS RF+  AI +E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSVRPRGQEAFGTRAEIKNVNSFRFIEKAINHEIQRQIEL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP+K+ETRS+R KE+A DYRYF  PDLLP+ +++ F+  +++ +PE
Sbjct: 238 IEDGGKVIQETRLYDPNKDETRSMRGKEEANDYRYFPCPDLLPVVLEDGFVERLRETLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP+ KRERF  ++G+S YDASVL + + +A+YFE    V  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPNQKRERFQSQYGLSAYDASVLSASREMAEYFEAVFEVCGDAKLAANWVMGELSSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNIL-WEKGGTPKEIVEELGLRQVT 438
            G  IE +P+S  QLG LI  I D TISGKIAK +F  L  ++G +   I+E  GL+QVT
Sbjct: 358 EGLEIERSPVSAEQLGGLIRRIQDNTISGKIAKMVFEALAADEGASADAIIERKGLKQVT 417

Query: 439 DLSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           D  AIE ++DE++ +N   V +      A +  +  +FVGQ MK + GKANP  V ++LK
Sbjct: 418 DTGAIESMLDEMLAANAAQVEQYRAADEAKRAKMFGFFVGQAMKASKGKANPGQVNELLK 477

Query: 494 EKL 496
           +KL
Sbjct: 478 KKL 480


>gi|299768904|ref|YP_003730930.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           sp. DR1]
 gi|298698992|gb|ADI89557.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           sp. DR1]
          Length = 489

 Score =  506 bits (1304), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 249/482 (51%), Positives = 340/482 (70%), Gaps = 11/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+LN + V  A+  
Sbjct: 13  WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPVLNEKVVDLAIRF 72

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G   T  +
Sbjct: 73  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGT--TKRI 127

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKSIHDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 128 GVTRAHLEEDAGKSIHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKSIHTLV 187

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 188 RWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 247

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I ++ I A +  +PEL
Sbjct: 248 EYGGSIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIADEQIEAARAALPEL 307

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKIVANWVINDLLGVL 377
           P A+R RFI +FG++ YDA VL   + +AD+FE         +  K+ ANWV+ +  G L
Sbjct: 308 PAARRARFIADFGVTEYDAHVLTLSREMADFFEAVVAAAGGAKQGKVSANWVMGEFSGAL 367

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLRQ 436
           N++G  + ++P+S  QLG +I  I+D TISGKIAK +F  +WE +G +  +I+ E GL+Q
Sbjct: 368 NKAGLDLAESPVSAEQLGGMIARIVDNTISGKIAKQVFGFMWESEGKSADDIIAEKGLKQ 427

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
            TD  AIE ++ EV+ +N   V    + K    +  VGQVMK + GKANP+ V +++K+ 
Sbjct: 428 ETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKANPAQVNELMKKL 487

Query: 496 LG 497
           +G
Sbjct: 488 IG 489


>gi|294651328|ref|ZP_06728649.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acinetobacter
           haemolyticus ATCC 19194]
 gi|292822800|gb|EFF81682.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 489

 Score =  506 bits (1303), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 248/482 (51%), Positives = 337/482 (69%), Gaps = 11/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+LN   V  A+  
Sbjct: 13  WEVVIGIEIHTQLATKSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPVLNAEVVDLAIRF 72

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G  + I  
Sbjct: 73  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGTVKRI-- 127

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKSIHDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 128 GVTRAHLEEDAGKSIHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKAIHTLV 187

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 188 RWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 247

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I  + I A +  +PEL
Sbjct: 248 EYGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIISNEQIEAARAALPEL 307

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKIVANWVINDLLGVL 377
           P A+RERFI +FG++ YDA VL   + +AD++E         +  K+ ANWV+ +  G L
Sbjct: 308 PAARRERFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKVSANWVMGEFSGAL 367

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG-TPKEIVEELGLRQ 436
           N++G  + D+P+S  QLG +I  I+D TI+GKIAK +F  +WE  G +  +I+ E GL+Q
Sbjct: 368 NKAGLDLADSPVSAEQLGGMIARIVDNTINGKIAKQVFGFMWEADGKSADDIIAEKGLKQ 427

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
            TD  AIE ++ +V+ +N   V    + K    +  VGQVMK   GKANP+ V +++K+ 
Sbjct: 428 ETDTGAIEAIIKDVLAANEKMVEEYKSGKEKAFNGLVGQVMKAAKGKANPAQVNELMKKL 487

Query: 496 LG 497
           +G
Sbjct: 488 IG 489


>gi|30250013|ref|NP_842083.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrosomonas
           europaea ATCC 19718]
 gi|47115760|sp|Q82T56|GATB_NITEU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|30139120|emb|CAD85984.1| gatB: glutamyl-tRNA(Gln) amidotransferase, B subunit [Nitrosomonas
           europaea ATCC 19718]
          Length = 478

 Score =  506 bits (1302), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 253/481 (52%), Positives = 344/481 (71%), Gaps = 13/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQLS  SK+FSGASV +GAEPN+Q    D A+PG+LP+LN + ++ A+  
Sbjct: 3   WETVIGLEIHAQLSTRSKIFSGASVAYGAEPNSQACAVDIALPGVLPVLNRQAIEYAIRF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A IN  SVFARKNYFYPDLP+GYQISQ + PIV  G V++  G     Q +TI  
Sbjct: 63  GLAIDATINSPSVFARKNYFYPDLPKGYQISQLEHPIVEGGHVAIQTG----DQEKTIR- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS H+++  ++ IDLNR+G  L+EIV++PDMRSS EA A+   L S++
Sbjct: 118 -LTRAHLEEDAGKSTHEEFHGMTGIDLNRAGTGLLEIVSEPDMRSSAEAVAYAKVLHSLV 176

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPG--EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           R++G CDGNM+EGS R D NVSV RP   EA GTRCE+KN+NS RFL  AI+YE  RQI 
Sbjct: 177 RWIGICDGNMQEGSFRCDANVSV-RPAGSEALGTRCEIKNLNSFRFLERAIDYEVARQID 235

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ILE GG I QETRL+D  ++ETR++R+KEDA DYRYF +PDLLP+ I +++I  I++++P
Sbjct: 236 ILESGGSITQETRLYDADRDETRTMRSKEDAHDYRYFPDPDLLPVIIPQEWIDQIREKLP 295

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL--AVNRDKKIVANWVINDLLGVL 377
           ELP  KR R+I +FG+  YDA++L + + +ADYFE++   +    K+ ANW++ ++   L
Sbjct: 296 ELPKDKRNRYIQDFGLQTYDANILTAARELADYFEQMVSVLPGQSKLCANWIMGEVSARL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG-TPKEIVEELGLRQ 436
           N+ G  I  +PISP QL  L+  I DGTISGKIAKD+F+ +W+  G +   I++   LRQ
Sbjct: 356 NKEGLEIARSPISPEQLAGLLLRITDGTISGKIAKDVFDSMWQSNGDSADTIIDAKNLRQ 415

Query: 437 VTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           ++D S IEK VD+V+ +NP  VA   A K    +  VGQVMK + GKANP+ V  +LK++
Sbjct: 416 ISDDSEIEKWVDDVLAANPQQVADYRAGKEKAFNSLVGQVMKTSKGKANPAQVNSVLKKR 475

Query: 496 L 496
           L
Sbjct: 476 L 476


>gi|50084036|ref|YP_045546.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           sp. ADP1]
 gi|81613314|sp|Q6FDY4|GATB_ACIAD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|49530012|emb|CAG67724.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter sp. ADP1]
          Length = 495

 Score =  505 bits (1301), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 252/481 (52%), Positives = 339/481 (70%), Gaps = 10/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+LN   V  A+  
Sbjct: 20  WEVVIGIEIHTQLATQSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPVLNEEVVNLAIRF 79

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G  + I  
Sbjct: 80  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGTVKRI-- 134

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKSIHDQ+   S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 135 GVTRAHLEEDAGKSIHDQFEGQSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKSIHTLV 194

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+A+GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 195 RWLGISDGNMAEGSFRADCNVSLRRPGDAFGTRCELKNLNSFRFIEQAINVEIERQMEIL 254

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I ++ I+AIK  +PEL
Sbjct: 255 EWGGTIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIADEQIKAIKATMPEL 314

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKIVANWVINDLLGVL 377
           P A+RERFI EF I+ YDA VL   + +AD++E            KI ANWV+ +  G L
Sbjct: 315 PAARRERFIAEFAITEYDAHVLTLSREMADFYEAVVAAAGGAAHGKIAANWVMGEFSGAL 374

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N++G  + D+P+S  QLG +I  I+D TISGKIAK +F  +W++G +   I++E  L+Q 
Sbjct: 375 NKAGLELADSPVSAEQLGGMIARIVDNTISGKIAKQVFGFMWDEGKSADTIIQEKSLKQE 434

Query: 438 TDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           TD  AIE ++ +V+ +N   V    + K    +  VGQVMK + GKANP+ V +++K+ +
Sbjct: 435 TDTGAIEAIIKDVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKANPAQVNELMKKLI 494

Query: 497 G 497
           G
Sbjct: 495 G 495


>gi|82701457|ref|YP_411023.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrosospira
           multiformis ATCC 25196]
 gi|109892039|sp|Q2YC90|GATB_NITMU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|82409522|gb|ABB73631.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Nitrosospira multiformis ATCC 25196]
          Length = 496

 Score =  505 bits (1301), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 251/494 (50%), Positives = 341/494 (69%), Gaps = 21/494 (4%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+EVHAQLS  SK+FSGAS  FGA PN +    D A+PG+LP+LN   V++A+  
Sbjct: 3   WETVIGLEVHAQLSTESKIFSGASTAFGAAPNAEACAVDLALPGVLPVLNRGAVERAIRF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A IN  S+FARKNYFYPDLP+GYQISQ++ P+V  G + + +  D   Q +T+  
Sbjct: 63  GLAVGAKINSPSIFARKNYFYPDLPKGYQISQYELPVVEGGHIQLQVVQDGKEQEKTVR- 121

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PDMRSS EA A+   L +++
Sbjct: 122 -LVRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDMRSSAEAVAYAKTLHTLV 180

Query: 202 RYLGTCDGNMEEGSMRADVNVSV-CRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           R++G CDGNM+EGS R D NVSV  R  +  GTRCE+KN+NS RFL  AI+YE RRQ+ I
Sbjct: 181 RWIGICDGNMQEGSFRCDANVSVRPRGSDKLGTRCEIKNLNSFRFLEKAIDYEVRRQVEI 240

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LEDGG I+Q+TRLFDP K ETR++R+KEDA DYRYF +PDLLPLEI  ++I  +KK +PE
Sbjct: 241 LEDGGSIQQQTRLFDPEKGETRAMRSKEDAQDYRYFPDPDLLPLEISGNWIEEVKKGLPE 300

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA--VNRDKKIVANWVINDLLGVLN 378
           LP   R RF  ++G+S+YDA +L  D+ I++Y+E +   +  D K+ ANWV+ ++   LN
Sbjct: 301 LPQQIRTRFEHDYGLSMYDALLLTGDRDISEYYEAVVGKLPSDPKLCANWVMGEVSAYLN 360

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK------------ 426
             GKS +  P+SP QL +L+  I DGTISGKIAKD+F  +W + GT              
Sbjct: 361 NEGKSFDVCPLSPAQLAQLLLRIKDGTISGKIAKDVFRQMWAQAGTESISWRNSEGVDEG 420

Query: 427 ---EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGK 482
               I++  GLRQ++D SA+E +V EV+ +NP +V    A K    +  +GQVMK   GK
Sbjct: 421 LADRIIDSQGLRQISDSSALENLVHEVLAANPKSVEEFKAGKEKAFNALMGQVMKAARGK 480

Query: 483 ANPSIVQKMLKEKL 496
           ANP+ V ++L++KL
Sbjct: 481 ANPAQVNEILRKKL 494


>gi|307823388|ref|ZP_07653617.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacter
           tundripaludum SV96]
 gi|307735373|gb|EFO06221.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacter
           tundripaludum SV96]
          Length = 478

 Score =  505 bits (1300), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 249/480 (51%), Positives = 333/480 (69%), Gaps = 12/480 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQL+  SK+FSGAS  +GAEPNTQ    D  +PG+LP+LN   V+ AV+ 
Sbjct: 5   WETVIGLEIHAQLATKSKIFSGASTAYGAEPNTQACAVDLGLPGVLPVLNEEAVRMAVIF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSGQFRTIE 140
           G+ + AHI  YSVFARKNYFYPDLP+GYQISQ D PIVG G + + + G  K        
Sbjct: 65  GMAIEAHIAPYSVFARKNYFYPDLPKGYQISQMDLPIVGVGHLDIDVDGVSK-------R 117

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           +GI R HLE+DAGKS+H  +  ++ IDLNR+G  L+EIV++P+M S+ EA A++ K+  +
Sbjct: 118 IGITRAHLEEDAGKSLHGSFHGLTGIDLNRAGTPLLEIVSEPEMSSAKEAVAYMRKMHEL 177

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +RYLG CDGNM+EGS R D NVSV   G+  +GTR E+KN+NS +F+  AI +E  RQI 
Sbjct: 178 VRYLGICDGNMQEGSFRCDANVSVRPKGQKEFGTRAEIKNINSFKFVEKAINHEIERQIE 237

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++E GG + QETRL+D  K+ETRS+R+KE+A DYRYF +PDLLP+ IDEDF   IK Q+P
Sbjct: 238 VIESGGTVVQETRLYDSDKDETRSMRSKEEANDYRYFPDPDLLPVLIDEDFKAQIKAQLP 297

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR--DKKIVANWVINDLLGVL 377
           ELP AK++RF  ++ +   +A++L S +S+ADYFE +      + K+ ANWV  DLL  L
Sbjct: 298 ELPQAKKQRFKDDYVLDEENATILTSSRSLADYFETVVKESGCEAKMCANWVTGDLLAAL 357

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           NR+   I D+P+S  +L  L+  I D TISGKIAK +F  LW+   T  EI+E  GL+Q+
Sbjct: 358 NRADLEITDSPVSHERLAGLLKRISDDTISGKIAKQVFEELWQSTATADEIIEAKGLKQI 417

Query: 438 TDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           TD  AIE ++D++I  N + V +  + K  +  +FVGQVMK   GKANP  V KMLK KL
Sbjct: 418 TDTGAIEAIIDKIIADNQDQVEQYRSGKDKVFGFFVGQVMKEMQGKANPGEVNKMLKAKL 477


>gi|307544497|ref|YP_003896976.1| aspartyl-tRNA amidotransferase subunit B [Halomonas elongata DSM
           2581]
 gi|307216521|emb|CBV41791.1| aspartyl-tRNA amidotransferase subunit B [Halomonas elongata DSM
           2581]
          Length = 484

 Score =  504 bits (1299), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 252/483 (52%), Positives = 339/483 (70%), Gaps = 13/483 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+EVH QL+  SK+FSGAS  FGAEPN+Q    D  +PG+LP+LN + V  AV  
Sbjct: 3   WETVIGLEVHVQLATRSKIFSGASTAFGAEPNSQACAVDLGLPGVLPVLNEQAVAMAVQF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A I + SVF RKNYFYPDLP+GYQ SQ  +PIVG G+V +++    + + R    
Sbjct: 63  GLGIHAEIPEVSVFDRKNYFYPDLPKGYQTSQMYQPIVGPGEVEITLDDGATKRIR---- 118

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            +   HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A+L  + SI+
Sbjct: 119 -VHHAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSEPDMRSAKEAAAYLKAIHSIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            YLG  DGNM EGSMR DVNVSV   G E +GTR E+KNVNS RF+  AIE+E  RQI +
Sbjct: 178 TYLGISDGNMAEGSMRCDVNVSVRPKGQETFGTRAEIKNVNSFRFVERAIEFEVERQIEL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP  +ETRS+RTKE+A DYRYF  PDLLP+ +D+ ++  ++  +PE
Sbjct: 238 IEDGGEVVQETRLYDPEADETRSMRTKEEANDYRYFPCPDLLPVVLDQAYVDHLRDNLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP  KR RF  EFG+S YDA VL + +++A+YFE++  V  D K  ANWV  +L G LNR
Sbjct: 298 LPADKRTRFENEFGLSAYDAGVLSASRAMAEYFERVKDVCGDAKQAANWVQGELSGALNR 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLRQVT 438
            G +I D+P+S ++LGELI  ++D TI+GK AK +F  LW  +G +   ++E  GL+QVT
Sbjct: 358 EGLAITDSPVSADRLGELIVRVLDDTINGKAAKQVFQALWHGEGDSADAVIEAKGLKQVT 417

Query: 439 DLSAIEKVVDEVINSNPNNVARIA-TKPN----LVSWFVGQVMKNTGGKANPSIVQKMLK 493
           D  AIE ++D+VI  +P  VA+    +P+    ++ +FVGQVMK + G ANP  V  MLK
Sbjct: 418 DTGAIEAMIDQVIADSPAQVAQYRDAEPDKRGKMIGYFVGQVMKASRGTANPQQVNTMLK 477

Query: 494 EKL 496
           EKL
Sbjct: 478 EKL 480


>gi|226951651|ref|ZP_03822115.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter sp. ATCC 27244]
 gi|226837632|gb|EEH70015.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter sp. ATCC 27244]
          Length = 489

 Score =  504 bits (1299), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 247/479 (51%), Positives = 336/479 (70%), Gaps = 11/479 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H +L+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+LN   V  A+  
Sbjct: 13  WEVVIGIEIHTKLATKSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPVLNAEVVDLAIRF 72

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G  + I  
Sbjct: 73  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGTVKRI-- 127

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKSIHDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 128 GVTRAHLEEDAGKSIHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKAIHTLV 187

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 188 RWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 247

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I  + I A +  +PEL
Sbjct: 248 EYGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIISNEQIEAARAALPEL 307

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKIVANWVINDLLGVL 377
           P A+RERFI +FG++ YDA VL   + +AD++E         +  K+ ANWV+ +  G L
Sbjct: 308 PAARRERFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKVSANWVMGEFSGAL 367

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLRQ 436
           N++G  + D+P+S  QLG +I  I+D TI+GKIAK +F  +WE +G +  +I+ E GL+Q
Sbjct: 368 NKAGLDLADSPVSAEQLGGMIARIVDNTINGKIAKQVFGFMWEAEGKSADDIIAEKGLKQ 427

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
            TD  AIE ++ EV+ +N   V    + K    +  VGQVMK   GKANP+ V +++K+
Sbjct: 428 ETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKAAKGKANPAQVNELMKK 486


>gi|255318766|ref|ZP_05359992.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter radioresistens SK82]
 gi|255304022|gb|EET83213.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter radioresistens SK82]
          Length = 493

 Score =  504 bits (1299), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 247/481 (51%), Positives = 338/481 (70%), Gaps = 10/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+LN   V  A+  
Sbjct: 18  WEVVIGIEIHTQLATKSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPVLNKEVVDLAIRF 77

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G  + I  
Sbjct: 78  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGTVKRI-- 132

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKSIHDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 133 GVTRAHLEEDAGKSIHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKAIHTLV 192

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 193 RWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 252

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E  G I QETRLFDP K ETRS+R+KE+A DYRYF +PDLLP+ I ++ I AIK  +PEL
Sbjct: 253 EWDGTIDQETRLFDPVKMETRSMRSKEEANDYRYFPDPDLLPVIIADEQIEAIKATMPEL 312

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV----NRDKKIVANWVINDLLGVL 377
           P A+R RF+ +FG++ YDA VL   + +++++E++          KI ANWV+ +  G L
Sbjct: 313 PAARRARFVADFGVTEYDAHVLTLTREMSEFYEEVVKAAGGAAQGKIAANWVMGEFSGAL 372

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N++   + D+P++  +LG +I  I+D TISGKIAK +F  +WE+G T  EI+ E GL+Q 
Sbjct: 373 NKASLDLADSPVTAEKLGGMIARIVDNTISGKIAKQVFGFMWEEGKTADEIIAEKGLKQE 432

Query: 438 TDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           TD  AIE ++ EV+ +N   V    + K    +  VGQVMK + GKANP+ V +++K+ +
Sbjct: 433 TDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKANPAQVNELMKKLI 492

Query: 497 G 497
           G
Sbjct: 493 G 493


>gi|26987666|ref|NP_743091.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           putida KT2440]
 gi|47115777|sp|Q88PC0|GATB_PSEPK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|24982350|gb|AAN66555.1|AE016284_3 glutamyl-tRNA(Gln) amidotransferase, B subunit [Pseudomonas putida
           KT2440]
          Length = 481

 Score =  504 bits (1299), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 247/482 (51%), Positives = 342/482 (70%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QL+  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN + V+ A M 
Sbjct: 3   WEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNEQAVRMACMF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I K +VFARKNYFYPDLP+GYQISQ D PIVG+G + +++   + G  + I  
Sbjct: 63  GLAIDAEIGKRNVFARKNYFYPDLPKGYQISQMDLPIVGKGHLDIAL---EDGTIKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+H+ +S  + IDLNR+G  L+EIV++PDMRS+ EA A++  + +++
Sbjct: 118 GVTRAHLEEDAGKSLHEDFSGSTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQTEFGTRCEIKNVNSFRFIERAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP+K+ETRS+R+KE+A DYRYF +PDLLP+ I++ F+  I+  +PE
Sbjct: 238 IEDGGKVVQETRLYDPNKDETRSMRSKEEANDYRYFPDPDLLPVVIEDSFLETIRAGLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP  K ERF  ++G+S YDA+VL S +  ADYFE++  +  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKVERFQTQYGLSAYDANVLASSREQADYFEEVVKIGGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I+  P+S  QLG ++  I D TISGKIAK +F  +    G    I+E  GL+QVTD
Sbjct: 358 LGVEIDQAPVSAAQLGGMLLRIRDNTISGKIAKTVFEAMAAGEGDADSIIESKGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNV-----ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AI+K++DE++ +N   V     A  A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 TGAIDKMLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPGQVNQLLKA 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|313497299|gb|ADR58665.1| GatB [Pseudomonas putida BIRD-1]
          Length = 481

 Score =  504 bits (1298), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 247/482 (51%), Positives = 342/482 (70%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QL+  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN + V+ A M 
Sbjct: 3   WEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNEQAVRMACMF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I K +VFARKNYFYPDLP+GYQISQ D PIVG+G + +++   + G  + I  
Sbjct: 63  GLAIDAEIGKRNVFARKNYFYPDLPKGYQISQMDLPIVGKGHLDIAL---EDGTIKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+H+ +S  + IDLNR+G  L+EIV++PDMRS+ EA A++  + +++
Sbjct: 118 GVTRAHLEEDAGKSLHEDFSGSTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQPEFGTRCEIKNVNSFRFIERAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP+K+ETRS+R+KE+A DYRYF +PDLLP+ I++ F+  I+  +PE
Sbjct: 238 IEDGGKVVQETRLYDPNKDETRSMRSKEEANDYRYFPDPDLLPVVIEDSFLETIRAGLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP  K ERF  ++G+S YDA+VL S +  ADYFE++  +  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKVERFQTQYGLSAYDANVLASSREQADYFEEVVKIGGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I+  P+S  QLG ++  I D TISGKIAK +F  +    G    I+E  GL+QVTD
Sbjct: 358 LGVEIDQAPVSAAQLGAMLLRIRDNTISGKIAKTVFEAMAAGEGDADSIIESKGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNV-----ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AI+K++DE++ +N   V     A  A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 TGAIDKMLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPGQVNQLLKA 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|148546213|ref|YP_001266315.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           putida F1]
 gi|166198808|sp|A5VZ21|GATB_PSEP1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|148510271|gb|ABQ77131.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Pseudomonas putida F1]
          Length = 481

 Score =  504 bits (1297), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 247/482 (51%), Positives = 341/482 (70%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QL+  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ A M 
Sbjct: 3   WEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNEEAVRMACMF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I K +VFARKNYFYPDLP+GYQISQ D PIVG+G + +++   + G  + I  
Sbjct: 63  GLAIDAEIGKRNVFARKNYFYPDLPKGYQISQMDLPIVGKGHLDIAL---EDGTIKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+H+ +S  + IDLNR+G  L+EIV++PDMRS+ EA A++  + +++
Sbjct: 118 GVTRAHLEEDAGKSLHEDFSGSTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQTEFGTRCEIKNVNSFRFIERAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP+K+ETRS+R+KE+A DYRYF +PDLLP+ I++ F+  I+  +PE
Sbjct: 238 IEDGGKVVQETRLYDPNKDETRSMRSKEEANDYRYFPDPDLLPVVIEDSFLETIRAGLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP  K ERF  ++G+S YDA+VL S +  ADYFE++  +  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKVERFQTQYGLSAYDANVLASSREQADYFEEVVKIGGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I+  P+S  QLG ++  I D TISGKIAK +F  +    G    I+E  GL+QVTD
Sbjct: 358 LGVEIDQAPVSAAQLGGMLLRIRDNTISGKIAKTVFEAMAAGEGDADSIIESKGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNV-----ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AI+K++DE++ +N   V     A  A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 TGAIDKMLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPGQVNQLLKA 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|104780287|ref|YP_606785.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           entomophila L48]
 gi|166198806|sp|Q1IED4|GATB_PSEE4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|95109274|emb|CAK13971.1| glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Pseudomonas
           entomophila L48]
          Length = 481

 Score =  504 bits (1297), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 245/482 (50%), Positives = 343/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QL+  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ A M 
Sbjct: 3   WEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNQEAVRMACMF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I   +VFARKNYFYPDLP+GYQISQ D PIVG+G + +++   + G  + I  
Sbjct: 63  GLAIDAEIGPRNVFARKNYFYPDLPKGYQISQMDLPIVGKGHLDIAL---EDGTIKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+H+ ++  + IDLNR+G  L+EIV++PDMRS+ EA A++  + +++
Sbjct: 118 GVTRAHLEEDAGKSLHEDFNGATGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVSV   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSVRPKGQVEFGTRCEIKNVNSFRFIERAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP+K+ETRS+R+KE+A DYRYF +PDLLP+ I++ F+ +++  +PE
Sbjct: 238 IEDGGKVVQETRLYDPNKDETRSMRSKEEANDYRYFPDPDLLPVVIEQSFLDSVRAALPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNR 379
           LP  K ERF  ++G+S YDA+VL S +  ADYFE+ +++  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPTQKVERFQSQYGLSAYDANVLASSREQADYFEQVVSIGGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I+ +P+S  QLG ++  I D TISGKIAK +F  +    G    I+E  GL+QVTD
Sbjct: 358 LGVEIDQSPVSAEQLGGMLLRIRDNTISGKIAKTVFEAMAAGEGDADSIIESKGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNV-----ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AI+K++DE++ +N   V     A  A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 TGAIDKMLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPGQVNQLLKA 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|262368934|ref|ZP_06062263.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter johnsonii SH046]
 gi|262316612|gb|EEY97650.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter johnsonii SH046]
          Length = 491

 Score =  503 bits (1296), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 246/481 (51%), Positives = 335/481 (69%), Gaps = 10/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+LN   V  A+  
Sbjct: 16  WEVVIGIEIHTQLATQSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPVLNKEVVDLAIRF 75

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G  + I  
Sbjct: 76  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGTVKRI-- 130

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKSIHDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 131 GVTRAHLEEDAGKSIHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKSIHTLV 190

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 191 RWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 250

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E  G I QETRLFDP K ETRS+R+KE+A DYRYF +PDLLP+ I +  I   +  +PEL
Sbjct: 251 EWDGTIDQETRLFDPVKMETRSMRSKEEANDYRYFPDPDLLPVIISDAQIETARAALPEL 310

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKIVANWVINDLLGVL 377
           P A+RERF+ +FG++ YDA VL   + ++D++E            K+ ANWV+ +  G L
Sbjct: 311 PAARRERFVADFGVTEYDAHVLTLTREMSDFYEVVVAAAGGAAQGKVSANWVMGEFSGAL 370

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N++G  + D+P+S  +LG +I  I+D TISGKIAK +F  +W++G T  EI+ E GL+Q 
Sbjct: 371 NKAGLELADSPVSAEKLGGMIARIVDNTISGKIAKQVFGFMWDEGKTADEIIAEKGLKQE 430

Query: 438 TDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           TD  AIE ++ EV+ +N   V    + K    +  VGQVMK + GKANP+ V +++K+ +
Sbjct: 431 TDTGAIEAIIKEVLAANEKMVEEFKSGKEKAFNGLVGQVMKASKGKANPAQVNELMKKLI 490

Query: 497 G 497
           G
Sbjct: 491 G 491


>gi|262281194|ref|ZP_06058976.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter calcoaceticus RUH2202]
 gi|262257425|gb|EEY76161.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter calcoaceticus RUH2202]
          Length = 489

 Score =  503 bits (1295), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 247/482 (51%), Positives = 339/482 (70%), Gaps = 11/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+LN + V  A+  
Sbjct: 13  WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLIDLAMPGVLPVLNEKVVDLAIRF 72

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +   + G   T  +
Sbjct: 73  GLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL---EDGT--TKRI 127

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  EA A++  + +++
Sbjct: 128 GVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKSIHTLV 187

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  AI  E  RQ+ IL
Sbjct: 188 RWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQAINVEIERQMEIL 247

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I ++ I A +  +PEL
Sbjct: 248 EYGGSIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIADEQIEAARAALPEL 307

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK----KIVANWVINDLLGVL 377
           P A+R RFI +FG++ YDA VL   + +AD++E +          K+ ANWV+ +  G L
Sbjct: 308 PAARRTRFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAAQGKVSANWVMGEFSGAL 367

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLRQ 436
           N++   + D+P+S  QLG +I  I+D TISGKIAK +F  +WE +G +  +I+ E GL+Q
Sbjct: 368 NKANLDLADSPVSAEQLGGMIARIVDNTISGKIAKQVFGFMWESEGKSADDIIAEKGLKQ 427

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
            TD  AIE ++ EV+ +N   V    + K    +  VGQVMK + GKANP+ V +++K+ 
Sbjct: 428 ETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKANPAQVNELMKKL 487

Query: 496 LG 497
           +G
Sbjct: 488 IG 489


>gi|78485968|ref|YP_391893.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Thiomicrospira
           crunogena XCL-2]
 gi|109892075|sp|Q31F54|GATB_THICR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|78364254|gb|ABB42219.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Thiomicrospira crunogena XCL-2]
          Length = 475

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 246/477 (51%), Positives = 340/477 (71%), Gaps = 7/477 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+HAQL+  +K+FSG+S+++GA PNTQ +  D  MPG LP+LN   + +A+  
Sbjct: 3   WEVVIGLEIHAQLTTKTKIFSGSSIDYGAAPNTQANLLDLGMPGQLPVLNKAVIPKAIKL 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL L A I + SVF RKNYFYPDLP+GYQ SQ   PIV  G V V I  D  G+ + I  
Sbjct: 63  GLALGAKIGRRSVFDRKNYFYPDLPKGYQTSQFSFPIVDTGGV-VEIEVD--GEIKKI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKSIHD +   + IDLNR+G  L+EIV++PDMRS+ EA A+  K+  ++
Sbjct: 118 GVTRAHLEEDAGKSIHDAFPGQTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYAKKMHELV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           +YLG CDGNM+EGS R D NVS+ +PG  +GTR E+KN+NS +F+  AIE E  RQI +L
Sbjct: 178 QYLGICDGNMQEGSFRVDSNVSIHKPGTPFGTRAELKNINSFKFIEQAIELEIERQIEVL 237

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           E GG + QETRL+D  KNETRS+R KE+A DYRYF  PDLLP+ I E+ I AI+ ++PE+
Sbjct: 238 ESGGKVVQETRLYDADKNETRSMREKEEANDYRYFPCPDLLPVVITEEDIEAIRAEMPEM 297

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLNRS 380
           PDAKR+R++ +FG+S YDA+ L   +++A+YFE  +A   + K+ ANWV+ +L   LN+ 
Sbjct: 298 PDAKRKRYVADFGLSDYDAAFLTGSRAMAEYFEAVVAKTNEAKVSANWVMGELSKSLNQK 357

Query: 381 GKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDL 440
           G  I ++P+S + L  LI+ I D TISGKIAK +F+ +W   G+  EI+E+ GL+Q+TD 
Sbjct: 358 GIDISESPVSADMLAGLIERIQDNTISGKIAKQVFDGMWSGEGSADEIIEQKGLKQITDS 417

Query: 441 SAIEKVVDEVINSNPNNV-ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           SAIE +V++V+ +N   V A    +  +  +FVGQVMK + G+ANP+ V ++LK+KL
Sbjct: 418 SAIEALVNDVLANNAAQVEAYKGGQEKMFGFFVGQVMKASQGQANPAQVNQVLKDKL 474


>gi|167031952|ref|YP_001667183.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           putida GB-1]
 gi|189045148|sp|B0KQF9|GATB_PSEPG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|166858440|gb|ABY96847.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Pseudomonas putida
           GB-1]
          Length = 481

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 246/482 (51%), Positives = 341/482 (70%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E+H QL+  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ A M 
Sbjct: 3   WEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNQEAVRMACMF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I K +VFARKNYFYPDLP+GYQISQ D PIVG+G + +++   + G  + I  
Sbjct: 63  GLAIDAEIGKRNVFARKNYFYPDLPKGYQISQMDLPIVGKGHLDIAL---EDGTIKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+H+ +S  + IDLNR+G  L+EIV++PDMRS+ EA A++  + +++
Sbjct: 118 GVTRAHLEEDAGKSLHEDFSGSTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM EGS+R D NVS+   G+  +GTRCE+KNVNS RF+  AI  E +RQI +
Sbjct: 178 RYLGICDGNMAEGSLRCDCNVSIRPKGQTEFGTRCEIKNVNSFRFIERAINSEIQRQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP+K+ETRS+R+KE+A DYRYF +PDLLP+ I++ F+  I+  +PE
Sbjct: 238 IEDGGKVVQETRLYDPNKDETRSMRSKEEANDYRYFPDPDLLPVVIEDSFLDTIRAGLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP  K ERF  ++G+S YDA+VL S +  ADYFE++  +  D K+ ANWV+ +L  +LN+
Sbjct: 298 LPPQKVERFQSQYGLSAYDANVLASSREQADYFEEVVKIGGDAKLAANWVMVELGSLLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  I+  P+S  QLG ++  I D TISGKIAK +F  +    G    I++  GL+QVTD
Sbjct: 358 LGVEIDQAPVSAAQLGGMLLRIRDNTISGKIAKTVFEAMAAGEGDADSIIDSKGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNV-----ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             AI+K++DE++ +N   V     A  A +  +  +FVGQ MK + GKANP  V ++LK 
Sbjct: 418 TGAIDKMLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPGQVNQLLKA 477

Query: 495 KL 496
           KL
Sbjct: 478 KL 479


>gi|68171132|ref|ZP_00544541.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88658061|ref|YP_507609.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ehrlichia
           chaffeensis str. Arkansas]
 gi|109892023|sp|Q2GG24|GATB_EHRCR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|67999457|gb|EAM86097.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88599518|gb|ABD44987.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 481

 Score =  502 bits (1292), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 254/487 (52%), Positives = 337/487 (69%), Gaps = 12/487 (2%)

Query: 13  SLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASV-NFGAEPNTQVSFFDAAMPGMLPILN 71
           ++  G   DWEVVIG+EVHAQ+   SKLFSGAS   + A PNTQV+ FD AMPGMLP+LN
Sbjct: 2   TIIKGNRCDWEVVIGLEVHAQVISNSKLFSGASTKTYDALPNTQVALFDVAMPGMLPVLN 61

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QA+ TG+ L+  INKYS F RKNYFYPDLP GYQI+Q   PI  EGK+ +     
Sbjct: 62  EYCVYQAIKTGIALSCKINKYSAFDRKNYFYPDLPSGYQITQFYYPIATEGKIVLEDHDM 121

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
           K       E+ I RIHLEQDAGKSIH+     + ID NR+GVALMEIV++PD RS  E  
Sbjct: 122 K-------EIRIARIHLEQDAGKSIHE--FDKTYIDFNRAGVALMEIVSEPDFRSIEEVA 172

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAI 250
            +L KLR ILR++ TCDG+ME+GS+R D NVSV   G +  G R E+KN+NSIR++  AI
Sbjct: 173 EYLKKLRMILRFIETCDGDMEKGSLRCDANVSVKPVGSSELGIRSEIKNLNSIRYVMQAI 232

Query: 251 EYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDF 310
           EYEA RQ+  LE+G  + Q T LFD +  +TR +RTKEDA DYRYF +PDL PL+ID+ +
Sbjct: 233 EYEANRQVNALENGEIVTQNTLLFDVTSGQTRVIRTKEDAHDYRYFPDPDLFPLKIDDQY 292

Query: 311 IRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVI 370
           I  ++  +PELP  KRER+  +F +S YDA +L SDK +A YFEK+A   D K+ A+W+ 
Sbjct: 293 IDHVRSSLPELPMQKRERYTNDFSLSKYDADILSSDKDVAIYFEKVAEKHDGKLAASWIT 352

Query: 371 NDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVE 430
            +L G LNR G +I ++ ++   L +L+DLI++ TISGKIAK +F++++E G +P  IV 
Sbjct: 353 GELFGRLNRLGITIGESSVTAEDLIQLLDLIVNNTISGKIAKQVFDMMFESGKSPALIVS 412

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQ 489
           E GL+QV+D +A+  +V+ V+ +N + V      K  L  +FVGQVMK T GKANP +V 
Sbjct: 413 EHGLKQVSDENALSVIVERVLKNNASKVVEYKQGKEKLFGYFVGQVMKETQGKANPDMVN 472

Query: 490 KMLKEKL 496
            ++K++L
Sbjct: 473 SIIKQQL 479


>gi|121997793|ref|YP_001002580.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Halorhodospira
           halophila SL1]
 gi|166217763|sp|A1WVR6|GATB_HALHL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|121589198|gb|ABM61778.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Halorhodospira halophila SL1]
          Length = 479

 Score =  501 bits (1291), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 247/481 (51%), Positives = 337/481 (70%), Gaps = 13/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQL+  +K+FSGA   +GAEPNTQ    D  +PG+LP+LN   V+ A+  
Sbjct: 3   WETVIGLEIHAQLATRTKIFSGAPTAYGAEPNTQACPVDLGLPGVLPVLNREVVRMAIKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I   SVFARKNYFYPDLP+GYQISQ+D PIV  G + + +    S +     +
Sbjct: 63  GLAVDARIAPRSVFARKNYFYPDLPKGYQISQYDLPIVEGGHLDIELEDGASKR-----I 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  ++ +DLNR+G  LMEIV++PD+RS  EA A++ KL +++
Sbjct: 118 GITRAHLEEDAGKSLHEDFHGMTGVDLNRAGTPLMEIVSEPDLRSPAEAAAYMKKLHALV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           RYL  CDGNM+EGS R D NVSV RP   EA+GTR E+KN+NS RF+  A+EYE  RQI 
Sbjct: 178 RYLEICDGNMQEGSFRCDANVSV-RPVGQEAFGTRAELKNLNSFRFVERALEYEVERQID 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           +LE GG + QETRL+D  K  TRS+RTKE+A DYRYF EPDLLP+E+D   +  +++ +P
Sbjct: 237 LLESGGEVVQETRLYDVDKGVTRSMRTKEEANDYRYFPEPDLLPVEVDAALVDEVRETLP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRD---KKIVANWVINDLLGV 376
           ELPD KR RF  E+G+  YDA VL + + +AD+FE  AV+      K  AN ++++LL  
Sbjct: 297 ELPDEKRRRFEEEYGLPAYDAGVLTATRDMADFFEH-AVSESGGFAKRTANLLMSELLAY 355

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN+ G  I ++P++P  LG+L+  + D T+S + AKD+F  +W   G P E++E+ GL+Q
Sbjct: 356 LNKDGLEIAESPVTPEMLGKLVARVEDETLSSRGAKDVFEAMWAGEGEPDEVIEKKGLKQ 415

Query: 437 VTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           VTD SAIE +VDE I +NP  + +  A K  L  +FVGQVMK +GGKANP  V ++LK+K
Sbjct: 416 VTDTSAIEALVDEAIANNPQQLEQYRAGKEKLFGFFVGQVMKASGGKANPQQVNELLKKK 475

Query: 496 L 496
           L
Sbjct: 476 L 476


>gi|325980991|ref|YP_004293393.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Nitrosomonas sp.
           AL212]
 gi|325530510|gb|ADZ25231.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Nitrosomonas sp.
           AL212]
          Length = 479

 Score =  501 bits (1290), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 254/483 (52%), Positives = 338/483 (69%), Gaps = 16/483 (3%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE+VIG+EVHAQLS  SK+FSGAS  +GA PNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 3   WEIVIGLEVHAQLSTQSKIFSGASTAYGAPPNTQACVIDLALPGVLPVLNKGAVERAIRF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSGQFRTIE 140
           GL + A IN  S+FARKNYFYPDLP+GYQISQ++ P+V  G + +   G +K+       
Sbjct: 63  GLSVGAKINSPSIFARKNYFYPDLPKGYQISQYELPVVQGGNIRIPADGVEKN------- 115

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           + + R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PDMRSS EA  +   L ++
Sbjct: 116 IRLTRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDMRSSAEAVTYAKTLHAL 175

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG--EAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           +R++G CDGNM+EGS R D NVSV RP   E  GTRCE+KN+NS RFL  AI+YEARRQI
Sbjct: 176 VRWIGICDGNMQEGSFRCDANVSV-RPRGIEKLGTRCEIKNLNSFRFLEKAIDYEARRQI 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ILEDGG IRQETRL+D +K+ETR++RTKEDA DYRYF +PDLLPLEI   +I  ++  +
Sbjct: 235 EILEDGGAIRQETRLYDANKDETRTMRTKEDANDYRYFPDPDLLPLEIPASWIDQVRSAL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL--AVNRDKKIVANWVINDLLGV 376
           PELP  +R+R++ EF +S YDASVL S +  ADYFE     +   +K+ ANW++ ++ G 
Sbjct: 295 PELPQVRRDRYMSEFALSAYDASVLTSSRETADYFESTIRQLPAQEKLCANWIMGEISGQ 354

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW--EKGGTPKEIVEELGL 434
           LN+ G  I   PI+P+QL  L++ I DGTISGK AK +F  +W  E       I+   GL
Sbjct: 355 LNKEGLEISACPITPSQLAMLLERISDGTISGKAAKTVFESMWNGELEKNVDAIIAVKGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           +Q++D SAIEK+VD+V+ +N   VA     K    +  VGQ+MK T GKANP+ V  +LK
Sbjct: 415 KQISDDSAIEKLVDQVLAANAQQVADYRNGKEKAFNSLVGQIMKATHGKANPAQVNVILK 474

Query: 494 EKL 496
           +KL
Sbjct: 475 KKL 477


>gi|326795033|ref|YP_004312853.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Marinomonas mediterranea MMB-1]
 gi|326545797|gb|ADZ91017.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Marinomonas mediterranea MMB-1]
          Length = 481

 Score =  501 bits (1289), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 247/483 (51%), Positives = 339/483 (70%), Gaps = 12/483 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WEVVIG+E+HAQL+  SKLFSGA+ +FGAEPNT  +  D  MPG LP+ N   ++ AVM
Sbjct: 2   NWEVVIGLEIHAQLATKSKLFSGAATSFGAEPNTNTTLVDLGMPGALPVFNKEALRMAVM 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            G  ++A I   SVFARKNYFYPDLP+GYQ SQ D PIVG G + V++   + G      
Sbjct: 62  FGHAVDAEIGMTSVFARKNYFYPDLPKGYQTSQMDHPIVGPGHLDVTL---EDGT--VTR 116

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           VGI R HLE+DAGKS+H+ +  ++ IDLNRS   L+EIV++PD+RS+ EA A++  + SI
Sbjct: 117 VGITRAHLEEDAGKSLHEDFHGMTGIDLNRSSTPLLEIVSEPDIRSAKEAVAYVKMIHSI 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           + YLG CDGNM EGSMR DVN+S+   G E +GTR E+KNVNS RF+  AI  E  RQ+ 
Sbjct: 177 VTYLGICDGNMAEGSMRCDVNLSLRPKGQEEFGTRTEIKNVNSFRFIEKAIYCEIERQMD 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ILEDGG I QETRL+DP K+ETRS+R+KEDA DYRYF  PDLLP+ +D++++  I+  +P
Sbjct: 237 ILEDGGKIVQETRLYDPDKDETRSMRSKEDANDYRYFPCPDLLPIVLDDEYVEEIRANLP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLN 378
           ELP  K +RF  E+ +S YDA VL S +++ADYFE  A   ++ K+ ANWV+ ++   LN
Sbjct: 297 ELPTQKAKRFEAEYALSEYDAGVLSSSRAMADYFEDAAKTAKNSKLAANWVMGEVSKFLN 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           +    I ++P+S   LG+L+  I D TI+GK AKD+F  +W+  G+  EI+E+ GL+QVT
Sbjct: 357 QENLDITESPVSAQALGQLLSRIEDNTINGKTAKDVFQSMWQGEGSADEIIEKKGLKQVT 416

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPN----LVSWFVGQVMKNTGGKANPSIVQKMLK 493
           D  AIE ++  VI++NP  V +  A++P+    ++ +F+GQVMK + GKANP +V  +L 
Sbjct: 417 DTGAIETLIQSVIDANPAQVEQFKASEPDKQKKMIGFFMGQVMKASQGKANPGLVTPILN 476

Query: 494 EKL 496
           + L
Sbjct: 477 KLL 479


>gi|58617013|ref|YP_196212.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ehrlichia
           ruminantium str. Gardel]
 gi|75432792|sp|Q5FHD2|GATB_EHRRG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|58416625|emb|CAI27738.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ehrlichia ruminantium str. Gardel]
          Length = 481

 Score =  501 bits (1289), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 252/487 (51%), Positives = 334/487 (68%), Gaps = 14/487 (2%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASV-NFGAEPNTQVSFFDAAMPGMLPILNG 72
           +  G   DWE++IG+EVHAQ+   SKLFSGAS   + + PNTQVS FD AMPGMLP+LN 
Sbjct: 3   IIKGKKCDWEMIIGLEVHAQVISNSKLFSGASAKTYDSLPNTQVSLFDVAMPGMLPLLNQ 62

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
            C+ QAV TGL L+  IN YS F RKNYFYPDLP GYQI+Q   PI  +GKV +    DK
Sbjct: 63  YCISQAVKTGLALSCKINNYSAFDRKNYFYPDLPSGYQITQFYYPIATDGKVVLEESNDK 122

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKA 192
                  EV I RIHLEQDAGKSIH+     + +D NR+GVALMEIV++PD+RS+ E   
Sbjct: 123 -------EVRITRIHLEQDAGKSIHEY--GKTYVDFNRAGVALMEIVSEPDLRSTDEVAE 173

Query: 193 FLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAI 250
           +L KLR ILR++GTCDG+ME+GS R D NVSV RP   +  G R E+KN+NSIR++  AI
Sbjct: 174 YLKKLRMILRFIGTCDGDMEKGSFRCDANVSV-RPLGSDKLGIRSEIKNLNSIRYVVQAI 232

Query: 251 EYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDF 310
           EYEA +Q+  LE+G  + Q T LFD    ETR +R KEDA DYRYF +PDL  LEID+ +
Sbjct: 233 EYEANKQVMALENGEELIQNTLLFDVILGETRVIRNKEDAHDYRYFPDPDLFSLEIDDQY 292

Query: 311 IRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVI 370
           I  +K  +PELP  KR+R+I +F ++ YDA +LV+D+ +A YFE++    D K+ A+W++
Sbjct: 293 ISEVKLSLPELPMQKRDRYIRDFKLNKYDADILVADRDVAAYFEEVVQKHDAKLAASWIV 352

Query: 371 NDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVE 430
            DL   LN+ G SI ++ +    + +L+DLI+D TISGKIAK +F I++E G +P  IV 
Sbjct: 353 CDLFARLNKLGISINESAVKAGDMIQLLDLIVDKTISGKIAKQVFAIMFESGKSPISIVN 412

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQ 489
           E GL+Q+ D  ++  +V+ V+ +N + V +    K  L  +FVGQVMK T GKANP +V 
Sbjct: 413 EYGLKQLDDSDSVSMIVENVLENNKDKVLQYKQGKEKLFGYFVGQVMKETQGKANPELVN 472

Query: 490 KMLKEKL 496
            ++KEKL
Sbjct: 473 SIIKEKL 479


>gi|261855844|ref|YP_003263127.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Halothiobacillus
           neapolitanus c2]
 gi|261836313|gb|ACX96080.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Halothiobacillus
           neapolitanus c2]
          Length = 492

 Score =  500 bits (1288), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 244/485 (50%), Positives = 331/485 (68%), Gaps = 8/485 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQL+  SK+FSGAS  FGAEPN Q    D  +PG+LP+LN   V  A + 
Sbjct: 7   WETVIGLEIHAQLATKSKIFSGASTAFGAEPNVQACAVDLGLPGVLPVLNAEAVHMAALF 66

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + AH+   S F RKNYFYPDLP+GYQISQ  +PIV  G V+++ G  +    +TI  
Sbjct: 67  GLAIGAHVAPVSTFDRKNYFYPDLPKGYQISQLAQPIVSGGSVTITTGEGEKAVNKTIN- 125

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIV++P+MRSS EA A+  K+ +I+
Sbjct: 126 -LTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLIEIVSEPEMRSSAEAVAYARKVHAIV 184

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           +YLG CDGNM+EGS R D NVSV   GE   GTR E+KNVNS RFL  AI+YE  RQI +
Sbjct: 185 QYLGICDGNMQEGSFRVDANVSVRPKGETKLGTRTEIKNVNSFRFLERAIDYEITRQIEL 244

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG ++Q+TRL+DP K+ETR +RTKE A DYRYF +PDLLP+ ID+  +   K  +PE
Sbjct: 245 IEDGGTVQQQTRLYDPDKDETRMMRTKEAADDYRYFPDPDLLPVVIDQALLAEWKASLPE 304

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK----LAVNRDKKIVANWVINDLLGV 376
           LPDAK  R+  ++G+S YDA VL S ++IA YFE+    +    D K+ ANWV   L   
Sbjct: 305 LPDAKAARYQSDYGLSPYDAGVLTSARAIATYFEQTLNSMGAAADAKLCANWVTGALAAQ 364

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++   IE +P+S + L  L+  + D T+S K+AK++F+ +W   G    I++  GL+Q
Sbjct: 365 LNKANLGIEQSPVSSDALAGLLLRVADNTLSNKLAKEVFDAMWAGEGDADSIIDARGLKQ 424

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           +TD SAIE +VDE++ +NP  VA   + K  L  +FVGQVMK   GKANP  + ++LK +
Sbjct: 425 ITDSSAIEAMVDEILAANPGKVAEYRSGKDKLFGFFVGQVMKAAQGKANPQQLNEVLKAR 484

Query: 496 LGIKE 500
           LG  E
Sbjct: 485 LGPSE 489


>gi|254447894|ref|ZP_05061359.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [gamma
           proteobacterium HTCC5015]
 gi|198262674|gb|EDY86954.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [gamma
           proteobacterium HTCC5015]
          Length = 495

 Score =  500 bits (1287), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 247/487 (50%), Positives = 345/487 (70%), Gaps = 12/487 (2%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           G    WEVVIG+E+HAQL+  SK+FSGAS  +GA PN+Q    D  +PG+LP+LN   V+
Sbjct: 12  GKKMSWEVVIGLEIHAQLATQSKIFSGASTAYGAAPNSQACAVDLGLPGVLPVLNKSVVE 71

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
            AV  GL ++A I + SVFARKNYFYPDLP+GYQISQ++ PIVG+G + + +   + G+ 
Sbjct: 72  MAVKFGLAIDAEIGQRSVFARKNYFYPDLPKGYQISQYELPIVGQGYLDIEL---EDGE- 127

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            T  +G+ R HLE+DAGKS+H+ + +++ IDLNR+G  L+EIV++PDMRS+ EA A++ K
Sbjct: 128 -TKRIGVTRAHLEEDAGKSVHEGFGSMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYMKK 186

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEAR 255
           + ++++YLG CDGNM+EGS R D NVSV   G+A +GTR E+KN+NS RF+  AI YE  
Sbjct: 187 MHALVQYLGICDGNMQEGSFRCDANVSVRPVGQAEFGTRAELKNLNSFRFIERAINYEVE 246

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++E GG + QETRL+D  K+ETRS+R KEDA DYRYF +PDLLP+ + ++ I  I+
Sbjct: 247 RQIDVIEGGGEVVQETRLYDADKDETRSMRGKEDANDYRYFPDPDLLPVAVTDEDIETIR 306

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANWVINDLL 374
             +PELPDAKR+R++ E G+  YDA VL + K++ADY+E  LA   D K+ ANW+  +L 
Sbjct: 307 STLPELPDAKRQRYVSELGLPEYDAGVLTASKAVADYYEAALAAGADAKLAANWINGELA 366

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
             LN++  +I+++P++P  L  L+  I D TISGKIAK +F  LW   G+  +I+E  GL
Sbjct: 367 AALNKNELNIDESPVTPVALSGLLSRIADDTISGKIAKQVFEALWNGEGSADDIIEAKGL 426

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIATKP-----NLVSWFVGQVMKNTGGKANPSIVQ 489
           +Q+TD SAIE ++DEV+ +N   V      P      ++ +FVGQVMK T GKANP  V 
Sbjct: 427 KQITDTSAIEGIIDEVMANNGEQVDNYRAAPEDKRGKMIGYFVGQVMKATQGKANPGQVN 486

Query: 490 KMLKEKL 496
           ++LK+KL
Sbjct: 487 QLLKQKL 493


>gi|57239016|ref|YP_180152.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ehrlichia
           ruminantium str. Welgevonden]
 gi|81637922|sp|Q5HBP2|GATB_EHRRW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|57161095|emb|CAH58002.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 481

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 253/487 (51%), Positives = 334/487 (68%), Gaps = 14/487 (2%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASV-NFGAEPNTQVSFFDAAMPGMLPILNG 72
           +  G   DWE++IG+EVHAQ+   SKLFSGAS   + + PNTQVS FD AMPGMLP+LN 
Sbjct: 3   IIKGKKCDWEMIIGLEVHAQVISNSKLFSGASAKTYDSLPNTQVSLFDVAMPGMLPLLNQ 62

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
            C+ QAV TGL L+  IN YS F RKNYFYPDLP GYQI+Q   PI  +GKV +    DK
Sbjct: 63  YCISQAVKTGLALSCKINNYSAFDRKNYFYPDLPSGYQITQFYYPIATDGKVVLEESNDK 122

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKA 192
                  EV I RIHLEQDAGKSIH+     + +D NR+GVALMEIV++PD+RS+ E   
Sbjct: 123 -------EVRITRIHLEQDAGKSIHEY--GKTYVDFNRAGVALMEIVSEPDLRSTDEVAE 173

Query: 193 FLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAI 250
           +L KLR ILR++GTCDG+ME+GS R D NVSV RP   +  G R E+KN+NSIR++  AI
Sbjct: 174 YLKKLRMILRFIGTCDGDMEKGSFRCDANVSV-RPLGSDKLGIRSEIKNLNSIRYVVQAI 232

Query: 251 EYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDF 310
           EYEA RQ+  LE+G  + Q T LFD    ETR +R KEDA DYRYF +PDL  LEID+ +
Sbjct: 233 EYEANRQVIALENGEELIQNTLLFDVILGETRVIRNKEDAHDYRYFPDPDLFSLEIDDQY 292

Query: 311 IRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVI 370
           I  +K  +PELP  KR+R+I +F ++ YDA +LV+D+ +A YFE++    D K+ A+W++
Sbjct: 293 ISEVKLSLPELPIQKRDRYIRDFKLNKYDADILVADRDVAAYFEEVVQKHDAKLAASWIV 352

Query: 371 NDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVE 430
            DL   LN+ G SI ++ +    + +L+DLI+D TISGKIAK +F I++E G +P  IV 
Sbjct: 353 CDLFARLNKLGISINESAVKAGDMIQLLDLIVDKTISGKIAKQVFAIMFESGKSPISIVN 412

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQ 489
           E GL+Q+ D  ++  +V+ V+ +N + V +    K  L  +FVGQVMK T GKANP +V 
Sbjct: 413 EYGLKQLDDGDSVSVIVENVLANNKDKVLQYKQGKEKLFGYFVGQVMKETQGKANPELVN 472

Query: 490 KMLKEKL 496
            ++KEKL
Sbjct: 473 SIIKEKL 479


>gi|58578955|ref|YP_197167.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58417581|emb|CAI26785.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ehrlichia ruminantium str. Welgevonden]
          Length = 481

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 253/487 (51%), Positives = 334/487 (68%), Gaps = 14/487 (2%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASV-NFGAEPNTQVSFFDAAMPGMLPILNG 72
           +  G   DWE++IG+EVHAQ+   SKLFSGAS   + + PNTQVS FD AMPGMLP+LN 
Sbjct: 3   IIKGKKCDWEMIIGLEVHAQVISNSKLFSGASAKTYDSLPNTQVSLFDVAMPGMLPLLNQ 62

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
            C+ QAV TGL L+  IN YS F RKNYFYPDLP GYQI+Q   PI  +GKV +    DK
Sbjct: 63  YCISQAVKTGLALSCKINNYSAFDRKNYFYPDLPSGYQITQFYYPIATDGKVVLEESNDK 122

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKA 192
                  EV I RIHLEQDAGKSIH+     + +D NR+GVALMEIV++PD+RS+ E   
Sbjct: 123 -------EVRITRIHLEQDAGKSIHEY--GKTYVDFNRAGVALMEIVSEPDLRSTDEVAE 173

Query: 193 FLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAI 250
           +L KLR ILR++GTCDG+ME+GS R D NVSV RP   +  G R E+KN+NSIR++  AI
Sbjct: 174 YLKKLRMILRFIGTCDGDMEKGSFRCDANVSV-RPLGSDKLGIRSEIKNLNSIRYVVQAI 232

Query: 251 EYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDF 310
           EYEA RQ+  LE+G  + Q T LFD    ETR +R KEDA DYRYF +PDL  LEID+ +
Sbjct: 233 EYEANRQVIALENGEELIQNTLLFDVILGETRVIRNKEDAHDYRYFPDPDLFSLEIDDQY 292

Query: 311 IRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVI 370
           I  +K  +PELP  KR+R+I +F ++ YDA +LV+D+ +A YFE++    D K+ A+W++
Sbjct: 293 ISEVKLSLPELPMQKRDRYIRDFKLNKYDADILVADRDVAAYFEEVVQKHDAKLAASWIV 352

Query: 371 NDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVE 430
            DL   LN+ G SI ++ +    + +L+DLI+D TISGKIAK +F I++E G +P  IV 
Sbjct: 353 CDLFARLNKLGISINESAVKAGDMIQLLDLIVDKTISGKIAKQVFAIMFESGKSPISIVN 412

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQ 489
           E GL+Q+ D  ++  +V+ V+ +N + V +    K  L  +FVGQVMK T GKANP +V 
Sbjct: 413 EYGLKQLDDGDSVSVIVENVLANNKDKVLQYKQGKEKLFGYFVGQVMKETQGKANPELVN 472

Query: 490 KMLKEKL 496
            ++KEKL
Sbjct: 473 SIIKEKL 479


>gi|288942489|ref|YP_003444729.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Allochromatium
           vinosum DSM 180]
 gi|288897861|gb|ADC63697.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Allochromatium
           vinosum DSM 180]
          Length = 477

 Score =  499 bits (1285), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 245/478 (51%), Positives = 333/478 (69%), Gaps = 8/478 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+H QL+  SK+FSGA   FGAEPNTQ    D  +PG+LP+LN   V+ AV  
Sbjct: 3   WETVIGLEIHTQLATQSKIFSGAPTAFGAEPNTQACAIDLGLPGVLPVLNVEAVRLAVRF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           G  ++A I   SVFARKNYFYPDLP+GYQISQ++ P+VG+G+V + +     G  +TI  
Sbjct: 63  GKAIDAEIAPRSVFARKNYFYPDLPKGYQISQYELPVVGKGRVEIVL---DDGTVKTI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R HLE+DAGKS+H+ +   + IDLNR+G  L+EIV++PD+RS  EA A+  K+  I+
Sbjct: 118 GVTRAHLEEDAGKSLHEDFHGFTGIDLNRAGTPLLEIVSEPDLRSPAEAVAYAKKIHQIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RY+G  DGNM+EGS R D NVSV   G+  +GTR E+KNVNS RFL  AI +E  RQI +
Sbjct: 178 RYIGISDGNMQEGSFRMDANVSVRPVGQKEFGTRAEIKNVNSFRFLEKAIAFEVERQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +E GG + QETRL+D  K+ETRS+RTKE+A DYRYF +PDLLPLEID+ F+      +PE
Sbjct: 238 IEGGGTVVQETRLYDAVKDETRSMRTKEEANDYRYFPDPDLLPLEIDDAFLTEATADLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LPDAKR RF  E+G+S YDA++L + + +ADY+E +A    + K+ ANWV  +L+  LN+
Sbjct: 298 LPDAKRARFQSEYGLSEYDANLLTASRELADYYETVARACGEPKLAANWVSGELMAALNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           S   I  +P+S + L  LI  I DGT+SGK+AK +F  +W  GG    ++E  GL+Q+TD
Sbjct: 358 SECEIGASPVSASALAGLIARIQDGTVSGKLAKQVFEGMWNGGGEADAVIEAQGLKQITD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
             AIE +++ ++ +NP  V +  A K  +  +FVGQVMK +GGKANP+ V ++LK KL
Sbjct: 418 TGAIESMIEAIVAANPEQVEQYRAGKDKVFGFFVGQVMKQSGGKANPAQVNEILKRKL 475


>gi|329909902|ref|ZP_08275144.1| Aspartyl-tRNA(Asn) amidotransferase subunit B [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327546371|gb|EGF31384.1| Aspartyl-tRNA(Asn) amidotransferase subunit B [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 486

 Score =  498 bits (1283), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 252/486 (51%), Positives = 338/486 (69%), Gaps = 13/486 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E H QL+  SK+FSG+++ FGAEPNTQ S  D A+PG LP++N R V++A+  
Sbjct: 3   WEVVIGLETHTQLTTQSKIFSGSAIRFGAEPNTQASLVDLALPGALPVMNKRAVERAIQF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I   SVFARKNYFYPDLP+GYQISQ + P+V  G+VS +   D   + RT++ 
Sbjct: 63  GLAVDAVIAPSSVFARKNYFYPDLPKGYQISQFEIPVVQGGRVSFAFERDGKTELRTVQ- 121

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS+H+ Y  ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L S++
Sbjct: 122 -LTRAHLEEDAGKSLHEDYQGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKALHSLV 180

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
            +L  CDGNM+EGS R D NVSV RP   E +GTRCEVKN+NS RFL  AI YE RRQI 
Sbjct: 181 MWLDICDGNMQEGSFRCDANVSV-RPVGQEQYGTRCEVKNLNSFRFLEEAINYEVRRQIE 239

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDL PL I  D+I  +K  +P
Sbjct: 240 LIEDGGRVVQETRLYDPDRKETRSMRSKEDAQDYRYFPDPDLPPLIIGADWIAQVKAAMP 299

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK---KIVANWVINDLLGV 376
           ELP A R RFI +FG++ YDA+VL   K++A YFE +A    K   K VANW++ DL   
Sbjct: 300 ELPGAMRARFISDFGLTDYDAAVLTQSKAMALYFEAVATLTGKDLAKQVANWLMGDLASA 359

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTP---KEIVEEL 432
           +NR G     +P+ P QL  L+  I DGTIS KIAK+IF  +WE K   P    +++E +
Sbjct: 360 VNRDGIDPGQSPVGPAQLALLLQRIADGTISNKIAKEIFAAMWEAKSVEPLLADQLIESM 419

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q++D  A+E ++ EV+ +NP +V    A K    +  +GQ MK + GKANP+ + ++
Sbjct: 420 GLKQISDSGALEAIIAEVLAANPKSVEEFRAGKEKAFNALIGQAMKASRGKANPAQLTEL 479

Query: 492 LKEKLG 497
           LK+KL 
Sbjct: 480 LKQKLA 485


>gi|153874608|ref|ZP_02002763.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Beggiatoa sp. PS]
 gi|152068928|gb|EDN67237.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Beggiatoa sp. PS]
          Length = 476

 Score =  498 bits (1283), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 247/479 (51%), Positives = 336/479 (70%), Gaps = 10/479 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+E+HAQL+  SK+FSG+S+ +G+EPNTQ    D  +PG+LP+LN + V  A   
Sbjct: 2   YETVIGLEIHAQLATNSKIFSGSSIAYGSEPNTQACAVDLGLPGVLPVLNEKVVTMAAKF 61

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A +   S+FARKNYFYPDLP+GYQISQ++ PIV +G++ + +     GQ +TI  
Sbjct: 62  GLAIGAEVAPRSIFARKNYFYPDLPKGYQISQYELPIVKQGQLQIEV----EGQEKTI-- 115

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +   S IDLNR+G  L+EIV++PDMRS+ EA A++ K+ S++
Sbjct: 116 GITRAHLEEDAGKSLHEDFQGSSGIDLNRAGTPLLEIVSEPDMRSAPEAVAYMKKVHSLV 175

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYL  CDGNM+EGS R D NVS+   G E  GTR E+KN+NS RF+  AI +E  RQI +
Sbjct: 176 RYLEICDGNMQEGSFRCDANVSIRPKGQEELGTRTELKNLNSFRFIEKAINFEIERQIDV 235

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LE GG + QETRL+D  KNETRS+R+KE+A DYRYF +PDLLP+ I+  F+  IK  +PE
Sbjct: 236 LESGGKVVQETRLYDADKNETRSMRSKEEANDYRYFPDPDLLPVVIEPAFLAQIKAGLPE 295

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL--AVNRDKKIVANWVINDLLGVLN 378
           LPD K++RFI ++G+SLYDAS L S++ +A+YFE+   A   D K+ ANWV+ +L   LN
Sbjct: 296 LPDEKKQRFIEQYGLSLYDASFLTSNREMANYFEETVKASGSDAKLCANWVMGELAAFLN 355

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++   I D+ +S  QL  L+  I D TISGKIAK +F  +W   G    I+E+  L+Q T
Sbjct: 356 KNNLEIADSKVSTTQLAGLLRRIADNTISGKIAKQVFEAMWNGEGEADVIIEKRDLKQET 415

Query: 439 DLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           D  AIEK+VD++I  NP+ +A     K  L  +FVGQVMK + GKANP  V ++LK+KL
Sbjct: 416 DSGAIEKIVDDIIAKNPSQLADYRNGKDKLFGFFVGQVMKVSKGKANPKQVNELLKKKL 474


>gi|73666897|ref|YP_302913.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ehrlichia canis
           str. Jake]
 gi|109892022|sp|Q3YSJ0|GATB_EHRCJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|72394038|gb|AAZ68315.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ehrlichia canis str. Jake]
          Length = 482

 Score =  497 bits (1279), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 254/484 (52%), Positives = 334/484 (69%), Gaps = 14/484 (2%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASV-NFGAEPNTQVSFFDAAMPGMLPILNGRCV 75
           G   DWEVVIG+EVHAQ+   SKLFSGAS   + A PNTQVS FD AMPGMLP+LN  C+
Sbjct: 6   GNKCDWEVVIGLEVHAQVISNSKLFSGASAKTYDAPPNTQVSLFDVAMPGMLPVLNEYCI 65

Query: 76  QQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQ 135
            QAV TG+ L+  I+KYS F RKNYFYPDLP GYQI+Q   PI  EGKV +    D + +
Sbjct: 66  YQAVKTGIALSCKISKYSAFDRKNYFYPDLPAGYQITQFYYPIATEGKVVLE---DHNAK 122

Query: 136 FRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
               EV I RIHLEQDAGKSIH+   + + ID NR+GVALMEIV++PD+RS  E   +L 
Sbjct: 123 ----EVRIARIHLEQDAGKSIHE--FSQTYIDFNRAGVALMEIVSEPDLRSVEEVAEYLK 176

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYE 253
           KLR ILR++GTCDG+ME+GS R D NVSV RP      G R E+KN+NSIR++  AIEYE
Sbjct: 177 KLRMILRFIGTCDGDMEKGSFRCDANVSV-RPFGSNELGVRSEIKNLNSIRYVMQAIEYE 235

Query: 254 ARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRA 313
           A +Q+ ILE+     Q T LFD S  +TR +RTKEDA DYRYF +PDL P++ID+ +I  
Sbjct: 236 ANKQVNILENNEIFTQNTLLFDVSLGQTRVIRTKEDAHDYRYFPDPDLFPVKIDDQYIDH 295

Query: 314 IKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDL 373
           +K  +PELP  KR+R+I +F ++  DA +L SDK +A YFEK+    D ++ A+W+I +L
Sbjct: 296 VKSLLPELPLQKRDRYINDFNLNKSDADILSSDKDVAMYFEKVVEKHDARLAASWIIGEL 355

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
            G LN+ G +I+++ +    L +L+DLI+D TISGKIAK +F++++E G  P  IV E G
Sbjct: 356 FGRLNKLGITIDESSVKAEHLIQLLDLIVDNTISGKIAKQVFDMMFESGKLPALIVSEHG 415

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           L+QV D   +  VV++++  N + V      K  L  +FVGQVMK T GKANP +V  ++
Sbjct: 416 LKQVDDADVLYVVVEKILKDNASKVEEYKQGKEKLFGYFVGQVMKETQGKANPEMVNSII 475

Query: 493 KEKL 496
           K++L
Sbjct: 476 KQQL 479


>gi|300313941|ref|YP_003778033.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase subunit B [Herbaspirillum
           seropedicae SmR1]
 gi|300076726|gb|ADJ66125.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit protein
           [Herbaspirillum seropedicae SmR1]
          Length = 486

 Score =  496 bits (1278), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 246/485 (50%), Positives = 329/485 (67%), Gaps = 13/485 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E H QLS  SK+FSG+   FGAEPNTQ S  D A+PG+LP+LN   V++A+  
Sbjct: 3   WEVVIGLETHTQLSTQSKIFSGSPTRFGAEPNTQASPVDLALPGVLPVLNKGAVERAIQF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A I   S+FARKNYFYPDLP+GYQISQ + P+V  G +S ++  D   + +TI  
Sbjct: 63  GLAIGATIAPRSIFARKNYFYPDLPKGYQISQFEIPVVQGGTMSFAVEKDGKTEIKTI-- 120

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS+H+ Y  ++ IDLNR+G  L+EIVT+P+MRS+ EA  +   L S++
Sbjct: 121 NLTRAHLEEDAGKSLHEDYQGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVGYAKALHSLV 180

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
            +LG CDGNM+EGS R D NVSV RP   E +GTRCE+KN+NS RFL  AI YE RRQI 
Sbjct: 181 MWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRCEIKNLNSFRFLEEAINYEVRRQIE 239

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL PL I +++I  +K  +P
Sbjct: 240 LIEDGGTVVQETRLYDPDKKETRSMRSKEDAQDYRYFPDPDLPPLAISQEWIERVKATMP 299

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK---KIVANWVINDLLGV 376
           ELP A RERF+ E+ +  YDA VL   K +A YFE +     K   K  ANW++ D+   
Sbjct: 300 ELPAAMRERFVAEYALPEYDAMVLTQSKGMASYFEAVVAAAGKEQAKPAANWLMGDVAST 359

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE----KGGTPKEIVEEL 432
           LNR    I D P+   QL  L+  I DGTIS KIAK++F  +WE    K     +I+E  
Sbjct: 360 LNREDTDIADAPVKAAQLALLLKRIADGTISNKIAKEVFAGMWEARSDKDSLADDIIEAK 419

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q++D  A+E +VD+V+ +N  +VA   A K   ++  +GQ MK T GKANP+ + ++
Sbjct: 420 GLKQISDSGALEAIVDQVLAANEKSVAEFRAGKEQAINALIGQAMKATRGKANPAQLTEL 479

Query: 492 LKEKL 496
           L++KL
Sbjct: 480 LRKKL 484


>gi|171321050|ref|ZP_02910034.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           ambifaria MEX-5]
 gi|171093685|gb|EDT38833.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           ambifaria MEX-5]
          Length = 496

 Score =  496 bits (1278), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 245/493 (49%), Positives = 342/493 (69%), Gaps = 18/493 (3%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGA   FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGAPTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE- 140
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++    +  E 
Sbjct: 65  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQAYEK 124

Query: 141 -VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 125 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKSLHA 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQ 243

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I +D+I  ++  
Sbjct: 244 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGQDWIERVQAG 303

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL--------AVNRDKKIVANWV 369
           +PELP A ++RF+ ++G+S YDA VL S K++A YFE +        A   + KI ANW+
Sbjct: 304 MPELPAAMQQRFVEQYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAATADGANAKIAANWL 363

Query: 370 INDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK--- 426
           + D+   LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF+ +W++  T +   
Sbjct: 364 MGDVSSQLNRDGIEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFSAIWDEKATDEAAA 423

Query: 427 -EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKAN 484
             I++  GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKAN
Sbjct: 424 DRIIDAKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKAN 483

Query: 485 PSIVQKMLKEKLG 497
           P  V ++LK+KLG
Sbjct: 484 PQQVNELLKKKLG 496


>gi|323524443|ref|YP_004226596.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Burkholderia sp.
           CCGE1001]
 gi|323381445|gb|ADX53536.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia sp.
           CCGE1001]
          Length = 491

 Score =  495 bits (1275), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 242/490 (49%), Positives = 342/490 (69%), Gaps = 11/490 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  WEVVIG+E HAQLS  SK+FSGA   FGA PNTQ    D A+PG LP++N   V++A
Sbjct: 2   TKQWEVVIGLETHAQLSTQSKIFSGAPTQFGAAPNTQACPVDLALPGTLPVMNRGAVERA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSGQFR 137
           +  GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G+V++ +   +K+G   
Sbjct: 62  IQFGLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQVTIQVPANEKAGTAA 121

Query: 138 TIEV-GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
             +V  + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   
Sbjct: 122 YAKVVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKT 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEAR 255
           L +++ +LG CDGNM+EGS R D NVSV   G+A +GTR E+KN+NS RFL  AI+YE R
Sbjct: 182 LHTLVTWLGICDGNMQEGSFRCDANVSVRPLGQAEFGTRAEIKNLNSFRFLEEAIQYEVR 241

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDL+PL ID  ++  +K
Sbjct: 242 RQIELIEDGGTVVQETRLYDPDRRETRSMRSKEDAHDYRYFPDPDLMPLVIDAAWVERVK 301

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVIND 372
           +++PELP+A ++RF+ ++G++ YDA+VL S K+ A YFE +       + K+ ANWV+ +
Sbjct: 302 REMPELPEAIQQRFVSQYGLTPYDANVLTSSKATAAYFEAVVEKLGAANAKVAANWVMGE 361

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT----PKEI 428
           +   LNR G  I + P+S  QL  ++  I DGTIS KIAK+IF  +WE+  T       I
Sbjct: 362 VSSQLNREGLDIAECPVSSAQLALVLQRIADGTISNKIAKEIFLAIWEEKATDDVAADRI 421

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSI 487
           +E  GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP+ 
Sbjct: 422 IEAKGLKQISDTGALEAIIDEVLAANQKSVEEFRAGKEKAFNALIGQAMKATKGKANPAQ 481

Query: 488 VQKMLKEKLG 497
           V ++LK+KLG
Sbjct: 482 VNELLKKKLG 491


>gi|254490363|ref|ZP_05103552.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Methylophaga thiooxidans DMS010]
 gi|224464496|gb|EEF80756.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Methylophaga thiooxydans DMS010]
          Length = 480

 Score =  494 bits (1273), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 243/482 (50%), Positives = 342/482 (70%), Gaps = 11/482 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WEVVIG+E+HAQL+  SK+FSGA+  +GA PN+Q    D  +PG+LP+LN   V+ A+ 
Sbjct: 2   EWEVVIGLEIHAQLATKSKIFSGAATAYGAAPNSQACAVDLGLPGVLPVLNEEAVKMALK 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL ++A I + SVFARKNYFYPDLP+GYQISQ + P+VG G++S+ +   + G  + I 
Sbjct: 62  FGLAVDAEIAERSVFARKNYFYPDLPKGYQISQFELPVVGIGQISIEM---EDGTEKVI- 117

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
            GI R HLE+DAGKS+H+ +   + IDLNR+G  L+EIV++PDMRS+ EA A++ K+ S+
Sbjct: 118 -GITRAHLEEDAGKSLHEDFQGQTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYMKKIHSL 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +RYL  CDGNM+EGS R D NVS+   G E +GTR E+KN+NS R +  AI  E  RQI 
Sbjct: 177 VRYLEICDGNMQEGSFRCDANVSIRPKGQEEYGTRAELKNINSFRNVERAINIEIERQID 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++E G  + QETRL+D  KNETRS+R+KE+A DYRYF +PDLLPL I+ + I +++  +P
Sbjct: 237 VIESGDLVVQETRLYDADKNETRSMRSKEEANDYRYFPDPDLLPLVIEPELIESVRATLP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV---NRDKKIVANWVINDLLGV 376
           ELP+ KR+RF+ + G+SLYDAS+L S + +ADY+E +      +D K  ANWV  +L G 
Sbjct: 297 ELPNEKRDRFVNDLGLSLYDASLLTSSRELADYYEAVLAATGGKDPKQCANWVTGELSGA 356

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKE-IVEELGLR 435
           LN++G  I ++P++  QL  ++  I D TISGKIAK +F  LWE  G   + ++E  GL+
Sbjct: 357 LNKAGLDINESPVTAEQLAGVLIRISDNTISGKIAKTVFEALWENEGKDADAVIEAKGLK 416

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           QVTD  AIE +VDEV+ +NP+ + +    K  L+ +FVGQVMK + GKANP+ V ++LK+
Sbjct: 417 QVTDTGAIEAMVDEVLANNPDQLQQYREGKEQLLGFFVGQVMKASKGKANPAQVNELLKK 476

Query: 495 KL 496
           K+
Sbjct: 477 KM 478


>gi|152995958|ref|YP_001340793.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Marinomonas sp.
           MWYL1]
 gi|189045144|sp|A6VWM9|GATB_MARMS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|150836882|gb|ABR70858.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Marinomonas sp.
           MWYL1]
          Length = 481

 Score =  494 bits (1272), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 246/483 (50%), Positives = 330/483 (68%), Gaps = 12/483 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WEVVIG+E+H QLS  SKLFSGA+V FGAEPNTQ +  D  MPG LP+ N   ++ AVM
Sbjct: 2   NWEVVIGLEIHTQLSTKSKLFSGAAVGFGAEPNTQTTLVDLGMPGALPVFNKEALRMAVM 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            G  +NA I   SVFARKNYFYPDLP+GYQ SQ D PIVG+G + V +         T  
Sbjct: 62  FGHAINAEIGMTSVFARKNYFYPDLPKGYQTSQMDHPIVGKGYLDVMLDDGT-----TSR 116

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           VGI R HLE+DAGKS+H+ +  ++ IDLNRS   L+EIV++PD+RS+ EA A++  + SI
Sbjct: 117 VGITRAHLEEDAGKSLHEDFQGMTGIDLNRSSTPLLEIVSEPDIRSAKEAVAYVKMIHSI 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           + YLG CDGNM EGSMR D+N+S+   G+  +GTR E+KNVNS RF+  AI  E  RQ  
Sbjct: 177 VTYLGICDGNMAEGSMRCDINLSLRPKGQKEYGTRTEIKNVNSFRFIEKAIYTEIERQAD 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ILEDGG I QETRL+DP KNETRS+R+KEDA DYRYF  PDLLP+ + ++++  IK  +P
Sbjct: 237 ILEDGGRIIQETRLYDPEKNETRSMRSKEDANDYRYFPCPDLLPVVLTQEYVDNIKATLP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVLN 378
           ELP  K  RF  E  +S YDA+VL S +++AD+FEK   V +D K+ ANWV+ +L  +LN
Sbjct: 297 ELPSQKAARFQSEHALSEYDANVLSSSRAMADFFEKANNVVKDPKLTANWVMGELSKLLN 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           +    IE++P++    GEL+  I D TI+GK AKD+F  +W+  G+   I+E  GL+QVT
Sbjct: 357 QEQLDIENSPVNAQAFGELLVRIKDNTINGKTAKDVFQAMWDGEGSADAIIEAKGLKQVT 416

Query: 439 DLSAIEKVVDEVINSNPNNVARIAT-----KPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           D  AIE ++  ++++N   V +        +  ++ +FVGQVMK + GKANP +V  +L 
Sbjct: 417 DTGAIEAMIQTILDANAAQVEQYRAADEDKQKKMIGFFVGQVMKASQGKANPGLVNPILA 476

Query: 494 EKL 496
           + L
Sbjct: 477 KML 479


>gi|307728163|ref|YP_003905387.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Burkholderia sp.
           CCGE1003]
 gi|307582698|gb|ADN56096.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia sp.
           CCGE1003]
          Length = 491

 Score =  494 bits (1272), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 244/491 (49%), Positives = 344/491 (70%), Gaps = 15/491 (3%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  WEVVIG+E HAQLS  SK+FSGA   FGA PNTQ    D A+PG LP++N   V++A
Sbjct: 2   TKQWEVVIGLETHAQLSTQSKIFSGAPTQFGAAPNTQACPVDLALPGTLPVMNRGAVERA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSGQ-- 135
           +  GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G+V++ + G +K+G   
Sbjct: 62  IQFGLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQVTIQVPGNEKAGTPA 121

Query: 136 FRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
           +  + V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+  
Sbjct: 122 YSKV-VNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAK 180

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEA 254
            L +++ +LG CDGNM+EGS R D NVSV   G+A +GTR E+KN+NS RFL  AI+YE 
Sbjct: 181 TLHTLVTWLGICDGNMQEGSFRCDANVSVRPVGQAEFGTRAEIKNLNSFRFLEEAIQYEV 240

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           RRQI ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDL+PL ID  ++  +
Sbjct: 241 RRQIELIEDGGTVVQETRLYDPDRRETRSMRSKEDAHDYRYFPDPDLMPLVIDAAWVERV 300

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKIVANWVI 370
           K+++PELP+A ++RF+ ++G++ YDA+VL S K+ A YFE    KL    + K+ ANWV+
Sbjct: 301 KREMPELPEAIQQRFVSQYGLTPYDANVLTSSKATAAYFEAVVGKLGAA-NAKVAANWVM 359

Query: 371 NDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK---- 426
            ++   LNR G  I + P+S  QL  L+  I DGTIS KIAK+IF  +WE+    +    
Sbjct: 360 GEVSSQLNREGLEIAECPVSSAQLALLLQRIADGTISNKIAKEIFLTIWEEKANDEAAAD 419

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANP 485
            I+E  GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP
Sbjct: 420 RIIEAKGLKQISDTGALEAIIDEVLAANQKSVEEFRAGKEKAFNALIGQAMKATKGKANP 479

Query: 486 SIVQKMLKEKL 496
           + V ++LK+KL
Sbjct: 480 AQVNELLKKKL 490


>gi|187922336|ref|YP_001893978.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           phytofirmans PsJN]
 gi|229486050|sp|B2T1M5|GATB_BURPP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|187713530|gb|ACD14754.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           phytofirmans PsJN]
          Length = 491

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 240/486 (49%), Positives = 339/486 (69%), Gaps = 11/486 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS  SK+FSG +  FGA PNTQ S  D A+PG LP++N   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTQSKIFSGTATQFGAAPNTQASPVDLALPGTLPVMNRGAVERAIQF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE- 140
           GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G+V++ +  ++       E 
Sbjct: 65  GLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQVTIQVPANEKAGKEAYEK 124

Query: 141 -VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 125 VVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKTLHT 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV   G+A +GTR E+KN+NS RFL  AI+YE RRQI
Sbjct: 185 LVTWLGICDGNMQEGSFRCDANVSVRPVGQAEFGTRAEIKNLNSFRFLEEAIQYEVRRQI 244

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL ID  +I  +K ++
Sbjct: 245 ELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIDAAWIERVKAEM 304

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVINDLLG 375
            ELP A ++RF+ ++G++ YDA+VL S K++A Y+E +       + K+ ANW++ ++  
Sbjct: 305 TELPVAIQQRFVSQYGLTPYDANVLTSSKAMAAYYEAVVSKVGPANAKVAANWLMGEVSS 364

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK----EIVEE 431
            LNR G  I + P+S  QL  L+  I DGTIS KIAK+IF  +WE+  T +     I+E 
Sbjct: 365 QLNREGLDIAENPVSSAQLALLLQRIADGTISNKIAKEIFLAIWEEKATDESAADRIIEA 424

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +NP +V    A K    +  +GQ MK T GKANP+ V +
Sbjct: 425 KGLKQISDTGALEAIIDEVLAANPKSVEEFRAGKEKAFNALIGQAMKATKGKANPAQVNE 484

Query: 491 MLKEKL 496
           +LK+KL
Sbjct: 485 LLKKKL 490


>gi|222475024|ref|YP_002563439.1| glutamyl-tRNA amidotransferase subunit B (gatB) [Anaplasma
           marginale str. Florida]
 gi|255003004|ref|ZP_05277968.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Anaplasma
           marginale str. Puerto Rico]
 gi|255004130|ref|ZP_05278931.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Anaplasma
           marginale str. Virginia]
 gi|254790933|sp|B9KI71|GATB_ANAMF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|222419160|gb|ACM49183.1| glutamyl-tRNA amidotransferase subunit B (gatB) [Anaplasma
           marginale str. Florida]
          Length = 485

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 244/492 (49%), Positives = 329/492 (66%), Gaps = 11/492 (2%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
           +A +  +  G T +WE+VIG+EVHAQ+   SKLFSGAS  F +EPNTQV+ FD AMPG L
Sbjct: 1   MAANTGIIKGNTHEWEMVIGLEVHAQVISNSKLFSGASTGFCSEPNTQVALFDVAMPGTL 60

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P+LN RCV+QAV T L L+  ++KYSVF RKNYFYPDL  GYQI+Q   PI  +G +++ 
Sbjct: 61  PVLNARCVEQAVRTSLALSCEVHKYSVFDRKNYFYPDLASGYQITQFYFPIATDGHITLD 120

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
               K       +V I RIHLEQDAGKS+H      + +D NR+GVALMEIV+ PD RS 
Sbjct: 121 ECCSK-------DVRISRIHLEQDAGKSMH--VGDKTYLDFNRAGVALMEIVSAPDFRSP 171

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFL 246
            EA  ++ KLR ILR +GTCDG+ME GS+R D NVSV + G++  G R E+KN+NSI+ L
Sbjct: 172 EEAAEYIKKLRIILRAIGTCDGDMENGSLRCDANVSVRKVGDSNLGARSEIKNLNSIKHL 231

Query: 247 GLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEI 306
             AI +EA RQ+ +LE GG + Q T LFD     TRS+R KEDA DYRYF +PDLLPLE+
Sbjct: 232 AQAIRHEACRQVEVLESGGVVSQSTMLFDVDTCTTRSMREKEDACDYRYFPDPDLLPLEL 291

Query: 307 DEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVA 366
              FI  I+  +PELP  K+ R++ + G+S YDA +L SDK ++ YFE +       +  
Sbjct: 292 TTAFIDNIRASLPELPSEKKRRYMQDIGLSRYDADILSSDKDVSAYFESVVAKHAPDLAV 351

Query: 367 NWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK 426
            W+  +L G LN+ G SI D+P+S  +L EL+DL+ DGTISGK+AK +F +++E   +  
Sbjct: 352 PWITGELFGALNKRGSSIADSPVSAGRLVELLDLVADGTISGKMAKQVFALMFETEKSAS 411

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANP 485
           +IV E GL Q+T    +  +VD +I+ +P+ VA     K  L+ +FVG+VMK T G+ANP
Sbjct: 412 DIVREQGLCQITSEETLAPIVDRIISESPDEVAEYRQGKTKLLGYFVGKVMKETNGQANP 471

Query: 486 SIVQKMLKEKLG 497
            +V  ++K +L 
Sbjct: 472 GLVNTLIKRRLA 483


>gi|289207518|ref|YP_003459584.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Thioalkalivibrio
           sp. K90mix]
 gi|288943149|gb|ADC70848.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thioalkalivibrio
           sp. K90mix]
          Length = 477

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 237/479 (49%), Positives = 337/479 (70%), Gaps = 8/479 (1%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE VIG+E+HAQL+ VSK+FSGA   +GAEPN Q    D  MPG+LP+LN   V++AVM
Sbjct: 2   EWETVIGLEIHAQLNTVSKIFSGAPTAYGAEPNRQACAVDLGMPGVLPVLNQGAVEKAVM 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL ++A I   SVFARKNYFYPDLP+GYQISQ++ PIVG G + + +   + G   T  
Sbjct: 62  LGLAIDAEITPRSVFARKNYFYPDLPKGYQISQYELPIVGLGHLDIEL---EDGT--TKR 116

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           +G+ R HLE+DAGKS+H+ + +++ IDLNR+G  L+EIV++P++RS+ EA A++ KL S+
Sbjct: 117 IGVTRAHLEEDAGKSLHEGFESMTGIDLNRAGTPLIEIVSEPELRSAKEAVAYMKKLHSL 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +RYL  CDGNM+EGS R D NVS+   G+  +GTR E+KN+NS RF+  AI +E  RQI 
Sbjct: 177 VRYLDICDGNMQEGSFRCDANVSIRPKGQTEFGTRAELKNLNSFRFVERAINHEVERQID 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++E GG + QETRL+DP ++ETRS+RTKE+A DYRYF +PDLLP+ +D  F+  +++++P
Sbjct: 237 VIEGGGSVVQETRLYDPDRDETRSMRTKEEANDYRYFPDPDLLPVVVDAAFVNQMRERLP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDLLGVLN 378
           ELP AKR RF+ ++G+S YDA VL + + + D++E +A      K+ ANWV+ +    +N
Sbjct: 297 ELPGAKRARFVEQYGLSDYDAGVLTAAREMGDFYEAVAAGCGAPKLAANWVMGEFSAAMN 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           RS   + D P++   L  L+  I D TISGKIAK++F  +W   G    ++E  GL+Q+T
Sbjct: 357 RSEVELADAPVNAEGLAGLLARIQDETISGKIAKEVFEAMWNGEGDADTVIEAKGLKQIT 416

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           D +AI+ ++DEV+ +NP  + +    K  L  +FVGQVMK T GKANP+ V + LK KL
Sbjct: 417 DTAAIDAIIDEVMANNPQQLEQYRGGKDKLFGFFVGQVMKATQGKANPAQVNERLKAKL 475


>gi|237748828|ref|ZP_04579308.1| glutamyl-tRNA amidotransferase subunit B [Oxalobacter formigenes
           OXCC13]
 gi|229380190|gb|EEO30281.1| glutamyl-tRNA amidotransferase subunit B [Oxalobacter formigenes
           OXCC13]
          Length = 486

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 250/486 (51%), Positives = 337/486 (69%), Gaps = 13/486 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS +FGAEPNTQ    D A+PG+LP++N   V++A+  
Sbjct: 3   WEVVIGLETHAQLSTVSKIFSGASTSFGAEPNTQACPVDLALPGVLPVMNRGAVEKAIQF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A +   SVFARKNYFYPDLP+GYQISQ +KP+V  GK++  +  ++ G+     V
Sbjct: 63  GLAIGAEVAPVSVFARKNYFYPDLPKGYQISQFEKPVVIGGKLNCIV--EQKGKSYIKTV 120

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS+H++++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L S++
Sbjct: 121 NLTRAHLEEDAGKSLHEEFADMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKSLHSLV 180

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPG--EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
            +LG  DGNM+EGS R D NVSV RP    A GTRCEVKN+NS R L  AI YE  RQI 
Sbjct: 181 TWLGISDGNMQEGSFRCDANVSV-RPAGTTALGTRCEVKNLNSFRNLEDAINYEVERQIE 239

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++E GG + Q TRL+DP K ETR +RTKED+ DYRYF +PDL PL I  ++I  +KK++P
Sbjct: 240 LIESGGKVVQATRLYDPDKRETREMRTKEDSDDYRYFPDPDLPPLVISAEWIERVKKELP 299

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIV---ANWVINDLLGV 376
           ELP+A R+RFI E+G+  YDA+VL   K++A+Y+EKL     K++    ANW++ D+   
Sbjct: 300 ELPEALRKRFINEYGLPEYDATVLTQSKAMAEYYEKLISLTGKQLAKQNANWLMVDIASA 359

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEEL---- 432
           LNR    I D P++  QL +L+  I D TIS KIA+DIF ILW+   +    V+++    
Sbjct: 360 LNRENLEIGDLPVTVRQLAQLMQRIADNTISNKIARDIFGILWDARASDDNAVDKIIDAK 419

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q++D  AIEK++DEV+ +N  +V    + K    +  VGQVMK T GKANP  V  M
Sbjct: 420 GLKQISDTGAIEKIIDEVLANNAKSVEEFRSGKDKAFNALVGQVMKATKGKANPGQVSDM 479

Query: 492 LKEKLG 497
           LK+KL 
Sbjct: 480 LKKKLA 485


>gi|170693995|ref|ZP_02885151.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           graminis C4D1M]
 gi|170141067|gb|EDT09239.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           graminis C4D1M]
          Length = 491

 Score =  493 bits (1269), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 244/490 (49%), Positives = 340/490 (69%), Gaps = 11/490 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  WEVVIG+E HAQLS  SK+FSGA   FGA PNTQ    D A+PG LP++N   V++A
Sbjct: 2   TKQWEVVIGLETHAQLSTQSKIFSGAPTQFGAAPNTQACPVDLALPGTLPVMNRGAVERA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSGQFR 137
           +  GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G+V++ +   +K+G   
Sbjct: 62  IEFGLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQVTIQVPANEKAGTAA 121

Query: 138 -TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            T  V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   
Sbjct: 122 YTKVVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKT 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEAR 255
           L +++ +LG CDGNM+EGS R D NVSV   G+A +GTR E+KN+NS RFL  AI+YE R
Sbjct: 182 LHTLVTWLGICDGNMQEGSFRCDANVSVRPVGQAEFGTRAEIKNLNSFRFLEEAIQYEVR 241

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL ID  ++  +K
Sbjct: 242 RQIELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIDAAWVERVK 301

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVIND 372
           + +PELP+  ++RF+ ++G++ YDA+VL S K+ A YFE +       + K+ ANWV+ +
Sbjct: 302 RDMPELPETIQQRFVSQYGLTPYDANVLTSSKATAAYFEAVVEKLGAANAKVAANWVMGE 361

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK----EI 428
           +   LNR G  I   P+S  QL  L+  I DGTIS KIAK+IF  +WE+  T +     I
Sbjct: 362 VSSQLNREGLDIAGCPVSSAQLTLLLQRIADGTISNKIAKEIFLAIWEEKATDEAAADRI 421

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSI 487
           +E  GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP+ 
Sbjct: 422 IEAKGLKQISDTGALEAIIDEVLAANQKSVEEFRAGKEKAFNALIGQAMKATKGKANPAQ 481

Query: 488 VQKMLKEKLG 497
           V ++LK+KLG
Sbjct: 482 VNELLKKKLG 491


>gi|269958923|ref|YP_003328712.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Anaplasma
           centrale str. Israel]
 gi|269848754|gb|ACZ49398.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Anaplasma
           centrale str. Israel]
          Length = 485

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 244/492 (49%), Positives = 329/492 (66%), Gaps = 11/492 (2%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
           +A +  +  G T +WE+VIG+EVHAQ+   SKLFSGAS  F +EPNTQV+ FD AMPG L
Sbjct: 1   MAANTGIIKGNTHEWEMVIGLEVHAQVISNSKLFSGASTGFCSEPNTQVALFDVAMPGTL 60

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P+LN RCV+QAV T L L+  ++KYSVF RKNYFYPDL  GYQI+Q   PI  +G +++ 
Sbjct: 61  PVLNARCVEQAVRTSLALSCEVHKYSVFDRKNYFYPDLASGYQITQFYFPIATDGYITLD 120

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
               K       +V I RIHLEQDAGKS+H      + +D NR+GVALMEIV+ PD RS 
Sbjct: 121 ECCSK-------DVRISRIHLEQDAGKSMH--VGDKTYLDFNRAGVALMEIVSAPDFRSP 171

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFL 246
            EA  ++ KLR ILR +GTCDG+ME GS+R D NVSV + G++  G R E+KN+NSI+ L
Sbjct: 172 EEAAEYIKKLRIILRAIGTCDGDMENGSLRCDANVSVRKVGDSNLGARSEIKNLNSIKHL 231

Query: 247 GLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEI 306
             AI +EA RQ+ +LE GG + Q T LFD     TRS+R KEDA DYRYF +PDLLPLE+
Sbjct: 232 AQAIRHEACRQVEVLESGGVVSQSTMLFDVDTCTTRSMREKEDACDYRYFPDPDLLPLEL 291

Query: 307 DEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVA 366
              FI  I+  +PELP  K+ R++ + G+S YDA +L SDK ++ YFE +       +  
Sbjct: 292 TTAFIDNIRASLPELPSEKKRRYMQDIGLSRYDADILSSDKDVSAYFESVVAKHAPDLAV 351

Query: 367 NWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK 426
            W+  +L G LN+ G SI D+P+S  +L EL+DL+ DGTISGK+AK +F +++E   +  
Sbjct: 352 PWITGELFGALNKRGSSIADSPVSAGRLVELLDLVADGTISGKMAKQVFALMFETEKSAS 411

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANP 485
           +IV E GL Q+T    +  +VD +I+ +P+ VA     K  L+ +FVG+VMK T G+ANP
Sbjct: 412 DIVREQGLCQITSEETLAPIVDRIISESPDEVAEYRQGKTKLLGYFVGKVMKETNGQANP 471

Query: 486 SIVQKMLKEKLG 497
            +V  ++K +L 
Sbjct: 472 GLVNTLIKRRLA 483


>gi|296161382|ref|ZP_06844189.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia sp.
           Ch1-1]
 gi|295888368|gb|EFG68179.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia sp.
           Ch1-1]
          Length = 491

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 240/489 (49%), Positives = 339/489 (69%), Gaps = 11/489 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  WEVVIG+E HAQLS  SK+FSGAS  FGA PNTQ    D A+PG LP++N   V++A
Sbjct: 2   TKQWEVVIGLETHAQLSTHSKIFSGASTQFGAAPNTQACPVDLALPGTLPVMNRGAVERA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           +  GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G+V++ +  ++      
Sbjct: 62  IQFGLAIGATVASRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQVTIQVPANEKAGSPA 121

Query: 139 IE--VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            E  V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   
Sbjct: 122 YEKVVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKT 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEAR 255
           L +++ +LG CDGNM+EGS R D NVSV   G+A +GTR E+KN+NS RFL  AI+YE R
Sbjct: 182 LHTLVTWLGICDGNMQEGSFRCDANVSVRPVGQAEFGTRAEIKNLNSFRFLEEAIQYEVR 241

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQ+ ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL ID  ++  +K
Sbjct: 242 RQVELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIDAAWVERVK 301

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVIND 372
            ++PELP+A ++RF+ ++G++ YDA+VL S K++A Y+E +       + K  ANW++ +
Sbjct: 302 SEMPELPEAIQQRFVTQYGLTPYDANVLTSSKAMAAYYEAVVSKLGPANAKAAANWLMGE 361

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK----EI 428
           +   LNR G  I  +P+S  QL  L+  I DGTIS KIAK+IF  +WE+  T +     I
Sbjct: 362 VSSQLNREGLDIAASPVSSAQLALLLQRIADGTISNKIAKEIFLSIWEEKATDEAAADRI 421

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSI 487
           +E  GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP+ 
Sbjct: 422 IEAKGLKQISDTGALEAIIDEVLAANQKSVEEFRAGKEKAFNALIGQAMKATKGKANPAQ 481

Query: 488 VQKMLKEKL 496
           V  +LK+KL
Sbjct: 482 VNDLLKKKL 490


>gi|56477144|ref|YP_158733.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Aromatoleum
           aromaticum EbN1]
 gi|81598811|sp|Q5P4D1|GATB_AZOSE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|56313187|emb|CAI07832.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Aromatoleum aromaticum EbN1]
          Length = 493

 Score =  492 bits (1267), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 245/489 (50%), Positives = 334/489 (68%), Gaps = 15/489 (3%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           DWEVVIG+EVHAQL+  SK+FS AS  FGAEPN Q S  D A+PG+LP+LNG  V++A+ 
Sbjct: 5   DWEVVIGLEVHAQLNTASKIFSAASTAFGAEPNVQASAVDIALPGVLPVLNGGAVERAIR 64

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            G+ + A +   SVFARKNYFYPDLP+GYQISQ + P+V  G +++ +G       +T++
Sbjct: 65  FGVAIGATVAPKSVFARKNYFYPDLPKGYQISQFELPVVQGGAITIRVGDGDKAYEKTVQ 124

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
             + R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PDMRSS EA A+   L ++
Sbjct: 125 --LTRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDMRSSAEAVAYARALHAL 182

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           +R++  CDGNM+EGS R D NVSV RPG   GTR E+KN+NS RFL  AI++E + QI  
Sbjct: 183 VRWIDICDGNMQEGSFRCDANVSVRRPGGPLGTRREIKNLNSFRFLQQAIDFEVQWQIGT 242

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG I+Q T LFDP   ETR +R+KEDA DYRYF +PDLLPL I  ++I  ++ ++PE
Sbjct: 243 IEDGGRIQQATVLFDPDTGETRMMRSKEDAHDYRYFPDPDLLPLVIPSEWIARVRSEMPE 302

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-------KIVANWVINDL 373
           LP A + RFI ++G+S YDA+ L + K IA Y++ +    D        K+ ANWV+ +L
Sbjct: 303 LPGAMKARFINDYGLSAYDAASLTAAKEIAAYYQAMLATADTKPGSQVPKLGANWVMGEL 362

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKE----I 428
              LNR+ + I D+P++P QL  L+  I DGTIS  IA+ +F  LW  +GG+  +    I
Sbjct: 363 AAQLNRAERDIGDSPVTPAQLAGLVQRIADGTISNNIARKVFAALWNGEGGSGADAADRI 422

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSI 487
           +E  GLRQV D SA+E ++DEV+ +N  +V    A K    +  VGQVMK + GKANP+ 
Sbjct: 423 IEAQGLRQVNDSSALEPLIDEVLAANRKSVDEFRAGKEKAFNALVGQVMKASRGKANPAQ 482

Query: 488 VQKMLKEKL 496
           V +MLK KL
Sbjct: 483 VNEMLKRKL 491


>gi|56416660|ref|YP_153734.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Anaplasma
           marginale str. St. Maries]
 gi|81599174|sp|Q5PB50|GATB_ANAMM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|56387892|gb|AAV86479.1| glutamyl-tRNA amidotransferase subunit B [Anaplasma marginale str.
           St. Maries]
          Length = 485

 Score =  492 bits (1267), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 243/492 (49%), Positives = 329/492 (66%), Gaps = 11/492 (2%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
           +A +  +  G T +WE+V+G+EVHAQ+   SKLFSGAS  F +EPNTQV+ FD AMPG L
Sbjct: 1   MAANTGIIKGNTHEWEMVVGLEVHAQVISNSKLFSGASTGFCSEPNTQVALFDVAMPGTL 60

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P+LN RCV+QAV T L L+  ++KYSVF RKNYFYPDL  GYQI+Q   PI  +G +++ 
Sbjct: 61  PVLNARCVEQAVRTSLALSCEVHKYSVFDRKNYFYPDLASGYQITQFYFPIATDGYITLD 120

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
               K       +V I RIHLEQDAGKS+H      + +D NR+GVALMEIV+ PD RS 
Sbjct: 121 ECCSK-------DVRISRIHLEQDAGKSMH--VGDKTYLDFNRAGVALMEIVSAPDFRSP 171

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFL 246
            EA  ++ KLR ILR +GTCDG+ME GS+R D NVSV + G++  G R E+KN+NSI+ L
Sbjct: 172 EEAAEYIKKLRIILRAIGTCDGDMENGSLRCDANVSVRKVGDSNLGARSEIKNLNSIKHL 231

Query: 247 GLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEI 306
             AI +EA RQ+ +LE GG + Q T LFD     TRS+R KEDA DYRYF +PDLLPLE+
Sbjct: 232 AQAIRHEACRQVEVLESGGVVSQSTMLFDVDTCTTRSMREKEDACDYRYFPDPDLLPLEL 291

Query: 307 DEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVA 366
              FI  I+  +PELP  K+ R++ + G+S YDA +L SDK ++ YFE +       +  
Sbjct: 292 TTAFIDNIRASLPELPSEKKRRYMQDIGLSRYDADILSSDKDVSAYFESVVAKHAPDLAV 351

Query: 367 NWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK 426
            W+  +L G LN+ G SI D+P+S  +L EL+DL+ DGTISGK+AK +F +++E   +  
Sbjct: 352 PWITGELFGALNKRGSSIADSPVSAGRLVELLDLVADGTISGKMAKQVFALMFETEKSAS 411

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANP 485
           +IV E GL Q+T    +  +VD +I+ +P+ VA     K  L+ +FVG+VMK T G+ANP
Sbjct: 412 DIVREQGLCQITSEETLAPIVDRIISESPDEVAEYRQGKTKLLGYFVGKVMKETNGQANP 471

Query: 486 SIVQKMLKEKLG 497
            +V  ++K +L 
Sbjct: 472 GLVNTLIKRRLA 483


>gi|107024038|ref|YP_622365.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           cenocepacia AU 1054]
 gi|116691125|ref|YP_836748.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           cenocepacia HI2424]
 gi|170734456|ref|YP_001766403.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           cenocepacia MC0-3]
 gi|254246882|ref|ZP_04940203.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Burkholderia
           cenocepacia PC184]
 gi|123244504|sp|Q1BSL3|GATB_BURCA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|166217738|sp|A0KBH8|GATB_BURCH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|229486047|sp|B1K0H6|GATB_BURCC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|105894227|gb|ABF77392.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Burkholderia cenocepacia AU 1054]
 gi|116649214|gb|ABK09855.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Burkholderia cenocepacia HI2424]
 gi|124871658|gb|EAY63374.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Burkholderia
           cenocepacia PC184]
 gi|169817698|gb|ACA92281.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           cenocepacia MC0-3]
          Length = 491

 Score =  492 bits (1267), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 248/488 (50%), Positives = 340/488 (69%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE- 140
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++       E 
Sbjct: 65  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKPAYEK 124

Query: 141 -VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 125 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHA 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQ 243

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D++  ++  
Sbjct: 244 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGRDWVERVQSG 303

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL---AVNRDKKIVANWVINDLL 374
           +PELP A ++RF+ E+G+S YDA VL S K++A YFE +   A   + KIVANW++ D+ 
Sbjct: 304 MPELPAAMQQRFVDEYGVSAYDAGVLTSSKAMAAYFESVVAKAGAANAKIVANWLMGDVS 363

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG----GTPKEIVE 430
             LNR G  I+  P+S  QL  L+  I DGTIS KIAK+IF  +W++     G    I++
Sbjct: 364 SQLNRDGIEIDAIPVSAAQLALLLQRIADGTISNKIAKEIFATIWDEKATDEGAADRIID 423

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP  V 
Sbjct: 424 AKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVN 483

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 484 ELLKKKLG 491


>gi|224826068|ref|ZP_03699171.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Lutiella
           nitroferrum 2002]
 gi|224601705|gb|EEG07885.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Lutiella
           nitroferrum 2002]
          Length = 475

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 248/479 (51%), Positives = 331/479 (69%), Gaps = 9/479 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIEVH QL+  SK+FSGAS  FGA PNTQ S  + A PG+LP+LN   V +A+  
Sbjct: 3   WEVVIGIEVHVQLNTASKIFSGASTAFGAAPNTQASAVELAFPGVLPVLNRAVVDKAIRL 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL L+A IN+ +VFARKNYFYPDLP+GYQISQ + PIV  GK+ + +G ++        +
Sbjct: 63  GLALDATINQKNVFARKNYFYPDLPKGYQISQMELPIVEHGKLKILVGEEEK------VI 116

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R H+E+DAGKS+H+ +  +S IDLNR+G  L+E+V++PDMRS  EA A++  L +++
Sbjct: 117 GVTRAHMEEDAGKSLHEDFQGLSGIDLNRAGTPLLEVVSEPDMRSVDEALAYVKALYTLV 176

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            +LG CDGNM+EGS R DVNVSV   G+  +GTR E+KN+NS RFL  A +YE + QI  
Sbjct: 177 TWLGICDGNMQEGSFRMDVNVSVRPEGQKEFGTRREIKNLNSFRFLEQAAKYEIQWQIDT 236

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LEDGG ++Q T LFDP   ETR +R+KEDA DYRYF +PDLLP+ ID   I AI+ ++PE
Sbjct: 237 LEDGGKVQQATVLFDPDSGETRMMRSKEDAHDYRYFPDPDLLPVCIDSAQIEAIRAEMPE 296

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP A + RF+ EFG+S YDA +L   +++A YFE +A V+   K+ ANWV  ++   LNR
Sbjct: 297 LPGAMQARFVAEFGVSGYDAGLLTGSRALAAYFETVAKVSGQGKLAANWVNGEIAARLNR 356

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            GK I D PI   +L  LI  I DGT+S K+AK +F  +W+   +   I+E  GL+QV+D
Sbjct: 357 DGKEIGDCPIDAARLSGLIARIADGTLSSKLAKQVFEAMWDSELSADAIIERDGLKQVSD 416

Query: 440 LSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           + AIEK+VDE I +NP  V    A K   ++   GQVMK + GKANP+ VQ++LK KL 
Sbjct: 417 VGAIEKMVDEAIAANPKAVEEFRAGKEKALNALAGQVMKASKGKANPAQVQEILKHKLA 475


>gi|92114365|ref|YP_574293.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Chromohalobacter
           salexigens DSM 3043]
 gi|91797455|gb|ABE59594.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Chromohalobacter salexigens DSM 3043]
          Length = 484

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 249/483 (51%), Positives = 328/483 (67%), Gaps = 13/483 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+EVH QL+  SK+FSGAS  FGAEPNTQ    D  MPG+LP+LN   V  AV  
Sbjct: 4   WETVIGLEVHVQLATQSKIFSGASTAFGAEPNTQACAVDLGMPGVLPVLNENAVAMAVKF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I + S+F RKNYFYPDLP+GYQ SQ  +PIVG GKV +++     G  R++  
Sbjct: 64  GLAVDAEIPETSLFERKNYFYPDLPKGYQTSQMAQPIVGPGKVEITL---DDGSTRSVR- 119

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            I   HLE+DAGKS+H+ Y  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  L +I+
Sbjct: 120 -IHHAHLEEDAGKSLHEDYHGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYIKALHAIV 178

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            YLG  DGNM EGSMR DVNVSV   G+A +GTR E+KNVNS RF+  AI +E  RQI +
Sbjct: 179 TYLGISDGNMAEGSMRCDVNVSVRPKGQAAFGTRAEIKNVNSFRFVEKAIAFEVERQIEL 238

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRLFDP ++ETR +RTKE+A DYRYF  PDLLP+ +D  ++   +  +PE
Sbjct: 239 IEDGGQVVQETRLFDPERDETRGMRTKEEANDYRYFPCPDLLPVTLDGAYVDHQRALMPE 298

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP  KR RF  + G+S YDA VL S +++A+YFE +  V  D K  ANWV  +L   LNR
Sbjct: 299 LPSEKRHRFENQLGLSAYDAGVLASSRAMAEYFEAVKDVCGDAKQAANWVQGELSANLNR 358

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLRQVT 438
               I D+P++  QLG LI  ++D TISGK AK +F  LW+ +  +   I+E  GL+QVT
Sbjct: 359 ENLEIGDSPVTAEQLGGLIQRVMDDTISGKAAKQVFQALWDGEADSADAIIEARGLKQVT 418

Query: 439 DLSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           D  AIE ++D+VI  +P  VA+      A +  ++ +FVGQVMK + G ANP  V  +LK
Sbjct: 419 DTGAIEGMIDQVIADSPVQVAQYREADEAKRGKMIGYFVGQVMKASRGTANPQQVNSLLK 478

Query: 494 EKL 496
           +KL
Sbjct: 479 QKL 481


>gi|87120476|ref|ZP_01076370.1| Glu-tRNA(Gln) amidotransferase subunit B [Marinomonas sp. MED121]
 gi|86164119|gb|EAQ65390.1| Glu-tRNA(Gln) amidotransferase subunit B [Marinomonas sp. MED121]
          Length = 481

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 248/482 (51%), Positives = 335/482 (69%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE+VIG+E+HAQLS  SKLFSGA+V FGAE NTQ +  D  MPG LP+ N   ++ AVM 
Sbjct: 3   WEIVIGLEIHAQLSTKSKLFSGAAVGFGAEANTQTTLVDLGMPGALPVFNKEALRMAVMF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           G  +NA I   SVFARKNYFYPDLP+GYQ SQ D PIVG G + V++   + G   T  V
Sbjct: 63  GHAVNAEIGMTSVFARKNYFYPDLPKGYQTSQMDDPIVGIGHLDVTL---EDGT--TKRV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  +S IDLNRS   L+EIV++PD+RS+ EA A++  + SI+
Sbjct: 118 GITRAHLEEDAGKSLHEDFHGMSGIDLNRSSTPLLEIVSEPDIRSAKEAVAYVKMIHSIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            YLG CDGNM EGSMR DVN+S+   G E +GTR E+KNVNS RF+  AI  E  RQ  I
Sbjct: 178 TYLGICDGNMAEGSMRCDVNISLRPKGQEEFGTRTEIKNVNSFRFIEKAIHTEVERQADI 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LEDGG I QETRL+DP K+ETRS+R+KEDA DYRYF  PDLLP+ + ++++  IK+ +PE
Sbjct: 238 LEDGGKITQETRLYDPEKDETRSMRSKEDANDYRYFPCPDLLPVVLTQEYVDQIKETLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP  K  RFI ++ +S YDA VL S + +ADYFE +     D K+ ANWV+ +L  +LN+
Sbjct: 298 LPTQKAARFISDYSLSEYDAGVLSSSRPMADYFETVTQTANDAKLSANWVMGELSKLLNQ 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           +   I ++P+    LG+L+  I D TI+GK AKDI   +W   G+  EI+++ GL+QVTD
Sbjct: 358 NQIEIANSPVDAKNLGQLLARIKDNTINGKTAKDILLDMWNGEGSADEIIDKKGLKQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-ATKPN----LVSWFVGQVMKNTGGKANPSIVQKMLKE 494
            +AIE +++++I +N   V +  A +P+    ++ +F+GQ+MK + GKANP IV  +L +
Sbjct: 418 TAAIETMINDIIAANSAQVEQFRAAEPDKQKKMMGFFMGQIMKASQGKANPGIVTPILMK 477

Query: 495 KL 496
            L
Sbjct: 478 LL 479


>gi|160872750|ref|ZP_02062882.1| glutamyl-tRNA(Gln)/aspartyl-tRNA(Asn) amidotransferase, B subunit
           [Rickettsiella grylli]
 gi|159121549|gb|EDP46887.1| glutamyl-tRNA(Gln)/aspartyl-tRNA(Asn) amidotransferase, B subunit
           [Rickettsiella grylli]
          Length = 497

 Score =  491 bits (1263), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 242/485 (49%), Positives = 334/485 (68%), Gaps = 13/485 (2%)

Query: 18  TTGD-WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
            TGD WE VIG+EVH QLS  SKLFSGA+  +GA PN+Q    D A+PG+LP+LN   V+
Sbjct: 18  ATGDAWEPVIGLEVHVQLSTQSKLFSGAATAYGANPNSQACAIDLALPGVLPVLNAEAVR 77

Query: 77  QAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF 136
            AV  GL + A I  YSVF+RKNYFYPDLP+GYQISQH+ PIVG G++++ +     G+ 
Sbjct: 78  MAVKFGLSIKADIPHYSVFSRKNYFYPDLPKGYQISQHEYPIVGRGQITIHLD---QGEQ 134

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           +TI   I R HLE+DAGKS H+ +  ++ IDLNR+G  L+EIV++PD+ S  EA  +L  
Sbjct: 135 KTIR--ITRAHLEEDAGKSFHEGFENMTGIDLNRAGTPLLEIVSEPDLTSPQEAVIYLKT 192

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-AWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L S++RYL   DGN++EGS R D NVSV +  +  WG R E+KN+NS RF+  AI+YE  
Sbjct: 193 LHSLVRYLDISDGNLQEGSFRCDANVSVRKVHQKTWGQRVEIKNLNSFRFVEKAIQYEIE 252

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI +LE+GGHI QETRL+D  + ETRS+R+KEDA DYRYF++PDL P+ +  ++I  I 
Sbjct: 253 RQINVLENGGHIIQETRLYDTDQQETRSMRSKEDAKDYRYFTDPDLCPVSLSAEWIEKIN 312

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK---KIVANWVIND 372
           + +PELP  K  RF  ++ +S YDAS+L + + +ADYFE  AV  +K   K+ ANW++ +
Sbjct: 313 QSLPELPQKKWIRFQKDYQLSAYDASLLTATRGLADYFE--AVVNEKVPAKLAANWIMGE 370

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEEL 432
           L   LN++  +I ++P+SP +   L+  I D T+S  IAK++F  LW    T  +I++E 
Sbjct: 371 LAAALNKANLTIHESPLSPKRFAGLLHRIADQTLSSNIAKNVFEALWNSDKTSDQIIKEK 430

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
            LRQVTD +AI K++DE++  +P  +A   A K  L  +FVGQVMK +GGK NP  + ++
Sbjct: 431 NLRQVTDHTAISKMIDEILEKHPQQLAEYKAGKDKLFGFFVGQVMKASGGKLNPQQLNQL 490

Query: 492 LKEKL 496
           LKEKL
Sbjct: 491 LKEKL 495


>gi|329897089|ref|ZP_08271843.1| Aspartyl-tRNA(Asn) amidotransferase subunit B / Glutamyl-tRNA(Gln)
           amidotransferase subunit B [gamma proteobacterium
           IMCC3088]
 gi|328921459|gb|EGG28846.1| Aspartyl-tRNA(Asn) amidotransferase subunit B / Glutamyl-tRNA(Gln)
           amidotransferase subunit B [gamma proteobacterium
           IMCC3088]
          Length = 480

 Score =  490 bits (1261), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 248/482 (51%), Positives = 343/482 (71%), Gaps = 12/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+EVH QL+  SK+FSG+S  FGAEPNTQ S  D AMPGMLP+LN + V+ AV+ 
Sbjct: 3   WEVVIGLEVHLQLATQSKIFSGSSTRFGAEPNTQASAVDLAMPGMLPVLNEQAVRFAVLF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GLG+ A I + SVF RKNYFYPDLP+GYQISQ ++PIVG+G  +V++     G  +TI  
Sbjct: 63  GLGIGAEIGQRSVFDRKNYFYPDLPKGYQISQFEQPIVGKGAFTVTL---SDGTTKTI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+HD     S IDLNR+G  L+EIV++PD+RS+ EA A+L  L +++
Sbjct: 118 GITRAHLEEDAGKSLHDAIPGASGIDLNRAGTPLLEIVSEPDIRSAEEAVAYLKALHTLV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            YLG  DG+M +GSMR D+N+S+ RPG + +GTR E+KNVNS RF+  AI  E  RQ  +
Sbjct: 178 TYLGISDGDMSQGSMRCDINLSLRRPGASEFGTRTEIKNVNSFRFVERAIHSEIERQSDV 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LEDGG I QETRL+D  ++ETRS+R+KE A DYRYF +PDLLP+ ++++ I AI+  +PE
Sbjct: 238 LEDGGVIIQETRLYDAERDETRSMRSKEVANDYRYFPDPDLLPVVLNDETIDAIRASLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANWVINDLLGVLNR 379
           LPDAKRERF  ++G+  YDA  L   +++A+YFE   A   D K+ ANW++++L   LN 
Sbjct: 298 LPDAKRERFKEQYGLGDYDARALCDSQAMANYFEDAAAAGGDAKLAANWMLSELAAQLNA 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           +   +E  P+S  QLG+LI  I D T+S K+AK +F+ LW+  G    I+E+ GL+QV+D
Sbjct: 358 NNIELEQAPVSAQQLGQLIVRIKDNTLSSKMAKQVFDALWQGEGDVDAIIEQRGLKQVSD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             A+E +V+EV+ +NP+ VA+        +  L+ +FVGQ+MK + G+ANP +V ++L +
Sbjct: 418 SGALESLVNEVVANNPDQVAQYRAADDGKQKKLLGFFVGQIMKASKGQANPKLVNELLNK 477

Query: 495 KL 496
            L
Sbjct: 478 AL 479


>gi|91776838|ref|YP_546594.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Methylobacillus
           flagellatus KT]
 gi|122399419|sp|Q1GYD4|GATB_METFK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|91710825|gb|ABE50753.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Methylobacillus flagellatus KT]
          Length = 477

 Score =  489 bits (1260), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 250/480 (52%), Positives = 323/480 (67%), Gaps = 10/480 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E H QL+  SK+FSG+S  FGAEPNTQ +  D A+PG+LP+LN   VQ A+  
Sbjct: 3   WEVVIGLETHVQLNTRSKIFSGSSTAFGAEPNTQANVVDVALPGVLPVLNKEAVQCAIRF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL +NA I   SVFARKNYFYPDLP+GYQISQ++ P+VG+G +++ +G  +    +TI  
Sbjct: 63  GLAVNAEIAPRSVFARKNYFYPDLPKGYQISQYELPVVGKGALTIQVGDTE----KTIR- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            I R HLE+DAGKS+H      S IDLNR+G  L+EIVT+PDMRS+ EA A+  KL  ++
Sbjct: 118 -ITRAHLEEDAGKSMHGASPGQSGIDLNRAGTPLLEIVTEPDMRSAAEAVAYARKLHELV 176

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           +++  CDGNM+EGS R DVNVSV R G E  GTR E+KN+NS RF+  AIE+E R QI  
Sbjct: 177 QWINICDGNMQEGSFRCDVNVSVRRKGQEKLGTRREIKNLNSFRFMQQAIEFETRWQIET 236

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LEDGG I Q T LF+P   ETR++RTKE+A DYRYF +PDLLPL I  + I A++  +PE
Sbjct: 237 LEDGGKIEQATVLFNPDTGETRAMRTKEEANDYRYFPDPDLLPLAISTEDIDAVRVTLPE 296

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV--NRDKKIVANWVINDLLGVLN 378
           LP A + RF  ++G+S YDAS L + +S+ADYF         + K+VANWV+  +   LN
Sbjct: 297 LPSAMKARFERDYGLSAYDASALTASRSVADYFTATLAEFGGEAKLVANWVMGGISAKLN 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
             G+ I D P+SP  L  L+  I D TIS KIAKD+F  +W   G    I+E  GL+QVT
Sbjct: 357 EEGREITDAPVSPVLLAGLLKRIADNTISSKIAKDVFEAMWAGEGDADAIIERKGLKQVT 416

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  AIE +VDEV+ +N   V    A K    +  VGQ MK + GKANP+ V ++LK KL 
Sbjct: 417 DSGAIEAIVDEVLAANAAMVEEFRAGKEKAFNALVGQTMKASKGKANPAQVNEILKRKLA 476


>gi|88606922|ref|YP_505071.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Anaplasma
           phagocytophilum HZ]
 gi|109892005|sp|Q2GKN0|GATB_ANAPZ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|88597985|gb|ABD43455.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Anaplasma
           phagocytophilum HZ]
          Length = 483

 Score =  489 bits (1258), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 236/486 (48%), Positives = 328/486 (67%), Gaps = 11/486 (2%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           + +G + DWEVVIG+EVHAQ+   SKLFSGAS     +PN+ V+  D AMPG+LP+ N  
Sbjct: 4   IINGASHDWEVVIGLEVHAQIVSNSKLFSGASTEISVDPNSHVALLDVAMPGVLPVTNEY 63

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           C+ QAV T L L+  + KYSVF RKNYFYPDL  GYQI+Q   PI   G + +    D  
Sbjct: 64  CIVQAVKTALALSCEVKKYSVFDRKNYFYPDLSFGYQITQFYHPIAKNGHIMLDESADNK 123

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
                 ++GI RIH+EQDAGKS+H      +CID NR+GVALMEIVT PD+RS  EA  +
Sbjct: 124 ------KIGIARIHIEQDAGKSLH--VGDKTCIDFNRAGVALMEIVTDPDLRSPEEAAEY 175

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-AWGTRCEVKNVNSIRFLGLAIEY 252
           L KLR ILRY+G C G+ME G++R D NVSV + GE A G R E+KN+NSI+++  AI+Y
Sbjct: 176 LKKLRIILRYIGACSGDMENGALRCDANVSVRKVGESALGVRSEIKNLNSIKYVAQAIKY 235

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           EA R + +LE GG + Q T L+D     TR++R+KED  DYRYF +PDLLPLEI ++FI 
Sbjct: 236 EAMRHVEVLESGGKVEQSTLLYDVDTGTTRTMRSKEDVCDYRYFPDPDLLPLEITDEFIA 295

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYF-EKLAVNRDKKIVANWVIN 371
           +I+  +PELP AK  R++ +F +S YDA +L SD+ +A+Y+ E +  N    +VA WV  
Sbjct: 296 SIRDTLPELPMAKMSRYMNDFSLSRYDAVILSSDRDVAEYYDEVMQRNLPGDLVAAWVTG 355

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           +L G+LN+ G  I D+P+  + LG+L+ L++DGTISGK+AK +F  ++E G +  +IVEE
Sbjct: 356 ELFGMLNKRGMCISDSPVRADALGDLLRLMVDGTISGKMAKQVFATMFETGKSASKIVEE 415

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q+ D   +  +V+ V+  NP+ V +    K  L  +FVGQ+M+ T G+ANP ++  
Sbjct: 416 EGLQQIADEGVLSAMVERVLEKNPDKVQQYKQGKEKLFGYFVGQIMQETKGRANPEVLNA 475

Query: 491 MLKEKL 496
           +++ KL
Sbjct: 476 LIQSKL 481


>gi|91781451|ref|YP_556657.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           xenovorans LB400]
 gi|123359257|sp|Q146Y4|GATB_BURXL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|91685405|gb|ABE28605.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Burkholderia xenovorans LB400]
          Length = 491

 Score =  488 bits (1257), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 239/489 (48%), Positives = 338/489 (69%), Gaps = 11/489 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  WEVVIG+E HAQLS  SK+FSGAS  FGA PNTQ    D A+PG LP++N   V++A
Sbjct: 2   TKQWEVVIGLETHAQLSTHSKIFSGASTQFGAAPNTQACPVDLALPGTLPVMNRGAVERA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           +  GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G+V++ +  ++      
Sbjct: 62  IQFGLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQVTIQVPANEKANTPA 121

Query: 139 IE--VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            E  V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   
Sbjct: 122 YEKVVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKT 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEAR 255
           L +++ +LG CDGNM+EGS R D NVSV   G+A +GTR E+KN+NS RFL  AI+YE R
Sbjct: 182 LHTLVTWLGICDGNMQEGSFRCDANVSVRPVGQAEFGTRAEIKNLNSFRFLEEAIQYEVR 241

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL ID  ++  +K
Sbjct: 242 RQIELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIDAAWVERVK 301

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVIND 372
            ++PELP A ++RF+ ++G++ YDA+VL S K++A Y+E +       + K  ANW++ +
Sbjct: 302 SEMPELPVAIQQRFVTQYGLTPYDANVLTSSKAMAAYYEAVVSKLGPANAKAAANWLMGE 361

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK----EI 428
           +   LNR    I  +P+S  QL  L+  I DGTIS KIAK+IF  +WE+  T +     I
Sbjct: 362 VSSQLNREDLDIAASPVSSAQLALLLQRIADGTISHKIAKEIFLSIWEEKATDEAATDRI 421

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSI 487
           +E  GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP+ 
Sbjct: 422 IEAKGLKQISDTGALEAIIDEVLAANQKSVEEFRAGKEKAFNALIGQAMKATKGKANPAQ 481

Query: 488 VQKMLKEKL 496
           V ++L++KL
Sbjct: 482 VNELLRKKL 490


>gi|88800237|ref|ZP_01115805.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Reinekea sp.
           MED297]
 gi|88777083|gb|EAR08290.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Reinekea sp.
           MED297]
          Length = 477

 Score =  488 bits (1256), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 247/479 (51%), Positives = 329/479 (68%), Gaps = 10/479 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+EVH QLS  +K+FSG+S  FGAEPNTQ +  D  +PG+LP+ N   +++AV  
Sbjct: 3   WETVIGLEVHVQLSTNTKIFSGSSTAFGAEPNTQANAVDLGLPGVLPVFNEGALKKAVAF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I K S F RKNYFYPDLP+GYQ +Q + PIVG G V + +   ++ + R    
Sbjct: 63  GLAIDADIGKRSFFERKNYFYPDLPKGYQTTQLEAPIVGPGHVDILLDDGETKRVR---- 118

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            I   HLE+DAGKS+H+ +  +S IDLNR+G  L+EIVT+PDMRSS EA AF  KL +I+
Sbjct: 119 -IHHAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLIEIVTEPDMRSSAEAVAFAKKLHTIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
             +G CDG+M +GSMR DVNVS+ RP   +  GTR E KN+NS RF+  AI+ E  RQI 
Sbjct: 178 TAIGICDGDMSQGSMRFDVNVSI-RPKGSDTLGTRTETKNLNSFRFMEEAIKLEVERQID 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           +LEDGG I QETRL++      RS+R+KE+A DYRYF  PDLLP+ ID+D+I +I+  +P
Sbjct: 237 VLEDGGEIIQETRLYNGDTKTARSMRSKEEANDYRYFPCPDLLPVVIDDDYINSIRSTLP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLN 378
           ELPDAK ERFI  +G++ YDASVL +  ++ADYFE+   +  D K+ ANW + +L   LN
Sbjct: 297 ELPDAKIERFIDSYGLTQYDASVLSATAAMADYFEQTTKICGDAKLAANWCMGELSKFLN 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           +    I D PISPN LG+L+  I D TISGKIAK +F  +    G+  EI++  GL+QVT
Sbjct: 357 QQEIDIADCPISPNDLGQLLARIKDDTISGKIAKTVFQAMTNGEGSADEIIDAKGLKQVT 416

Query: 439 DLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           D  AIE +VDEVI +N      + + K  L+ +FVGQVMK + G+ANP  V K+LK+K+
Sbjct: 417 DTGAIEAMVDEVIAANQGQFEELKSGKDKLIGFFVGQVMKASKGQANPGQVNKILKQKM 475


>gi|330818666|ref|YP_004362371.1| Glutamyl-tRNA [Burkholderia gladioli BSR3]
 gi|327371059|gb|AEA62415.1| Glutamyl-tRNA [Burkholderia gladioli BSR3]
          Length = 491

 Score =  488 bits (1256), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 244/488 (50%), Positives = 346/488 (70%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS  SK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTASKIFSGASTQFGAEPNTQACAVDLALPGVLPVLNRGAVERAIRL 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSG-QFRTI 139
           GL L + + + S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +   +K+G +  + 
Sbjct: 65  GLALGSTVAQRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQLTIQVPANEKAGKEAYSK 124

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 125 TINLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHA 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 185 LVMWLGICDGNMQEGSFRCDANVSV-RPLGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQ 243

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+P+ ID  ++  ++ +
Sbjct: 244 IELIEDGGTVVQETRLYDPDKRETRSMRSKEDAQDYRYFPDPDLMPVVIDPKWVERVRGE 303

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL---AVNRDKKIVANWVINDLL 374
           +PELP A ++RF+ ++G++ YDA VL + K++A YFE +   A   + K+ ANW++ D+ 
Sbjct: 304 MPELPAAMQQRFVEQYGVTPYDAVVLTASKAMAAYFEAVVGKAGVANAKVAANWLMGDVS 363

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW-EKGG---TPKEIVE 430
            +LNR G  I+ +P+S  QL  ++  I DGTIS KIAK+IF  +W EK G       I+E
Sbjct: 364 SLLNREGIEIDASPVSAAQLALVLQRIADGTISNKIAKEIFQAIWDEKAGDEAAADRIIE 423

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  VGQ MK T GKANP+ V 
Sbjct: 424 AKGLKQISDSGALEAIIDEVLAANAKSVEEFRAGKEKAFNALVGQAMKATKGKANPAQVN 483

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 484 ELLKKKLG 491


>gi|78067927|ref|YP_370696.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia sp.
           383]
 gi|109892010|sp|Q39BW4|GATB_BURS3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|77968672|gb|ABB10052.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Burkholderia sp. 383]
          Length = 491

 Score =  488 bits (1256), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 246/488 (50%), Positives = 338/488 (69%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE- 140
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++       E 
Sbjct: 65  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKDAYEK 124

Query: 141 -VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 125 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI +E RRQ
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSV-RPIGQEKFGTRAEIKNLNSFRFLEEAINFEVRRQ 243

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I +D+I  ++  
Sbjct: 244 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGQDWIERVQSG 303

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL---AVNRDKKIVANWVINDLL 374
           +PELP A ++RF  E+G+S YDA VL S K++A YFE +   A   + KI ANW++ D+ 
Sbjct: 304 MPELPAAMQQRFADEYGVSAYDAGVLTSSKAMAAYFEAVVAKAGTANAKIAANWLMGDVS 363

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG----GTPKEIVE 430
             LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G    I++
Sbjct: 364 SQLNRDGIEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFTTIWDEKADDEGAADRIID 423

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP  V 
Sbjct: 424 AKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVN 483

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 484 ELLKKKLG 491


>gi|188996754|ref|YP_001931005.1| glutamyl-tRNA(Gln) amidotransferase, B subunit
           [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931821|gb|ACD66451.1| glutamyl-tRNA(Gln) amidotransferase, B subunit
           [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 482

 Score =  488 bits (1255), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 238/480 (49%), Positives = 336/480 (70%), Gaps = 12/480 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +++VVIG+E H Q++  +K+F G  V FGAEPNT V     A PG LP++N R ++ A+ 
Sbjct: 10  EFDVVIGLETHVQMNTQTKMFCGCKVEFGAEPNTNVCPVCLAHPGTLPVINKRAIEFAIK 69

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
             L LN  ++  S+ ARKNYFYPDLP+GYQISQ+DKP+  +G + +         F+ I 
Sbjct: 70  AALALNCKVHNLSIMARKNYFYPDLPKGYQISQYDKPLATDGYIEIKT----ENGFKKIR 125

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
             I R+H+E+DAGK+IH+   + S +DLNR+G  LMEIVT+PD+ S+ EA+ +L KLR+I
Sbjct: 126 --IHRLHIEEDAGKTIHE--GSFSYVDLNRAGTPLMEIVTEPDISSAEEARKYLEKLRNI 181

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +RYLG  D +ME+G +R DVN+S+   G E  GT+ E+KN+NS RF+  AIEYE  RQ  
Sbjct: 182 MRYLGVSDADMEKGQLRCDVNISLKPKGSEKLGTKVELKNINSFRFIVKAIEYEIERQSK 241

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           +L+ G  I QETRLFDP+  +T ++RTKE+A DYRYF +PDLLP+ I ++ I+ IK  +P
Sbjct: 242 LLKKGEKIVQETRLFDPNTGKTYTMRTKEEAHDYRYFPDPDLLPVVIKDEEIQQIKNSLP 301

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL--AVNRDKKIVANWVINDLLGVL 377
           ELPD K  R+I + G+  YDA VL SDK++A+YFEK+     ++ K+VANW++N+LLG L
Sbjct: 302 ELPDQKYHRYIEKLGLPEYDAEVLTSDKALANYFEKVIEIFPQNPKLVANWILNELLGKL 361

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N  G  IE++PISPN L EL+ LI DGTISGKIAKD+F I +E   +PK+IVEE GL+Q+
Sbjct: 362 NEKGLEIENSPISPNSLAELLSLITDGTISGKIAKDVFEIAFETQKSPKQIVEEKGLKQI 421

Query: 438 TDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           ++   I K+V +++   P  V +  +    ++ + VGQ+MK T GKANP +V K++KE+L
Sbjct: 422 SNEDEIRKIVKDILAKFPAEVEKYKSGNEKILGFLVGQIMKETKGKANPQLVNKIIKEEL 481


>gi|209522352|ref|ZP_03270970.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia sp.
           H160]
 gi|209497211|gb|EDZ97448.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia sp.
           H160]
          Length = 491

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 236/489 (48%), Positives = 336/489 (68%), Gaps = 11/489 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  WEVVIG+E H QLS  SK+FSG +  FGA PNTQ S  D A+PG LP++N   V++A
Sbjct: 2   TKQWEVVIGLETHTQLSTHSKIFSGTATQFGAAPNTQASPVDLALPGTLPVMNRGAVERA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           +  GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G+V++ +  ++      
Sbjct: 62  IQFGLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQVTIQVPANEKAGKEA 121

Query: 139 IE--VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            E  + + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   
Sbjct: 122 YEKTINLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKS 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEAR 255
           L +++ +LG CDGNM+EGS R D NVSV   G+  +GTR E+KN+NS RFL  AI+YE R
Sbjct: 182 LHTLVVWLGICDGNMQEGSFRCDANVSVRPLGQKEFGTRAEIKNLNSFRFLEEAIQYEVR 241

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL ID  ++  +K
Sbjct: 242 RQIELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIDAAWVERVK 301

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVIND 372
            ++PELP+A + RF+ ++G++ YDA+VL S K+ A Y+E +       + K+ ANWV+ +
Sbjct: 302 SEMPELPEAIQRRFVSQYGLTPYDANVLTSSKATAAYYEAVVAKVGAGNAKVAANWVMGE 361

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK----EI 428
           +   LNR G  +   P+S  QL  ++  I DGTIS KIAK+IF  +WE+  T +     I
Sbjct: 362 VSSQLNREGLDMAACPVSAAQLALVLQRIADGTISNKIAKEIFLAIWEEKATDEAAADRI 421

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSI 487
           +E  GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP+ 
Sbjct: 422 IEAKGLKQISDTGALEAIIDEVLTANQKSVDEYRAGKEKAFNALIGQAMKATKGKANPAQ 481

Query: 488 VQKMLKEKL 496
           V ++LK+KL
Sbjct: 482 VNELLKKKL 490


>gi|295675145|ref|YP_003603669.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia sp.
           CCGE1002]
 gi|295434988|gb|ADG14158.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia sp.
           CCGE1002]
          Length = 491

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 237/489 (48%), Positives = 337/489 (68%), Gaps = 11/489 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  WEVVIG+E H QLS  SK+FSG +  FGA PNTQ S  D A+PG LP++N   V++A
Sbjct: 2   TKQWEVVIGLETHTQLSTHSKIFSGTATQFGAAPNTQASPVDLALPGTLPVMNRGAVERA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           +  GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G+V++ +  ++      
Sbjct: 62  IQFGLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQVTIQVPANEKAGKEA 121

Query: 139 IE--VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            E  + + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   
Sbjct: 122 YEKTINLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKS 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEAR 255
           L +++ +LG CDGNM+EGS R D NVSV   G+  +GTR E+KN+NS RFL  AI+YE R
Sbjct: 182 LHTLVVWLGICDGNMQEGSFRCDANVSVRPLGQKEFGTRAEIKNLNSFRFLEEAIQYEVR 241

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL ID  ++  ++
Sbjct: 242 RQIELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLMIDAAWVERVR 301

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL---AVNRDKKIVANWVIND 372
            ++PELP+A + RF+ ++G++ YDA+VL S K+ A Y+E +   A   + K+ ANWV+ +
Sbjct: 302 SEMPELPEAIQRRFVSQYGLTPYDANVLTSSKATAAYYEAVVAKAGEANAKVAANWVMGE 361

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK----EI 428
           +   LNR G  I   P+S  QL  ++  I DGTIS KIAK+IF  +WE+  T +     I
Sbjct: 362 VSSQLNREGLDIAACPVSAAQLALVLQRIADGTISNKIAKEIFLAIWEEKATDEAAADRI 421

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSI 487
           +E  GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP+ 
Sbjct: 422 IEAKGLKQISDTGALEAIIDEVLAANQKSVDEYRAGKEKAFNALIGQAMKATKGKANPAQ 481

Query: 488 VQKMLKEKL 496
           V ++LK+KL
Sbjct: 482 VNELLKKKL 490


>gi|254515292|ref|ZP_05127353.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [gamma
           proteobacterium NOR5-3]
 gi|219677535|gb|EED33900.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [gamma
           proteobacterium NOR5-3]
          Length = 484

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 251/483 (51%), Positives = 332/483 (68%), Gaps = 14/483 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E+VIG+EVH QL+  SK+FSG++  FGAEPNTQ +  D AMPGMLP+LN + V+ AVM 
Sbjct: 3   YEMVIGLEVHLQLATRSKIFSGSATTFGAEPNTQANAVDLAMPGMLPVLNVQAVRYAVMF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I K SVF RKNYFYPDLP+GYQISQ  +PIVG G+ + ++ PD +      EV
Sbjct: 63  GLAIDAQIGKRSVFDRKNYFYPDLPKGYQISQFAEPIVGGGRFAFNL-PDGTQS----EV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIVT+PD RS+ +A AFL  L S++
Sbjct: 118 GITRAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVTEPDFRSAEQAVAFLKALHSLV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
            YLG  DGNM EGSMR DVN+S+ RP   +  GTR EVKNVNS RF+  AI  E  RQ  
Sbjct: 178 TYLGISDGNMAEGSMRCDVNLSL-RPKGSDTLGTRTEVKNVNSFRFVEKAIHCERVRQED 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           IL+DGG I QETRL+D  ++ETRS+R+KE A DYRYF EPDLLP+ + +  I  I   +P
Sbjct: 237 ILDDGGSIVQETRLYDADRDETRSMRSKEVANDYRYFPEPDLLPVILSDADIADIVATLP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLN 378
           ELP A+R RF   +G+S YDA VL  ++++ADYFE  A  + D K+ ANW+  DLL  LN
Sbjct: 297 ELPRARRARFEEAYGLSGYDAGVLTDERAVADYFEATARASGDAKLAANWIQGDLLAALN 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
              K+I + P+  +QL  LI  I D TISGKIAK +F  +W+  G    I+E  G +QV+
Sbjct: 357 ADDKNITECPVQADQLAGLIARIKDQTISGKIAKQVFEAMWQGEGDADAIIEARGFKQVS 416

Query: 439 DLSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           D  A+E +VD+V+  NP+ VA+      A +  L  +FVGQ+MK + G+ANP +V  +L 
Sbjct: 417 DSGALESMVDQVVADNPDQVAQYRAADPAKRKKLSGFFVGQIMKASKGQANPKMVNDLLI 476

Query: 494 EKL 496
            +L
Sbjct: 477 ARL 479


>gi|237756653|ref|ZP_04585163.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691185|gb|EEP60283.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 482

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 238/480 (49%), Positives = 335/480 (69%), Gaps = 12/480 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +++VVIG+E H Q++  +K+F G  V FGAEPNT V     A PG LP++N R ++ A+ 
Sbjct: 10  EFDVVIGLETHVQMNTQTKMFCGCKVEFGAEPNTNVCPVCLAHPGTLPVINKRAIEFAIK 69

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
             L LN  ++  S+ ARKNYFYPDLP+GYQISQ+DKP+  +G + +         F+ I 
Sbjct: 70  AALALNCKVHNLSIMARKNYFYPDLPKGYQISQYDKPLATDGYIEIKT----ENGFKKIR 125

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
             I R+H+E+DAGK+IH+   + S +DLNR+G  LMEIVT+PD+ S+ EA+ +L KLR+I
Sbjct: 126 --IHRLHIEEDAGKTIHE--GSFSYVDLNRAGTPLMEIVTEPDISSAEEARKYLEKLRNI 181

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +RYLG  D +ME+G +R DVN+S+   G E  GT+ E+KN+NS RF+  AIEYE  RQ  
Sbjct: 182 MRYLGVSDADMEKGQLRCDVNISLKPKGSEKLGTKVELKNINSFRFIVKAIEYEIERQSK 241

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           +L  G  I QETRLFDP+  +T ++RTKE+A DYRYF +PDLLP+ I ++ I+ IK  +P
Sbjct: 242 LLRKGEKIVQETRLFDPNTGKTYTMRTKEEAHDYRYFPDPDLLPVVIKDEEIQQIKNSLP 301

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL--AVNRDKKIVANWVINDLLGVL 377
           ELPD K  R+I + G+  YDA VL SDK++A+YFEK+     ++ K+VANW++N+LLG L
Sbjct: 302 ELPDQKYHRYIEKLGLPEYDAEVLTSDKALANYFEKVIEIFPQNPKLVANWILNELLGKL 361

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N  G  IE++PISPN L EL+ LI DGTISGKIAKD+F I +E   +PK+IVEE GL+Q+
Sbjct: 362 NEKGLEIENSPISPNSLAELLSLITDGTISGKIAKDVFEIAFETQKSPKQIVEEKGLKQI 421

Query: 438 TDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           ++   I K+V +++   P  V +  +    ++ + VGQ+MK T GKANP +V K++KE+L
Sbjct: 422 SNEDEIRKIVKDILAKFPAEVEKYKSGNEKILGFLVGQIMKETKGKANPQLVNKIIKEEL 481


>gi|254000231|ref|YP_003052294.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Methylovorus sp.
           SIP3-4]
 gi|253986910|gb|ACT51767.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylovorus sp.
           SIP3-4]
          Length = 476

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 250/480 (52%), Positives = 327/480 (68%), Gaps = 11/480 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E H QL   SK+FSG+S+ FGAEPNTQ S  D A+PG+LP+LN   VQ A+  
Sbjct: 3   WEVVIGLETHTQLQTKSKIFSGSSIAFGAEPNTQASAVDIALPGVLPVLNQEAVQCAIKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL +NA I   SVFARKNYFYPDLP+GYQISQ++ P+VG+G ++V +G     Q +TI  
Sbjct: 63  GLAVNAEIAPRSVFARKNYFYPDLPKGYQISQYELPVVGKGSLTVQVG----DQEKTIR- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            I R HLE+DAGKS+H   + +S IDLNR+G  L+EIVT+PDMRS+ EA A+  KL  ++
Sbjct: 118 -ITRAHLEEDAGKSVHGASAGMSGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKKLHELV 176

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +++G CDGNM+EGS R DVNVSV RP   +  GTR E+KN+NS RF+  AIEYE R QI 
Sbjct: 177 QWIGICDGNMQEGSFRCDVNVSV-RPKGSDKLGTRREIKNLNSFRFMQQAIEYETRWQIE 235

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
            LEDGG I+Q T LF+P   ETR++R+KE+A DYRYF +PDLLPL+I  + I  +K  +P
Sbjct: 236 TLEDGGTIQQATVLFNPDTGETRAMRSKEEANDYRYFPDPDLLPLQITVEDIAKVKAVMP 295

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLN 378
           ELP   + RF  E+ +S YDAS L S + IADYF   +A   + K+ ANWV+  +   LN
Sbjct: 296 ELPGDMKARFEREYSLSAYDASGLTSSRGIADYFTAVVAQAAEPKMAANWVMGSVAAKLN 355

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
              + I  +P+SP QL  L+  I D TIS KIAK++F  +W   G    I+E+ GL+QVT
Sbjct: 356 EQDQDISASPVSPLQLAGLLKRIADNTISNKIAKEVFEAMWAGEGDADSIIEKKGLKQVT 415

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  AIE ++DEV+ +N   V    A K    +  VGQ MK + GKANP+ V ++L+ KLG
Sbjct: 416 DSGAIEAIIDEVLAANAAMVEEFRAGKEKAFNALVGQAMKASKGKANPAQVNEVLRRKLG 475


>gi|299068371|emb|CBJ39595.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Ralstonia solanacearum CMR15]
          Length = 488

 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 249/487 (51%), Positives = 336/487 (68%), Gaps = 14/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS  SK+FSGAS  FGA PNTQ +  D A+PG+LP+LN   V++A+  
Sbjct: 3   WEVVIGLETHAQLSTASKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAITF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQ---FRT 138
           GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +   K+GQ    +T
Sbjct: 63  GLAIGAKIASKSIFARKNYFYPDLPKGYQISQYEIPVVQGGTLTIQV-EGKNGQPGYEKT 121

Query: 139 IEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
           ++  + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L 
Sbjct: 122 VQ--LTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKSLH 179

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           +++ +LG CDGNM+EGS R D NVSV R P   +GTRCE+KN+NS RFL  AI YE RRQ
Sbjct: 180 ALVMWLGICDGNMQEGSFRCDANVSVRRGPDAPFGTRCEIKNLNSFRFLEEAINYEVRRQ 239

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPL I  D++ A++  
Sbjct: 240 IELIEDGGTVVQETRLYDPDRKETRSMRSKEDAHDYRYFPDPDLLPLMIGADWVDAVRAT 299

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLL 374
           +PELP A   RF   +G+  YDAS+L + K+ A YFE     A   + K  ANW++ ++ 
Sbjct: 300 LPELPAAMAARFESAYGLPRYDASILTATKATAAYFEAVVAAAGAANAKAAANWIMGEVA 359

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEE 431
             LNR+G  I+  P+SP QL  L+  I DGTIS   A KD+F  +W  E GG    I+ E
Sbjct: 360 SNLNRAGLEIDAAPVSPAQLAGLLARIADGTISNNTAKKDVFPAMWAGEHGGDADAIIAE 419

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D   +EK++DEV+ +N  +V    A K    +  VGQ MK T GKANPS V +
Sbjct: 420 KGLKQMSDSGELEKIIDEVLAANAKSVEEFRAGKDKAFNALVGQAMKATRGKANPSQVNE 479

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 480 LLKKKLG 486


>gi|34499809|ref|NP_904024.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Chromobacterium
           violaceum ATCC 12472]
 gi|47115714|sp|Q7NPY8|GATB_CHRVO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|34105659|gb|AAQ62013.1| Glu-tRNA(Gln) amidotransferase, subunit B [Chromobacterium
           violaceum ATCC 12472]
          Length = 475

 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 244/478 (51%), Positives = 332/478 (69%), Gaps = 9/478 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIEVH QL+  SK+FSGAS  FGAEPNTQ S  + A+PG+LP+LN   V +A+  
Sbjct: 3   WEVVIGIEVHVQLNTASKIFSGASTAFGAEPNTQASAVELALPGVLPVLNRAVVDKAIRL 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL L+A+IN+ +VFARKNYFYPDLP+GYQISQ D PIV  GK+ + +G  +        +
Sbjct: 63  GLALDANINQKNVFARKNYFYPDLPKGYQISQMDLPIVEHGKLKILVGDQEK------VI 116

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ R H+E+DAGKS+H+ +  +S IDLNR+G  L+E+V++PDMRS  EA A++  L +++
Sbjct: 117 GVTRAHMEEDAGKSLHEDFQGLSGIDLNRAGTPLLEVVSEPDMRSVDEALAYVKALYTLV 176

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            +LG CDGNM+EGS R DVNVSV   G+  +GTR E+KN+NS RFL  A +YE + QI  
Sbjct: 177 TWLGICDGNMQEGSFRMDVNVSVRPEGQKEFGTRREIKNLNSFRFLEQAAKYEIQWQIDT 236

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LEDGG ++Q T LFDP   ETR +R+KEDA DYRYF +PDLLP+ I ++ +  IK ++PE
Sbjct: 237 LEDGGKVQQATVLFDPDTGETRMMRSKEDAHDYRYFPDPDLLPVRISDEQVARIKGEMPE 296

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP A + RF+  +G+S YDA++L S  + A YFE +A  +   K+ ANW+  ++   LNR
Sbjct: 297 LPGAMQARFVDAYGVSAYDAALLTSSLAQAQYFEAVAKASGQGKLAANWINGEIAARLNR 356

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            GK I D PIS  +L  LI  I D T+S K+AK +F+ LW+   +   I+E  GL+QV+D
Sbjct: 357 DGKDILDCPISAERLSGLIARIADNTLSSKLAKQVFDALWDSELSADAIIERDGLKQVSD 416

Query: 440 LSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           + AIEK+V+E I +NP  V    A K   ++   GQVMK + GKANP+ VQ +L++KL
Sbjct: 417 VGAIEKMVEEAIAANPKAVEEFRAGKEKALNALAGQVMKASKGKANPAQVQDILRQKL 474


>gi|313202198|ref|YP_004040856.1| glutamyl-tRNA(gln) amidotransferase subunit B [Methylovorus sp.
           MP688]
 gi|312441514|gb|ADQ85620.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylovorus sp.
           MP688]
          Length = 476

 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 249/480 (51%), Positives = 326/480 (67%), Gaps = 11/480 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E H QL   SK+FSG+S+ FGAEPNTQ S  D A+PG+LP+LN   VQ A+  
Sbjct: 3   WEVVIGLETHTQLQTKSKIFSGSSIAFGAEPNTQASAVDIALPGVLPVLNQEAVQCAIKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL +NA I   SVFARKNYFYPDLP+GYQISQ++ P+VG+G ++V +G     Q +TI  
Sbjct: 63  GLAVNAEIAPRSVFARKNYFYPDLPKGYQISQYELPVVGKGSLTVQVG----DQEKTIR- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            I R HLE+DAGKS+H   + +S IDLNR+G  L+EIVT+PDMRS+ EA A+  KL  ++
Sbjct: 118 -ITRAHLEEDAGKSVHGASAGMSGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKKLHELV 176

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +++G CDGNM+EGS R DVNVSV RP   +  GTR E+KN+NS RF+  AIEYE R QI 
Sbjct: 177 QWIGICDGNMQEGSFRCDVNVSV-RPKGSDKLGTRREIKNLNSFRFMQQAIEYETRWQIE 235

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
            LEDGG I+Q T LF+P   ETR++R+KE+A DYRYF +PDLLPL+I  + I  +K  +P
Sbjct: 236 TLEDGGTIQQATVLFNPDTGETRAMRSKEEANDYRYFPDPDLLPLQITVEDIAKVKAVMP 295

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVLN 378
           ELP   + RF  E+ +S YDAS L S + IADYF  +     + K+ ANWV+  +   LN
Sbjct: 296 ELPGDMKARFEREYSLSAYDASGLTSSRGIADYFTAVVAQVAEPKMAANWVMGSVAAKLN 355

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
              + I  +P+SP QL  L+  I D TIS KIAK++F  +W   G    I+E+ GL+QVT
Sbjct: 356 EQDQDISASPVSPLQLAGLLKRIADNTISNKIAKEVFEAMWAGEGDADSIIEKKGLKQVT 415

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  AIE ++DEV+ +N   V    A K    +  VGQ MK + GKANP+ V ++L+ KLG
Sbjct: 416 DSGAIEAIIDEVLAANAAMVEEFRAGKEKAFNALVGQAMKASKGKANPAQVNEVLRRKLG 475


>gi|325519882|gb|EGC99154.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia sp.
           TJI49]
          Length = 491

 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 244/488 (50%), Positives = 335/488 (68%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE- 140
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +  ++       E 
Sbjct: 65  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGTITIQVPANEKAGKPAYEK 124

Query: 141 -VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + + R HLE+DAGKS+H+ Y+ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 125 TINLTRAHLEEDAGKSLHEDYAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQ 243

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP   ET+S+R+KEDA DYRYF +PDL+PL I  D++  ++  
Sbjct: 244 IELIEDGGEVVQETRLYDPDTRETKSMRSKEDAHDYRYFPDPDLMPLVIGRDWVERVQAG 303

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVINDLL 374
           +PELP A ++RF+ E+G+S YDA VL S K++A YFE +       + KI ANW++ D+ 
Sbjct: 304 MPELPAAMQQRFVAEYGVSAYDAGVLTSSKAMAAYFEAVVAKAGVANAKIAANWLMGDVS 363

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVE 430
             LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +WE+     G    I++
Sbjct: 364 SQLNRDGIEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFATIWEEKATDDGAADRIID 423

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP  V 
Sbjct: 424 AKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVN 483

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 484 ELLKKKLG 491


>gi|327398677|ref|YP_004339546.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Hippea
           maritima DSM 10411]
 gi|327181306|gb|AEA33487.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Hippea
           maritima DSM 10411]
          Length = 475

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 246/479 (51%), Positives = 337/479 (70%), Gaps = 11/479 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           ++E VIG+EVH QL   +K+F   S +FGA PNT +      MPG+LP+LN + +  A+ 
Sbjct: 2   EFEAVIGLEVHIQLLTNTKIFCSCSTDFGAPPNTHICPVCMGMPGVLPVLNKKVLDYAIK 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL LN  INK+S FARKNYFYPDLP+GYQISQ++ PI+  G V + +    +G+++ I 
Sbjct: 62  LGLALNCKINKFSRFARKNYFYPDLPKGYQISQYELPILEGGHVEIFV----NGEYKKI- 116

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
            G+ERIH+E+DAGK+IH      S +D NR+GV L+EIV+ P M S  EA  +L  LR I
Sbjct: 117 -GLERIHMEEDAGKTIHRPDG--SYVDFNRAGVPLLEIVSLPVMHSPQEAGEYLRSLRRI 173

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +RYLG CDGNMEEGS+R D NVS+   G+   GT+ E+KN+NS R +  A+EYE +RQI 
Sbjct: 174 VRYLGICDGNMEEGSLRCDANVSIRPKGQTKLGTKTELKNMNSFRHVEKALEYEIQRQIE 233

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++EDGG I Q+TRL+D     T+ +R+KE+A +YRYF +PDL+P+ ID+++I  IK ++P
Sbjct: 234 VVEDGGKIIQQTRLWDEKTGMTKPMRSKEEAYEYRYFPDPDLVPIFIDDEWIERIKDEVP 293

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDLLGVLN 378
           ELP  K ERF+ E+G+   DA VLV +KS+ADYFE+ A    K + +ANW++++LLG LN
Sbjct: 294 ELPRQKLERFVEEYGLKEEDARVLVEEKSLADYFEEAAKGYKKPQSIANWILSELLGYLN 353

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           +  K+IEDT I PN + EL++LI  G ISGKIAK +F  ++E   +PK+IVEE GL Q+T
Sbjct: 354 KENKNIEDTLIKPNHIRELVELIDSGLISGKIAKTVFGKMYETAKSPKQIVEEEGLVQIT 413

Query: 439 DLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           D S IE +VDEVI +NP  V +  + K N + +FVGQVMK T GKANP +V ++L  KL
Sbjct: 414 DRSQIEGIVDEVIKANPKAVEQYKSGKKNTIGFFVGQVMKKTKGKANPKLVNEILASKL 472


>gi|117923991|ref|YP_864608.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Magnetococcus sp. MC-1]
 gi|117607747|gb|ABK43202.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Magnetococcus sp. MC-1]
          Length = 486

 Score =  485 bits (1248), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 251/484 (51%), Positives = 327/484 (67%), Gaps = 13/484 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E+VIG+EVHAQ+   SK+F G S  FGA  NTQ+    +  PG+LP+LN   V  A+ T
Sbjct: 7   YEMVIGLEVHAQMLTQSKIFCGCSTAFGAPANTQICPVCSGFPGVLPVLNKEAVNMAIKT 66

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL +   +   S F+RKNYFYPDLP GYQI+Q + PIV  GKV +    DK    +   V
Sbjct: 67  GLAIEGEVRMQSEFSRKNYFYPDLPSGYQITQFELPIVEHGKVLIE---DKDVPAKV--V 121

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI RIH+E DAGKSIH+     + +DLNR+GV LMEIV++PDM +  EA A+L KLRSI+
Sbjct: 122 GITRIHMEVDAGKSIHEGVVGGTWVDLNRTGVPLMEIVSEPDMSTPEEAGAYLKKLRSIV 181

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYL  CDGNME+GS R D NVSV + G+   GTRCE+KN+NSIR +  AIE EA R I I
Sbjct: 182 RYLEVCDGNMEQGSFRCDANVSVRKKGDPKLGTRCELKNLNSIRNVMRAIELEAERHIDI 241

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LE+GG I QETRL+D + NETRS+R+KEDA DYRYF EPDL  L + E  I  +K  +PE
Sbjct: 242 LEEGGSIVQETRLYDANLNETRSMRSKEDAHDYRYFPEPDLPLLVLSEQQIATVKATLPE 301

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFE------KLAVNRDKKIVANWVINDLL 374
           LPDAKRERF   +G+S YDASVL + ++++ Y+E      K     D KI ANWV  +LL
Sbjct: 302 LPDAKRERFETAYGLSHYDASVLTTSRALSRYYETVVEQVKAGGQNDPKICANWVTVELL 361

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
            +LN+  K IE +P+S   L +++  I+D TISGKIAK++F  ++E G  P  I+EE GL
Sbjct: 362 ALLNKENKEIEQSPVSATNLAKMVVRILDNTISGKIAKEVFASMFESGSDPDTIIEEKGL 421

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           +Q+TD  AIE  +D+V+  N   V +    +  L  +F+GQVMK T GKANP+ + K+LK
Sbjct: 422 KQITDSGAIEAAIDKVLALNSTQVEQYRGGQEKLFGFFIGQVMKATQGKANPAELNKLLK 481

Query: 494 EKLG 497
           +KLG
Sbjct: 482 QKLG 485


>gi|217968689|ref|YP_002353923.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Thauera sp.
           MZ1T]
 gi|217506016|gb|ACK53027.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thauera sp. MZ1T]
          Length = 486

 Score =  484 bits (1247), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 241/483 (49%), Positives = 330/483 (68%), Gaps = 8/483 (1%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           DWEVVIG+EVHAQL   SK+FSGAS  FGAEPN Q S  D A+PG+LP+LN   V++A+ 
Sbjct: 5   DWEVVIGLEVHAQLDTASKIFSGASTAFGAEPNRQASAVDIALPGVLPVLNRGAVERAIR 64

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL + AH+ + SVFARKNYFYPDLP+GYQISQ D P+V  G +++ +G  +S   +T+ 
Sbjct: 65  FGLAIGAHVAEKSVFARKNYFYPDLPKGYQISQMDLPVVVGGTITIRVGEGESAYEKTVR 124

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
             + R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRSS EA A+   L ++
Sbjct: 125 --LTRAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSEPDMRSSAEAVAYARTLHAL 182

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +R++  CDGNM+EGS R D NVSV R G   +GTR E+KN+NS RFL  AI+YE + QI 
Sbjct: 183 VRWIDICDGNMQEGSFRCDANVSVRRKGATEFGTRREIKNLNSFRFLQQAIDYEVQWQID 242

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
            LEDGG I Q T LFDP   ETR +R+KEDA DYRYF +PDLLPL I  ++   ++ ++P
Sbjct: 243 TLEDGGRIEQATVLFDPDTGETRMMRSKEDAHDYRYFPDPDLLPLMIAPEWKARVQAEMP 302

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLGV 376
           ELP A + RF+ ++G+S YDA+ L + K +AD+++     A     K  ANWV+ +L   
Sbjct: 303 ELPGAMKGRFMDDWGLSAYDATTLTASKEVADFYQATVSAAGAALAKPCANWVMGELAAR 362

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLR 435
           LN++   +  +P+SP QL  L+  I D TIS  IA+ +F  LW  +G T  E++++ GLR
Sbjct: 363 LNKAELDVAASPVSPAQLAGLVARIADNTISNAIARKVFEALWNGEGATADEVIDKQGLR 422

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           QVTD  AIE ++DEV+ +N  +V    A K    +  VGQVMK + GKA P+ V  +L++
Sbjct: 423 QVTDTGAIEAMIDEVLAANQKSVEEFRAGKEKAFNALVGQVMKASKGKAGPAQVNALLRK 482

Query: 495 KLG 497
           KLG
Sbjct: 483 KLG 485


>gi|189426243|ref|YP_001953420.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Geobacter
           lovleyi SZ]
 gi|229486069|sp|B3EA25|GATB_GEOLS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|189422502|gb|ACD96900.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacter lovleyi
           SZ]
          Length = 475

 Score =  484 bits (1247), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 244/478 (51%), Positives = 324/478 (67%), Gaps = 10/478 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           ++ VIG+EVH QL   SK+F G S  FGAEPN        A+PG LP+LN + V+ A+M 
Sbjct: 3   FQPVIGLEVHVQLKTDSKIFCGCSTRFGAEPNLNTCPVCLALPGALPVLNQKVVEFAIMA 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL  N  I+  ++FARKNYFYPDLP+GYQISQ D PI   G + +++G       +T  +
Sbjct: 63  GLATNCSISPTNIFARKNYFYPDLPKGYQISQFDLPICLAGHLDIAVGD------QTKRI 116

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI RIH+E+DAGK +H Q    S +DLNR+G  L+E+V++PDMR++ EA A+L KL  I+
Sbjct: 117 GITRIHMEEDAGKLVHGQGGG-SGVDLNRAGTPLLEVVSEPDMRTADEAVAYLKKLYQIV 175

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            YLG CDGNMEEGS R D NVSV   G   +GTR E+KNVNS +F+  AIEYE  RQ  +
Sbjct: 176 TYLGICDGNMEEGSFRCDANVSVMPVGSGTFGTRAEIKNVNSFKFVKAAIEYEIARQCEL 235

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRLFDP+K  TRS+R KE+A DYRYF +PDL+P+ I +D+I+ +K ++PE
Sbjct: 236 IEDGGKVVQETRLFDPNKGVTRSMRGKEEAHDYRYFPDPDLVPVVISDDWIKRVKNELPE 295

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP+ K  RF+ E+ +  YDA VL S + +ADYFE+ A    + K  ANWV+ +L   LN 
Sbjct: 296 LPEVKFNRFLTEYSLPEYDADVLTSSRPLADYFEQCAQTCNNAKAAANWVMGELTRSLND 355

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           +G +IED+P+SP QL  LI LI  GTISG IAK +F  LW+ GG    IVE+ GL QV+D
Sbjct: 356 NGIAIEDSPVSPAQLAGLIKLIDGGTISGTIAKKVFEDLWKNGGEAAAIVEQQGLAQVSD 415

Query: 440 LSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
             AIE  +D+++ +N   V      K  +  +FVGQVMK   GKANP++V  +LK+KL
Sbjct: 416 TGAIETAIDQIMAANMGQVEEYRGGKDKVFGFFVGQVMKAMKGKANPAVVNDLLKQKL 473


>gi|186474826|ref|YP_001856296.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           phymatum STM815]
 gi|229486049|sp|B2JJW3|GATB_BURP8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|184191285|gb|ACC69250.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           phymatum STM815]
          Length = 491

 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 237/487 (48%), Positives = 339/487 (69%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGA+  FGA PNTQ    D A+PG+LP++N   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGAATQFGAAPNTQACPVDLALPGVLPVMNKGAVERAIQF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE- 140
           GL ++A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++       E 
Sbjct: 65  GLAIDATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKEAYEK 124

Query: 141 -VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 125 TINLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV   G+  +GTR E+KN+NS RFL  AI+YE RRQI
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRAEIKNLNSFRFLEEAIQYEVRRQI 244

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL ID  ++  +K ++
Sbjct: 245 ELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIDASWVERVKGEL 304

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVINDLLG 375
           PELP A ++RF+ ++G++ YDA V+ + K++A Y+E +         K+ ANW++ ++  
Sbjct: 305 PELPAAMQKRFVDQYGLTPYDAGVVTAGKAMAAYYEAVVAKVGAAQAKVAANWLMGEVSS 364

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK----EIVEE 431
            LNR G  I D+P+S  QL  ++  I DGTIS KIAK+IF  +WE+  T +     I+E 
Sbjct: 365 QLNREGLDIADSPVSAAQLALVLQRIADGTISNKIAKEIFLAIWEEKATDEAAADRIIEA 424

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP  V +
Sbjct: 425 KGLKQISDTGALEAIIDEVLAANQKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVNE 484

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 485 LLKKKLG 491


>gi|53717831|ref|YP_106817.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei K96243]
 gi|167736588|ref|ZP_02409362.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei 14]
 gi|167813688|ref|ZP_02445368.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei 91]
 gi|167909015|ref|ZP_02496106.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei 112]
 gi|81608158|sp|Q63YJ8|GATB_BURPS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|52208245|emb|CAH34176.1| glutamyl-tRNA amidotransferase subunit B [Burkholderia pseudomallei
           K96243]
          Length = 490

 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 251/488 (51%), Positives = 342/488 (70%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGA+PNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSG-QFRTI 139
           GL + A +   SVFARKNYFYPDLP+GYQISQ++ P+V  G++++ +   +K+G Q  + 
Sbjct: 64  GLAIGATVAPRSVFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 184 LVMWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQ 242

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D+I  +K +
Sbjct: 243 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWIARVKGE 302

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA---VNRDKKIVANWVINDLL 374
           +PELP A ++RFI ++G+S YDA VL S K++A+YFE L       + K+ ANW++ D+ 
Sbjct: 303 MPELPAAMQQRFIEQYGVSAYDAGVLTSTKAMAEYFEALVAKAGAANAKLAANWLMGDVS 362

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG----GTPKEIVE 430
             LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G    I+E
Sbjct: 363 SQLNRDGIDIDACPVSAAQLALVLQRIADGTISNKIAKEIFVTIWDEKAADEGAADRIIE 422

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  VGQ MK T GKANP  V 
Sbjct: 423 AKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKDKAFNALVGQAMKATKGKANPQQVN 482

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 483 ELLKKKLG 490


>gi|218515783|ref|ZP_03512623.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhizobium etli
           8C-3]
          Length = 315

 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 224/298 (75%), Positives = 262/298 (87%)

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A INK S+F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 1   AAMPGMLPVINEECVKQAVRTGLGLKAQINKRSLFDRKNYFYPDLPQGYQISQFKDPIVG 60

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ GQF  IE+GIER+HLEQDAGKS+HDQ++ +S +DLNRSGVALMEIV+
Sbjct: 61  EGKIVISLGPDRQGQFEDIEIGIERLHLEQDAGKSMHDQHATMSYVDLNRSGVALMEIVS 120

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLRSI+RYLGTCDGNM+EGSMRADVNVSV RPGEA+GTRCE+KNV
Sbjct: 121 KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEAFGTRCEIKNV 180

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KEDA DYRYF +PD
Sbjct: 181 NSIRFIGQAIEYEARRQIGILEDGGTIEQETRLFDPNKGETRSMRSKEDAHDYRYFPDPD 240

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV 358
           LLPLE D+ F+ A+   +PELPD K+ERF+ E G+S+YDASVLVS+K+IADYFE +A 
Sbjct: 241 LLPLEFDDAFVTALAADLPELPDDKKERFVRELGLSVYDASVLVSEKAIADYFEAVAA 298


>gi|257092323|ref|YP_003165964.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257044847|gb|ACV34035.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 483

 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 250/486 (51%), Positives = 331/486 (68%), Gaps = 16/486 (3%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE HAQL+  SK+FSG+S  FGA PN Q +  D A+PG+LP+LN   V+ A+  
Sbjct: 4   WEVVIGIETHAQLATRSKIFSGSSTAFGAAPNVQANAVDIALPGVLPVLNKAAVECAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A I+  SVFARKNYFYPDLP+GYQISQ++ P+V  G +++ +G  +    R I  
Sbjct: 64  GLAVAAEISSRSVFARKNYFYPDLPKGYQISQYELPVVVGGALTIQVGEAE----RVIH- 118

Query: 142 GIERIHLEQDAGKSIHD----QYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
            + R HLE+DAGKS+H+    Q+S  S IDLNR+G  L+EIVT+PDMRSS EA A+   L
Sbjct: 119 -LTRAHLEEDAGKSLHEELGAQFSGRSGIDLNRAGTPLLEIVTEPDMRSSAEAVAYARAL 177

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-AWGTRCEVKNVNSIRFLGLAIEYEARR 256
            +++R++G CDGNM+EGS R D NVSV   G+ A+GTR E+KN+NS RFL  AI+YE + 
Sbjct: 178 HALVRWIGICDGNMQEGSFRCDANVSVRPVGQVAYGTRREIKNLNSFRFLQQAIDYEVQW 237

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QIA LEDGG I Q T LFDPS  ETRS+R+KEDA DYRYF +PDLLPL I+ ++I  I+ 
Sbjct: 238 QIATLEDGGTIEQATVLFDPSTGETRSMRSKEDAHDYRYFPDPDLLPLVIEPEWIDRIRA 297

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK---KIVANWVINDL 373
           Q+PELP AKR+  + E+G+S YDA VL +    A+Y+E       K   KI ANWV+ DL
Sbjct: 298 QMPELPAAKRDHLVAEYGLSPYDARVLTTSIEFANYYEATVAAAGKANAKICANWVMVDL 357

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEEL 432
              L+R    I  +P+S  QLG LI  I DGT+S  +AK +F+ LW  +G +  EI+   
Sbjct: 358 AARLHRDDSEIGKSPVSAAQLGGLIARIGDGTLSNNLAKKVFDALWNGEGDSADEIIARE 417

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q+TD  A+E+++DE+I +N   VA   A K    +  VGQ MK T GKANP  + ++
Sbjct: 418 GLQQITDTGALERLIDEIITANATMVAECRAGKEKAFNALVGQAMKATRGKANPQRINEL 477

Query: 492 LKEKLG 497
           L+ K+G
Sbjct: 478 LRRKIG 483


>gi|88704049|ref|ZP_01101764.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Congregibacter
           litoralis KT71]
 gi|88701876|gb|EAQ98980.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Congregibacter
           litoralis KT71]
          Length = 484

 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 250/482 (51%), Positives = 330/482 (68%), Gaps = 14/482 (2%)

Query: 23  EVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTG 82
           E+VIG+EVH QL+  SK+FSG+   FGAEPNTQ +  D AMPGMLP+LN + V+ AVM G
Sbjct: 4   EMVIGLEVHLQLATRSKIFSGSPTTFGAEPNTQANAVDLAMPGMLPVLNKQAVRYAVMFG 63

Query: 83  LGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVG 142
           L ++A I K S F RKNYFYPDLP+GYQISQ  +PIVG G+ S  + PD S       VG
Sbjct: 64  LAIDAEIGKRSAFDRKNYFYPDLPKGYQISQFAEPIVGTGRFSFKL-PDGSES----TVG 118

Query: 143 IERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILR 202
           I R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIVT+PD RS  +A AFL  L S++ 
Sbjct: 119 ITRAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVTEPDFRSGEQAVAFLKALHSLVT 178

Query: 203 YLGTCDGNMEEGSMRADVNVSVCRPGEA--WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           YLG  DGNM EGSMR DVN+S+ RP ++   GTR E+KNVNS RF+  AI  E  RQ  I
Sbjct: 179 YLGISDGNMAEGSMRCDVNLSL-RPADSDTLGTRTEIKNVNSFRFVEKAIRCERIRQEDI 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           L+DGG I QETRL+D  ++ETRS+R+KE A DYRYF EPDLLP+ +D++ I  IK  +PE
Sbjct: 238 LDDGGSIVQETRLYDADRDETRSMRSKEVANDYRYFPEPDLLPVILDDEDIAEIKASLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LP A+  RF  E+G+S YDA VL  ++ +ADYFE  A  + D K+ ANW+  +LL  LN 
Sbjct: 298 LPRARWARFQDEYGLSEYDAGVLTDERDVADYFEATAKASGDPKLAANWIQGELLAALNA 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
             +SI+  P++   LG LI  I D TISGKIAK++F  +W   G    I++  GL+QV+D
Sbjct: 358 EDQSIQSCPVAAEHLGGLILRIKDQTISGKIAKEVFEAMWNGEGDADAIIDARGLKQVSD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
             A+  +VD+V+  NP+ VA+      A +  L  +FVGQ+MK + G+ANP +V ++L  
Sbjct: 418 SGALAAMVDQVVADNPDQVAQYRAADPAKRKKLSGFFVGQIMKASKGQANPQMVNELLIP 477

Query: 495 KL 496
           +L
Sbjct: 478 RL 479


>gi|167561087|ref|ZP_02354003.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           oklahomensis EO147]
 gi|167568305|ref|ZP_02361179.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           oklahomensis C6786]
          Length = 495

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 249/493 (50%), Positives = 341/493 (69%), Gaps = 18/493 (3%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSG-QFRTI 139
           GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +   +K+G +  + 
Sbjct: 64  GLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGRITIQVPANEKAGKEAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 184 LVVWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQ 242

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D++  +K +
Sbjct: 243 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWVERVKGE 302

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE--------KLAVNRDKKIVANWV 369
           +PELP A ++RF+ ++G+S YDA VL S K++A YFE          A   + KI ANW+
Sbjct: 303 MPELPAAMQQRFVEQYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAAGADGANAKIAANWL 362

Query: 370 INDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG----GTP 425
           + D+   LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G  
Sbjct: 363 MGDVSSQLNRDGIDIDACPVSAAQLALVLRRIADGTISNKIAKEIFVTIWDEKAADEGAA 422

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKAN 484
             I+E  GL+Q++D  A+E ++DEV+ +N  +V    A K    +  VGQ MK T GKAN
Sbjct: 423 DRIIEAKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALVGQAMKATKGKAN 482

Query: 485 PSIVQKMLKEKLG 497
           P  V ++LK+KLG
Sbjct: 483 PQQVNELLKKKLG 495


>gi|172062085|ref|YP_001809737.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           ambifaria MC40-6]
 gi|229486046|sp|B1YPV7|GATB_BURA4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|171994602|gb|ACB65521.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           ambifaria MC40-6]
          Length = 490

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 245/488 (50%), Positives = 340/488 (69%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGA   FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGAPTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE- 140
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++       E 
Sbjct: 64  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKPAYEK 123

Query: 141 -VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKSLHA 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 184 LVVWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQ 242

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I +D+I  ++  
Sbjct: 243 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGQDWIERVQAG 302

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLL 374
           +PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+ 
Sbjct: 303 MPELPAAMQQRFVEQYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAANAKIAANWLMGDVS 362

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK----EIVE 430
             LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF+ +W++  T +     I++
Sbjct: 363 SQLNRDGIEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFSAIWDEKATDEAAADRIID 422

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP  V 
Sbjct: 423 AKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVN 482

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 483 ELLKKKLG 490


>gi|76809058|ref|YP_331783.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei 1710b]
 gi|126440871|ref|YP_001057226.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei 668]
 gi|126453954|ref|YP_001064467.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei 1106a]
 gi|134284076|ref|ZP_01770770.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 305]
 gi|167822203|ref|ZP_02453674.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei 9]
 gi|167843797|ref|ZP_02469305.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei B7210]
 gi|167900791|ref|ZP_02487996.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei NCTC 13177]
 gi|217425074|ref|ZP_03456570.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 576]
 gi|226194639|ref|ZP_03790234.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei Pakistan 9]
 gi|237810364|ref|YP_002894815.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei MSHR346]
 gi|242315865|ref|ZP_04814881.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 1106b]
 gi|254182231|ref|ZP_04888828.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 1655]
 gi|254188158|ref|ZP_04894670.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei Pasteur 52237]
 gi|254196380|ref|ZP_04902804.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei S13]
 gi|254259364|ref|ZP_04950418.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 1710a]
 gi|254295729|ref|ZP_04963186.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 406e]
 gi|109892009|sp|Q3JXC0|GATB_BURP1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|166217742|sp|A3NQ46|GATB_BURP0 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|166217743|sp|A3N4F5|GATB_BURP6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|76578511|gb|ABA47986.1| glutamyl-tRNA amidotransferase subunit B [Burkholderia pseudomallei
           1710b]
 gi|126220364|gb|ABN83870.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 668]
 gi|126227596|gb|ABN91136.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 1106a]
 gi|134244528|gb|EBA44632.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 305]
 gi|157805920|gb|EDO83090.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 406e]
 gi|157935838|gb|EDO91508.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei Pasteur 52237]
 gi|169653123|gb|EDS85816.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei S13]
 gi|184212769|gb|EDU09812.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 1655]
 gi|217392094|gb|EEC32120.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 576]
 gi|225933340|gb|EEH29332.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei Pakistan 9]
 gi|237504535|gb|ACQ96853.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei MSHR346]
 gi|242139104|gb|EES25506.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 1106b]
 gi|254218053|gb|EET07437.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 1710a]
          Length = 490

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 250/488 (51%), Positives = 342/488 (70%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGA+PNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSG-QFRTI 139
           GL + A +   SVFARKNYFYPDLP+GYQISQ++ P+V  G++++ +   +K+G Q  + 
Sbjct: 64  GLAIGATVAPRSVFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 184 LVMWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQ 242

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D+I  +K +
Sbjct: 243 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWIARVKGE 302

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA---VNRDKKIVANWVINDLL 374
           +PELP A ++RF+ ++G+S YDA VL S K++A+YFE L       + K+ ANW++ D+ 
Sbjct: 303 MPELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAEYFEALVAKAGAANAKLAANWLMGDVS 362

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG----GTPKEIVE 430
             LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G    I+E
Sbjct: 363 SQLNRDGIDIDACPVSAAQLALVLQRIADGTISNKIAKEIFVTIWDEKAADEGAADRIIE 422

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  VGQ MK T GKANP  V 
Sbjct: 423 AKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKDKAFNALVGQAMKATKGKANPQQVN 482

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 483 ELLKKKLG 490


>gi|212212161|ref|YP_002303097.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Coxiella
           burnetii CbuG_Q212]
 gi|229486063|sp|B6IZ24|GATB_COXB2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|212010571|gb|ACJ17952.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Coxiella burnetii CbuG_Q212]
          Length = 477

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 243/481 (50%), Positives = 326/481 (67%), Gaps = 10/481 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE VIG+EVH QL   SK+FSGA+  +GAEPNTQ    D  +PG+LP+LN   V+ AV 
Sbjct: 2   EWEPVIGLEVHVQLRTQSKIFSGAATAYGAEPNTQACAIDLGLPGVLPVLNKEAVKLAVC 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL +NA I  YS+FARKNYFYPDLP+GYQISQ++ PIV  G + +    ++ G   T  
Sbjct: 62  FGLSVNASIPPYSIFARKNYFYPDLPKGYQISQYNFPIVQNGHLDIE---NEDGT--TKR 116

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           +GI R HLE+DAGKS H+     S ID NR+G  L+EIV++PD+RS+ EA A+L  L S+
Sbjct: 117 IGITRAHLEEDAGKSFHEGMQGYSGIDFNRAGTPLLEIVSEPDIRSAQEAVAYLKALHSL 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGE-AWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +RY+G  D NM+EG+ R DVN+S+   GE  +GTR E+KNVNS RF+  AI +E  RQ  
Sbjct: 177 VRYIGVSDANMQEGAFRCDVNISLRPKGEEKFGTRAEIKNVNSFRFVERAILFEINRQKE 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ILE+GG I QETRL+D  ++ETRS+RTKE+A DYRYF +PDLLP+EI  +FI A+K Q+P
Sbjct: 237 ILENGGTIVQETRLYDAVQDETRSMRTKEEAHDYRYFPDPDLLPVEIGPEFIEAVKNQLP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLGV 376
           ELP  KR+RF   + +S YD  +L +   IA+YFE   K+      K+ ANW+  DL   
Sbjct: 297 ELPWEKRKRFAASYQLSNYDVKLLTTQIEIANYFETVLKIDKTIPPKLAANWINGDLAAA 356

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++  SI  +PI+  QL  L+  I D T+SG + K +F  +W   G    I+E  GL+Q
Sbjct: 357 LNKNNLSITQSPINAEQLASLLHRIADNTLSGSMGKQVFETMWGGEGDADTIIERHGLKQ 416

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           +TD  A+EK++DEVI +NP  V +  + K  L+++FVGQVMK T GKANP  V ++ K+K
Sbjct: 417 ITDTEALEKIIDEVIENNPTQVEQYRSGKDKLIAFFVGQVMKATKGKANPQQVNELFKKK 476

Query: 496 L 496
           L
Sbjct: 477 L 477


>gi|167717546|ref|ZP_02400782.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei DM98]
          Length = 490

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 250/488 (51%), Positives = 342/488 (70%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGA+PNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSG-QFRTI 139
           GL + A +   SVFARKNYFYPDLP+GYQISQ++ P+V  G++++ +   +K+G Q  + 
Sbjct: 64  GLAIGATVAPRSVFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 184 LVMWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQ 242

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D+I  +K +
Sbjct: 243 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGTDWIARVKGE 302

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA---VNRDKKIVANWVINDLL 374
           +PELP A ++RF+ ++G+S YDA VL S K++A+YFE L       + K+ ANW++ D+ 
Sbjct: 303 MPELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAEYFEALVAKAGAANAKLAANWLMGDVS 362

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG----GTPKEIVE 430
             LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G    I+E
Sbjct: 363 SQLNRDGIDIDACPVSAAQLALVLQRIADGTISNKIAKEIFVTIWDEKAADEGAADRIIE 422

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  VGQ MK T GKANP  V 
Sbjct: 423 AKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKDKAFNALVGQAMKATKGKANPQQVN 482

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 483 ELLKKKLG 490


>gi|302879995|ref|YP_003848559.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Gallionella
           capsiferriformans ES-2]
 gi|302582784|gb|ADL56795.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Gallionella
           capsiferriformans ES-2]
          Length = 482

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 235/480 (48%), Positives = 330/480 (68%), Gaps = 5/480 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE+VIG+EVH QLS  +K+FSGAS  +GAEPNTQ      A+PG+LP+LN   V++AV  
Sbjct: 3   WEIVIGLEVHTQLSTRTKIFSGASTTYGAEPNTQADAVSIALPGVLPVLNKGAVERAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE- 140
           GL + AHI   SVFARKNYFYPDLP+GYQISQ D P+VG G +++ + P  SG  +  E 
Sbjct: 63  GLAVGAHIAPRSVFARKNYFYPDLPKGYQISQFDLPVVGMGALTIQVEP-LSGNAKPYEK 121

Query: 141 -VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V I R HLE+DAGKS+H     ++ +DLNR+G  L+EIV++PDM S+ EA A+   L +
Sbjct: 122 VVRITRAHLEEDAGKSVHGASQGMTGVDLNRAGTPLLEIVSEPDMCSAAEAVAYAKTLHN 181

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           ++R++G  DGNM+EGS R DVNVSV +PGE  GTR E+KN+NS +++  AI++E + QI 
Sbjct: 182 LVRWIGISDGNMQEGSFRCDVNVSVRKPGEELGTRREIKNLNSFKYMQQAIDFEVQWQID 241

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
            +E+GG I Q T LF+P   ETR++R+KEDA DYRYF +PDLLPL+I  + + A++ ++P
Sbjct: 242 TIENGGKIHQATILFNPDTGETRAMRSKEDAHDYRYFPDPDLLPLDITPEMLEAMRAELP 301

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVLN 378
           ELP+A+R R++ E G+S YDA+ L S + +ADYF+    +  + K+ ANW+I +L   LN
Sbjct: 302 ELPEARRTRYVSELGLSAYDANSLTSSREMADYFDTCVTSVGNAKLCANWLIGELSAQLN 361

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           R G  +   P+SP Q+  ++  I D T+S   AK++F  LW  GG    I+E  GL+QV+
Sbjct: 362 RDGLDMAQCPVSPQQMSGMLVRIADNTLSNAGAKEVFRTLWSDGGDADTIIEARGLKQVS 421

Query: 439 DLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  AIE +VDE+I +N + VA   + K  L  +FVG  MK + GKANP+ + ++L +KL 
Sbjct: 422 DSGAIEALVDEIITANADKVAEYRSGKDKLFGFFVGLAMKASKGKANPAQLNEVLLKKLA 481


>gi|94308991|ref|YP_582201.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Cupriavidus
           metallidurans CH34]
 gi|166198810|sp|Q1LSE4|GATB_RALME RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|93352843|gb|ABF06932.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Cupriavidus
           metallidurans CH34]
          Length = 484

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 242/485 (49%), Positives = 331/485 (68%), Gaps = 12/485 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E H QLS  SK+FSG S  FGAEPNTQ S  D A+PG+LP+LN   V++A+  
Sbjct: 3   WEVVIGLETHTQLSTASKIFSGTSTAFGAEPNTQASPVDLALPGVLPVLNRGAVERAIQF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +   K G +    V
Sbjct: 63  GLSIGATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQV-EGKQGVYEKT-V 120

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRSS EA A+   L S++
Sbjct: 121 NLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSSAEAVAYAKALHSLV 180

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
            +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI+YE + QIA
Sbjct: 181 VWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRREIKNLNSFRFLQQAIDYEVQWQIA 239

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
            +EDG  I Q T LFDP   ETR++RTKEDA DYRYF +PDL+PLEID  ++  +K ++P
Sbjct: 240 EIEDGREIVQATVLFDPDTGETRAMRTKEDAHDYRYFPDPDLMPLEIDAAWVERVKSELP 299

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVINDLLGV 376
           ELP   + RF+ ++G+S YDAS + + K++A Y+E +  N      K  ANWV+ ++   
Sbjct: 300 ELPATMQARFVSQYGLSAYDASTITATKALAAYYEAVVTNVGAASAKPAANWVMGEIASQ 359

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEELG 433
           LNR G SI++ P+ P QL +L+  I DGT+S   A KD+F  +W  E  G    I+   G
Sbjct: 360 LNREGISIDEAPVRPAQLAKLLARITDGTVSNNTAKKDVFPAMWAGESDGDADAIIAAKG 419

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           L+Q++D   +EK++D+V+ +N  +V    A K    +  VGQ MK T GKANP+ V ++L
Sbjct: 420 LKQMSDTGELEKIIDDVLAANAKSVEEFRAGKEKAFNALVGQAMKATKGKANPAQVNELL 479

Query: 493 KEKLG 497
           K+KLG
Sbjct: 480 KKKLG 484


>gi|119477383|ref|ZP_01617574.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [marine gamma
           proteobacterium HTCC2143]
 gi|119449309|gb|EAW30548.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [marine gamma
           proteobacterium HTCC2143]
          Length = 481

 Score =  483 bits (1243), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 242/483 (50%), Positives = 329/483 (68%), Gaps = 12/483 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE VIG+EVH QL+  SK+FSG+S  FGAEPNTQ +  D AMPG LP+ N + ++ A+M
Sbjct: 2   EWETVIGLEVHVQLATKSKIFSGSSTAFGAEPNTQANAVDLAMPGTLPVPNEQALRYAIM 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL ++A IN+ S+F RKNYFYPD P+GYQ +Q D+PIVG G V V +    S   R   
Sbjct: 62  FGLAIDAEINQRSIFDRKNYFYPDSPKGYQTTQMDEPIVGPGIVEVQMPNGDSKSIR--- 118

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
             I   HLE+DAGKS+H+ +   + IDLNR+G  L+EIV++PDMR+S EA  F  KL +I
Sbjct: 119 --IHHAHLEEDAGKSLHEDFHGSTGIDLNRAGTPLIEIVSEPDMRTSEEAVEFAKKLHAI 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +  LG  DG+M +GSMR DVNVSV   G+  +GTR E KN+NS +F+  AI  E  RQI 
Sbjct: 177 VTSLGISDGHMSQGSMRFDVNVSVRPKGQGEYGTRTETKNLNSFKFMEEAIALEVERQID 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           +LEDGG I QETRL++      RS+R+KE+A DYRYF  PDLLP+ ID  +I AI+  +P
Sbjct: 237 VLEDGGSIYQETRLYNGETKVARSMRSKEEANDYRYFPCPDLLPIIIDSPYIEAIRSSLP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLN 378
           ELPD +R RF+ ++ +S YDAS+L SDKS A+YFE    V +D K+ ANWV+ +L   LN
Sbjct: 297 ELPDTRRSRFVDKYRLSSYDASILSSDKSTAEYFETVFNVCKDAKLAANWVMGELTAKLN 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
               SI ++PIS + LG+LI+ IID TISGKIAK +F  +W   G    ++E  GL+QV+
Sbjct: 357 SESLSIHESPISADNLGKLIERIIDHTISGKIAKQVFESIWNGEGNADVVIEAKGLKQVS 416

Query: 439 DLSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           D S +E +V++V++ NP+ VA         +  ++ +FVGQ+MK + G+ANP +V K+L 
Sbjct: 417 DSSELESMVEDVMSKNPDQVANYHNADDVKRKKMIGFFVGQIMKVSKGQANPGMVNKILM 476

Query: 494 EKL 496
           +KL
Sbjct: 477 QKL 479


>gi|115353213|ref|YP_775052.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           ambifaria AMMD]
 gi|122321947|sp|Q0BAV5|GATB_BURCM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|115283201|gb|ABI88718.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Burkholderia ambifaria AMMD]
          Length = 491

 Score =  483 bits (1243), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 245/488 (50%), Positives = 340/488 (69%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGA   FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGAPTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE- 140
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++       E 
Sbjct: 65  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKPAYEK 124

Query: 141 -VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 125 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKSLHA 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQ 243

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I +D+I  ++  
Sbjct: 244 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGQDWIERVQAG 303

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLL 374
           +PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+ 
Sbjct: 304 MPELPAAIQQRFVEQYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAANAKIAANWLMGDVS 363

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK----EIVE 430
             LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF+ +W++  T +     I++
Sbjct: 364 SQLNRDGIEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFSAIWDEKATDEAAADRIID 423

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP  V 
Sbjct: 424 AKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVN 483

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 484 ELLKKKLG 491


>gi|167892296|ref|ZP_02479698.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei 7894]
 gi|167917053|ref|ZP_02504144.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei BCC215]
          Length = 490

 Score =  483 bits (1242), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 249/488 (51%), Positives = 342/488 (70%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGA+PNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSG-QFRTI 139
           GL + A +   SVFARKNYFYPDLP+GYQISQ++ P+V  G++++ +   +K+G Q  + 
Sbjct: 64  GLAIGATVAPRSVFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 184 LVMWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQ 242

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D+I  +K +
Sbjct: 243 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWIARVKGE 302

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA---VNRDKKIVANWVINDLL 374
           +PELP A ++RF+ ++G+S YDA VL S K++A+YFE L       + K+ ANW++ D+ 
Sbjct: 303 MPELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAEYFEALVAKAGAANAKLAANWLMGDVS 362

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG----GTPKEIVE 430
             LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G    ++E
Sbjct: 363 SQLNRDGIDIDACPVSAAQLALVLQRIADGTISNKIAKEIFVTIWDEKAADEGAADRLIE 422

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  VGQ MK T GKANP  V 
Sbjct: 423 AKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKDKAFNALVGQAMKATKGKANPQQVN 482

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 483 ELLKKKLG 490


>gi|170703195|ref|ZP_02894002.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           ambifaria IOP40-10]
 gi|170131892|gb|EDT00413.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           ambifaria IOP40-10]
          Length = 490

 Score =  483 bits (1242), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 246/488 (50%), Positives = 342/488 (70%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGA   FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGAPTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSGQ-FRTI 139
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +   +K+G+     
Sbjct: 64  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPASEKAGKPAYEK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKSLHA 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 184 LVVWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQ 242

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I +D+I  ++  
Sbjct: 243 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGQDWIERVQAG 302

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLL 374
           +PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+ 
Sbjct: 303 MPELPAAIQQRFVEQYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAANAKIAANWLMGDVS 362

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK----EIVE 430
             LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF+ +W++  T +     I++
Sbjct: 363 SQLNRDGIEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFSAIWDEKATDEAAADRIID 422

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP  V 
Sbjct: 423 AKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVN 482

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 483 ELLKKKLG 490


>gi|29654766|ref|NP_820458.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Coxiella
           burnetii RSA 493]
 gi|47115764|sp|Q83BM8|GATB_COXBU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|29542034|gb|AAO90972.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Coxiella burnetii RSA 493]
          Length = 477

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 244/482 (50%), Positives = 327/482 (67%), Gaps = 12/482 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE VIG+EVH QL   SK+FSGA+  +GAEPNTQ    D  +PG+LP+LN   V+ AV 
Sbjct: 2   EWEPVIGLEVHVQLRTQSKIFSGAATAYGAEPNTQACAIDLGLPGVLPVLNKEAVKLAVC 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL +NA I  YS+FARKNYFYPDLP+GYQISQ++ PIV  G + +    ++ G   T  
Sbjct: 62  FGLSVNASIPPYSIFARKNYFYPDLPKGYQISQYNFPIVQNGHLDIE---NEDGT--TKR 116

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           +GI R HLE+DAGKS H+     S ID NR+G  L+EIV++PD+RS+ EA A+L  L S+
Sbjct: 117 IGITRAHLEEDAGKSFHEGMQGYSGIDFNRAGTPLLEIVSEPDIRSAQEAVAYLKALHSL 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG--EAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           +RY+G  D NM+EG+ R DVN+S+ RP   E +GTR E+KNVNS RF+  AI +E  RQ 
Sbjct: 177 VRYIGVSDANMQEGAFRCDVNISL-RPKSEEKFGTRAEIKNVNSFRFVERAILFEINRQK 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ILE+GG I QETRL+D  ++ETRS+RTKE+A DYRYF +PDLLP+EI  +FI A+K Q+
Sbjct: 236 EILENGGTIVQETRLYDAVQDETRSMRTKEEAHDYRYFPDPDLLPVEIGPEFIEAVKNQL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP  KR+RF   + +S YD  +L +   IA+YFE   K+      K+ ANW+  DL  
Sbjct: 296 PELPWEKRKRFAASYQLSNYDVKLLTTQIEIANYFETVLKIDKTIPPKLAANWINGDLAA 355

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            LN++  SI  +PI+  QL  L+  I D T+SG + K +F  +W   G    I+E  GL+
Sbjct: 356 ALNKNNLSITQSPINAEQLAGLLHRIADNTLSGSMGKQVFETMWGGEGDADTIIERHGLK 415

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q+TD  A+EK++DEVI +NP  V +  + K  L+++FVGQVMK T GKANP  V ++ K+
Sbjct: 416 QITDTEALEKIIDEVIENNPTQVEQYRSGKDKLIAFFVGQVMKATKGKANPQQVNELFKK 475

Query: 495 KL 496
           KL
Sbjct: 476 KL 477


>gi|53724971|ref|YP_102004.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           mallei ATCC 23344]
 gi|121598654|ref|YP_994078.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           mallei SAVP1]
 gi|124384355|ref|YP_001028259.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           mallei NCTC 10229]
 gi|126451255|ref|YP_001081903.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           mallei NCTC 10247]
 gi|167001942|ref|ZP_02267732.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei PRL-20]
 gi|238561928|ref|ZP_00441229.2| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia mallei
           GB8 horse 4]
 gi|254177115|ref|ZP_04883772.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei ATCC 10399]
 gi|254203684|ref|ZP_04910044.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei FMH]
 gi|254208660|ref|ZP_04915008.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei JHU]
 gi|254360285|ref|ZP_04976555.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei 2002721280]
 gi|81605677|sp|Q62MR3|GATB_BURMA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|166217739|sp|A3MNR7|GATB_BURM7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|166217740|sp|A2S8J0|GATB_BURM9 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|166217741|sp|A1V775|GATB_BURMS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|52428394|gb|AAU48987.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia mallei
           ATCC 23344]
 gi|121227464|gb|ABM49982.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei SAVP1]
 gi|124292375|gb|ABN01644.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei NCTC 10229]
 gi|126244125|gb|ABO07218.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei NCTC 10247]
 gi|147745196|gb|EDK52276.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei FMH]
 gi|147750536|gb|EDK57605.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei JHU]
 gi|148029525|gb|EDK87430.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei 2002721280]
 gi|160698156|gb|EDP88126.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei ATCC 10399]
 gi|238523634|gb|EEP87071.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia mallei
           GB8 horse 4]
 gi|243062350|gb|EES44536.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei PRL-20]
          Length = 490

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 250/488 (51%), Positives = 341/488 (69%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGA+PNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSG-QFRTI 139
           GL + A +   SVFARKNYFYPDLP+GYQISQ++ P+V  G++++ +   +K+G Q  + 
Sbjct: 64  GLAIGATVAPRSVFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 184 LVMWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQ 242

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D+I  +K +
Sbjct: 243 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWIARVKGE 302

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA---VNRDKKIVANWVINDLL 374
           +PELP   ++RFI ++G+S YDA VL S K++A+YFE L       + K+ ANW++ D+ 
Sbjct: 303 MPELPAVMQQRFIEQYGVSAYDAGVLTSTKAMAEYFEALVAKAGAANAKLAANWLMGDVS 362

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG----GTPKEIVE 430
             LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G    I+E
Sbjct: 363 SQLNRDGIDIDACPVSAAQLALVLQRIADGTISNKIAKEIFVTIWDEKAADEGAADRIIE 422

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  VGQ MK T GKANP  V 
Sbjct: 423 AKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKDKAFNALVGQAMKATKGKANPQQVN 482

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 483 ELLKKKLG 490


>gi|153209977|ref|ZP_01947550.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Coxiella burnetii 'MSU Goat Q177']
 gi|154706369|ref|YP_001423933.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Coxiella
           burnetii Dugway 5J108-111]
 gi|161830892|ref|YP_001597315.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Coxiella
           burnetii RSA 331]
 gi|165924156|ref|ZP_02219988.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Coxiella burnetii RSA 334]
 gi|212219199|ref|YP_002305986.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Coxiella
           burnetii CbuK_Q154]
 gi|189045276|sp|A9KBI1|GATB_COXBN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|189045277|sp|A9N8Z5|GATB_COXBR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|229486062|sp|B6J4H6|GATB_COXB1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|120575203|gb|EAX31827.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Coxiella burnetii 'MSU Goat Q177']
 gi|154355655|gb|ABS77117.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Coxiella burnetii Dugway 5J108-111]
 gi|161762759|gb|ABX78401.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Coxiella burnetii RSA 331]
 gi|165916395|gb|EDR34999.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Coxiella burnetii RSA 334]
 gi|212013461|gb|ACJ20841.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Coxiella burnetii CbuK_Q154]
          Length = 477

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 243/481 (50%), Positives = 326/481 (67%), Gaps = 10/481 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE VIG+EVH QL   SK+FSGA+  +GAEPNTQ    D  +PG+LP+LN   V+ AV 
Sbjct: 2   EWEPVIGLEVHVQLRTQSKIFSGAATAYGAEPNTQACAIDLGLPGVLPVLNKEAVKLAVC 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL +NA I  YS+FARKNYFYPDLP+GYQISQ++ PIV  G + +    ++ G   T  
Sbjct: 62  FGLSVNASIPPYSIFARKNYFYPDLPKGYQISQYNFPIVQNGHLDIE---NEDGT--TKR 116

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           +GI R HLE+DAGKS H+     S ID NR+G  L+EIV++PD+RS+ EA A+L  L S+
Sbjct: 117 IGITRAHLEEDAGKSFHEGMQGYSGIDFNRAGTPLLEIVSEPDIRSAQEAVAYLKALHSL 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGE-AWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +RY+G  D NM+EG+ R DVN+S+   GE  +GTR E+KNVNS RF+  AI +E  RQ  
Sbjct: 177 VRYIGVSDANMQEGAFRCDVNISLRPKGEEKFGTRAEIKNVNSFRFVERAILFEINRQKE 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ILE+GG I QETRL+D  ++ETRS+RTKE+A DYRYF +PDLLP+EI  +FI A+K Q+P
Sbjct: 237 ILENGGTIVQETRLYDAVQDETRSMRTKEEAHDYRYFPDPDLLPVEIGPEFIEAVKNQLP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLGV 376
           ELP  KR+RF   + +S YD  +L +   IA+YFE   K+      K+ ANW+  DL   
Sbjct: 297 ELPWEKRKRFAASYQLSNYDVKLLTTQIEIANYFETVLKIDKTIPPKLAANWINGDLAAA 356

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++  SI  +PI+  QL  L+  I D T+SG + K +F  +W   G    I+E  GL+Q
Sbjct: 357 LNKNNLSITQSPINAEQLAGLLHRIADNTLSGSMGKQVFETMWGGEGDADTIIERHGLKQ 416

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           +TD  A+EK++DEVI +NP  V +  + K  L+++FVGQVMK T GKANP  V ++ K+K
Sbjct: 417 ITDTEALEKIIDEVIENNPTQVEQYRSGKDKLIAFFVGQVMKATKGKANPQQVNELFKKK 476

Query: 496 L 496
           L
Sbjct: 477 L 477


>gi|71905762|ref|YP_283349.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Dechloromonas
           aromatica RCB]
 gi|109892017|sp|Q47JV2|GATB_DECAR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|71845383|gb|AAZ44879.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Dechloromonas aromatica RCB]
          Length = 484

 Score =  482 bits (1240), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 255/483 (52%), Positives = 334/483 (69%), Gaps = 10/483 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIGIE HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN + V+ A+  
Sbjct: 4   WEVVIGIETHAQLSTVSKIFSGASTAFGAEPNTQACAVDLALPGVLPVLNKKAVECAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP-DKSGQFRTIE 140
           GL + A + + SVFARKNYFYPDLP+GYQISQ D P+V  G +++ +G  DK+  +  I 
Sbjct: 64  GLAIGAEVAQKSVFARKNYFYPDLPKGYQISQMDLPVVVGGNITLQVGQGDKA--YEKI- 120

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           V + R HLE+DAGKS+H+ +   S IDLNR+G  L+EIV++PDMRSS EA A+   L ++
Sbjct: 121 VRLTRAHLEEDAGKSLHEDFHGKSGIDLNRAGTPLLEIVSEPDMRSSDEAVAYARALHAL 180

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +R++G CDGNM+EGS R D NVSV   G+A +GTR E+KN+NS RF+  AI++E + QI 
Sbjct: 181 VRWIGICDGNMQEGSFRCDANVSVRPKGQAEFGTRREIKNLNSFRFMKEAIDFEVQWQIN 240

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
            +E+G  I+Q T LFDP   ETR +R+KEDA DYRYF +PDLLPL I  ++I  ++ ++P
Sbjct: 241 EIEEGRKIQQATVLFDPDTGETRMMRSKEDAHDYRYFPDPDLLPLMIPAEWIARVQGEMP 300

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLGV 376
           ELP  +RERF G+ G+S YDAS L + + IADYFE    +A   + K  ANWV+ DL   
Sbjct: 301 ELPVQRRERFAGDLGLSAYDASALTASQEIADYFEAVVAIAGKANAKPCANWVMVDLAAR 360

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLR 435
           LN+ GK I D+P+S  QL  LI  I D TIS  IAK +F  LW  +G T  E++++ GL+
Sbjct: 361 LNKDGKDIADSPVSAAQLAGLIQRIADSTISNNIAKKVFEALWNGEGATADEVIDKQGLK 420

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q+TD  AIE +VDEV+ +N  NVA   A K    +  VGQVMK   GKANP  V  +LK+
Sbjct: 421 QITDTGAIEALVDEVLAANAANVAEFKAGKEKAFNALVGQVMKAAKGKANPQQVNDLLKQ 480

Query: 495 KLG 497
           KL 
Sbjct: 481 KLA 483


>gi|312797576|ref|YP_004030498.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Burkholderia rhizoxinica HKI 454]
 gi|312169351|emb|CBW76354.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (EC
           6.3.5.-) [Burkholderia rhizoxinica HKI 454]
          Length = 539

 Score =  482 bits (1240), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 244/501 (48%), Positives = 337/501 (67%), Gaps = 11/501 (2%)

Query: 7   HVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGM 66
           H     S     T  WEVVIG+E H QLS  SK+FSGA+  FGAEPNTQ    D A+PG 
Sbjct: 38  HRLAQASAGGSLTMQWEVVIGLETHVQLSTQSKIFSGAATRFGAEPNTQACALDLALPGT 97

Query: 67  LPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSV 126
           LP++N   V++A+  GL + A I   SVFARKNYFYPDLP+GYQISQ++ P+V  G +++
Sbjct: 98  LPVVNRGAVERAIRFGLAIGAAIAPRSVFARKNYFYPDLPKGYQISQYELPVVQGGSITI 157

Query: 127 SIGPDKSGQFRTIE--VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDM 184
            +  ++       E  + + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDM
Sbjct: 158 QVEANEKAGRDAYEKTIRLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDM 217

Query: 185 RSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-AWGTRCEVKNVNSI 243
           RS+ EA A+   L S++ +LG CDGNM+EGS R D NVSV R GE A GTR E+KN+NS 
Sbjct: 218 RSAAEAVAYAKALHSLVVWLGICDGNMQEGSFRCDANVSVRRLGEQALGTRAEIKNLNSF 277

Query: 244 RFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLP 303
           RFL  AI+YE RRQI ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDL+P
Sbjct: 278 RFLEEAIQYEVRRQIELIEDGGTVVQETRLYDPDRGETRSMRSKEDAHDYRYFPDPDLMP 337

Query: 304 LEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL---AVNR 360
           L ID ++I  + + +PELPDA + RF  ++G+  YDA +L + +++A Y+E++   A   
Sbjct: 338 LVIDSEWIAEVGRALPELPDAMKRRFTEQYGLPGYDAGMLTTSQALAAYYEQVVSKAGVA 397

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           + K+ ANWV+ +L   LNR G  I  +P+S  QL  ++  I DGTIS KI K IF  +W+
Sbjct: 398 NAKMAANWVMGELASQLNRDGLDIAQSPVSAAQLALVLVRIADGTISNKIGKAIFGAIWD 457

Query: 421 KGGT----PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQV 475
           +  T       I++  GLRQ++D  A+E ++DEV+ +NP +V    A K    +  VGQ 
Sbjct: 458 EKATDDTAADRIIDAKGLRQISDSGALEAILDEVLAANPKSVDEYRAGKDKAFNALVGQA 517

Query: 476 MKNTGGKANPSIVQKMLKEKL 496
           MK T G+ANP  V ++LK+KL
Sbjct: 518 MKATKGRANPQQVNELLKKKL 538


>gi|134093454|ref|YP_001098529.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Herminiimonas
           arsenicoxydans]
 gi|166217764|sp|A4G1L3|GATB_HERAR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|133737357|emb|CAL60400.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Herminiimonas arsenicoxydans]
          Length = 486

 Score =  481 bits (1239), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 239/484 (49%), Positives = 336/484 (69%), Gaps = 11/484 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E H QL+  +K+FSG+   FGA PNTQ S  D A+PG LP++N   V++A+  
Sbjct: 3   WEVVIGLETHTQLTTKTKIFSGSPTRFGAAPNTQTSPVDLALPGALPVMNRSAVERAIQF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A I  YSVFARKNYFYPDLP+GYQISQ D PIV  G+VS ++  D   + R+++ 
Sbjct: 63  GLAIGATIAPYSVFARKNYFYPDLPKGYQISQMDLPIVQGGRVSFAMEVDGKTEIRSVQ- 121

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS+H+ Y  ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L +++
Sbjct: 122 -LTRAHLEEDAGKSLHEDYHGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKALHTLV 180

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            ++G CDGNM+EGS R D NVSV   G+  +GTRCE+KN+NS RF+  AI YE RRQI +
Sbjct: 181 TWIGICDGNMQEGSFRCDANVSVRPVGQKEYGTRCEIKNLNSFRFMEDAINYEVRRQIEL 240

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q TRL+DP K ETR +R+KE+A DYRYF +PDL PL +  ++I  ++ ++PE
Sbjct: 241 IEDGGRVVQATRLYDPDKKETREMRSKENAHDYRYFPDPDLPPLVVSAEWITRVQAEMPE 300

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLGVL 377
           LP A RERF  E+G+S YDA+VL   K++A+YFE    +A +   K  AN ++ D+   +
Sbjct: 301 LPGAMRERFTREYGLSDYDAAVLTQSKAMANYFELICSIAGHEQAKPAANLLMGDVASAV 360

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPK---EIVEELG 433
           NR G  ++  P+S  QL  L+  I DGTIS KIAK++F  +WE K  +P    E++E  G
Sbjct: 361 NRDGIELDAAPVSAAQLAVLLHRIADGTISNKIAKEVFGAMWEAKSDSPTIADELIESKG 420

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           L+Q++D  A+EK+VD+V+ +N  +V    A K   ++  +GQ MK + GKANP+ + ++L
Sbjct: 421 LKQISDSGALEKIVDDVLAANTKSVEEFRAGKEQAINALMGQAMKASKGKANPAQLTELL 480

Query: 493 KEKL 496
           K+KL
Sbjct: 481 KKKL 484


>gi|222053490|ref|YP_002535852.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacter sp.
           FRC-32]
 gi|254790950|sp|B9LZ19|GATB_GEOSF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|221562779|gb|ACM18751.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacter sp.
           FRC-32]
          Length = 479

 Score =  481 bits (1238), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 243/482 (50%), Positives = 323/482 (67%), Gaps = 12/482 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           ++  VIG+EVH QL+  +K+F G S  FGAEPN+Q       MPG LP+LN + V+ A+ 
Sbjct: 2   EYRAVIGLEVHVQLNTNTKIFCGCSTKFGAEPNSQTCPVCLGMPGALPVLNRKVVEYAIK 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL  N  I   S+FARKNYFYPDLP+GYQISQ++ PI   G + + +     G  + I 
Sbjct: 62  AGLATNCEIAPRSIFARKNYFYPDLPKGYQISQYELPICSAGHLDIQV----EGTAKRI- 116

Query: 141 VGIERIHLEQDAGKSIHDQYSAV---SCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
            GI RIH+E+DAGK +H     V   SC+DLNR+   L+EIV++PD+RS+ EA A+L KL
Sbjct: 117 -GITRIHMEEDAGKLVHADVPGVGDDSCVDLNRACTPLLEIVSEPDLRSADEAVAYLKKL 175

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARR 256
             I+ YLG  DGNMEEGS R D NVSV R G + +GTR E KNVNS +F+  AIEYE  R
Sbjct: 176 HQIVVYLGISDGNMEEGSFRCDANVSVMRVGADKFGTRTETKNVNSFKFVKQAIEYEIER 235

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI ++EDGG I QETRLFDP+   TRS+R KE+A DYRYF +PDL+PL I  D++  ++ 
Sbjct: 236 QIEVIEDGGKIVQETRLFDPNTGVTRSMRGKEEAHDYRYFPDPDLVPLVISNDWVEDVRL 295

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLG 375
            +PELP+AKR R++ E G+  YDA VL + + +ADYFE  L  +   K VANWV+ ++  
Sbjct: 296 GLPELPEAKRLRYMDELGLPAYDAEVLTASRELADYFEACLEFHSQPKPVANWVMGEVTR 355

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            LN   +SI D P++P  L EL+ LI  GTISGKIAK +F+ +W  G  P ++VEE GL 
Sbjct: 356 ALNEENRSITDAPVTPQLLAELLQLIDKGTISGKIAKTVFDEMWRTGKAPAKVVEEKGLV 415

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           QV+D   IEK++DEV+      VA   + K  L  +FVGQVM+ + GKANP++V ++L +
Sbjct: 416 QVSDTGEIEKIIDEVLAREAGQVAEYRSGKDKLFGFFVGQVMRASKGKANPAVVNELLLK 475

Query: 495 KL 496
           KL
Sbjct: 476 KL 477


>gi|77919763|ref|YP_357578.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pelobacter
           carbinolicus DSM 2380]
 gi|109892043|sp|Q3A2J9|GATB_PELCD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|77545846|gb|ABA89408.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Pelobacter carbinolicus DSM 2380]
          Length = 478

 Score =  481 bits (1238), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 241/483 (49%), Positives = 331/483 (68%), Gaps = 14/483 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  +EVVIG+EVH QL+  +K+F   S+ FG +PN+Q       +PG LP+LN + V+ A
Sbjct: 2   TSRYEVVIGLEVHVQLTTQTKIFCNCSIAFGNQPNSQTCPVCLGLPGALPVLNRKVVEYA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSGQFR 137
           + TGL  N  I   S+FARKNYFYPDLP+GYQISQ + PI   G++ + + G  KS    
Sbjct: 62  IKTGLATNCSIAPRSIFARKNYFYPDLPKGYQISQFELPICEHGRLDIDVDGTSKS---- 117

Query: 138 TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
              +GI RIH+E+DAGK +HD     S +DLNR+   LMEIV++PDMRSS EA A+L KL
Sbjct: 118 ---IGITRIHMEEDAGKLLHDD-GDTSRVDLNRACTPLMEIVSEPDMRSSDEAIAYLKKL 173

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
             I+ YLG CDGN+EEGS R D NVS+ RP   + +GTR E+KN+NS RF+  AI+YE  
Sbjct: 174 HQIVVYLGVCDGNLEEGSFRCDANVSI-RPWGQKEFGTRAELKNINSFRFIKQAIDYEIE 232

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQ  IL+DGG + QETRLFD +   TRS+R+KE+A DYRYF +PDL+PL + +D++  I+
Sbjct: 233 RQADILDDGGTVVQETRLFDTASGTTRSMRSKEEAHDYRYFPDPDLVPLIVSDDWVEQIR 292

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLL 374
           +++PELP+AK  RF+GE GI  YDA VL +D+++A+Y++ L   + + K+ ANWV+ +L 
Sbjct: 293 RELPELPEAKIARFVGELGIPQYDAEVLAADRAMAEYYDSLVKAHGNAKLCANWVMGELQ 352

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
             LN SG  I + P++P  L  ++  I D TIS KIAK +F+ +W+ G     I+EE GL
Sbjct: 353 RALNDSGAGIAECPVTPPMLAGILQRIDDNTISNKIAKTVFDAMWQSGKDADTIIEEQGL 412

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           +QVTD  AIE V+DEV+ +NP+ V      K  L+ +FVGQVM+ T GKANP  + ++LK
Sbjct: 413 KQVTDTGAIEAVIDEVLAANPSQVEEYRGGKDKLMGFFVGQVMRATKGKANPKTLNELLK 472

Query: 494 EKL 496
           +KL
Sbjct: 473 KKL 475


>gi|207727542|ref|YP_002255936.1| aspartyl/glutamyl-trna(asn/gln) amidotransferase subunit b
           (asp/glu-adt subunit b) protein [Ralstonia solanacearum
           MolK2]
 gi|206590779|emb|CAQ56391.1| aspartyl/glutamyl-trna(asn/gln) amidotransferase subunit b
           (asp/glu-adt subunit b) protein [Ralstonia solanacearum
           MolK2]
          Length = 488

 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 248/485 (51%), Positives = 334/485 (68%), Gaps = 12/485 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS  SK+FSGAS  FGA PNTQ +  D A+PG+LP+LN   V++A+  
Sbjct: 3   WEVVIGLETHAQLSTASKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAIRF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQ-FRTIE 140
           GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +   KSGQ      
Sbjct: 63  GLAIGATIAPKSIFARKNYFYPDLPKGYQISQYEIPVVQGGTLTIQV-EGKSGQPGYEKT 121

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L ++
Sbjct: 122 VHLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSATEAVAYAKALHAL 181

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG--EAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           + +LG CDGNM+EGS R D NVSV RPG    +GTRCE+KN+NS RFL  AI YE RRQI
Sbjct: 182 VVWLGICDGNMQEGSFRCDANVSV-RPGPDAPYGTRCEIKNLNSFRFLEEAINYEVRRQI 240

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPL I  D++ A++  +
Sbjct: 241 ELIEDGGTVVQETRLYDPDRKETRSMRSKEDAHDYRYFPDPDLLPLVIGADWVDAVRATL 300

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A   RF   +G+  YDAS+L + K+ A YFE     A   + K  ANW++ ++  
Sbjct: 301 PELPAAMAVRFESAYGLPKYDASILTATKATAAYFEAVVAAAGAANAKAAANWIMGEVAS 360

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEEL 432
            LNR+G  I+  P+SP QL +L+  I DGTIS   A KD+F  +W  E GG    I+ E 
Sbjct: 361 NLNRAGLEIDAAPVSPAQLAKLLARIADGTISNNTAKKDVFPAMWAGEHGGDADTIIAEK 420

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q++D   +EK++D+V+ +N  +V    A K    +  VGQ MK T GKANP+ V ++
Sbjct: 421 GLKQMSDSGELEKIIDDVLAANAKSVEEYRAGKEKAFNALVGQAMKATRGKANPAQVNEL 480

Query: 492 LKEKL 496
           LK+KL
Sbjct: 481 LKKKL 485


>gi|167834998|ref|ZP_02461881.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           thailandensis MSMB43]
          Length = 490

 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 250/488 (51%), Positives = 342/488 (70%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSGQ-FRTI 139
           GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +   +K+G+   + 
Sbjct: 64  GLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKDAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHA 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 184 LVVWLGICDGNMQEGSFRCDANVSV-RPLGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQ 242

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D+I  +K +
Sbjct: 243 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWIERVKGE 302

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLL 374
           +PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+ 
Sbjct: 303 MPELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAAYFEAVVAKAGAANAKIAANWLMGDVS 362

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG----GTPKEIVE 430
             LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G    I+E
Sbjct: 363 SQLNRDGVEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFVTIWDEKAADEGAADRIIE 422

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  VGQ MK T GKANP  V 
Sbjct: 423 AKGLKQISDTGALEAIIDEVLAANAKSVEEFHAGKEKAFNALVGQAMKATKGKANPQQVN 482

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 483 ELLKKKLG 490


>gi|161526273|ref|YP_001581285.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           multivorans ATCC 17616]
 gi|189349013|ref|YP_001944641.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           multivorans ATCC 17616]
 gi|221214690|ref|ZP_03587660.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia multivorans CGD1]
 gi|226709600|sp|A9AC50|GATB_BURM1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|160343702|gb|ABX16788.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           multivorans ATCC 17616]
 gi|189333035|dbj|BAG42105.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Burkholderia multivorans ATCC 17616]
 gi|221165580|gb|EED98056.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia multivorans CGD1]
          Length = 491

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 248/488 (50%), Positives = 337/488 (69%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE- 140
           GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +  ++       E 
Sbjct: 65  GLAIGATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGAITIQVPANEKAGKPAYEK 124

Query: 141 -VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 125 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHA 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQ 243

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D++  ++  
Sbjct: 244 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGRDWVERVQAG 303

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLL 374
           +PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+ 
Sbjct: 304 MPELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAAYFEAVVAKAGAANAKIAANWLMGDVS 363

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVE 430
             LNR G  I+  P+S  QL  L+  I DGTIS KIAK++F  +WE+     G    I+E
Sbjct: 364 SQLNRDGIEIDAIPVSAAQLALLLQRIADGTISNKIAKEVFATMWEEKASDDGAADRIIE 423

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP  V 
Sbjct: 424 AKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVN 483

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 484 ELLKKKLG 491


>gi|206558887|ref|YP_002229647.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           cenocepacia J2315]
 gi|229486048|sp|B4E7X7|GATB_BURCJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|198034924|emb|CAR50796.1| glutamyl-tRNA amidotransferase subunit B [Burkholderia cenocepacia
           J2315]
          Length = 491

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 248/488 (50%), Positives = 338/488 (69%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE- 140
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++       E 
Sbjct: 65  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKAAYEK 124

Query: 141 -VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 125 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQ 243

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I +D+I  ++  
Sbjct: 244 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGQDWIERVQSG 303

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLL 374
           +PELP A ++RF+ E+G+S YDA VL S K++A YFE     A   + KI ANW++ D+ 
Sbjct: 304 MPELPAAMQQRFVDEYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAANAKIAANWLMGDVS 363

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG----GTPKEIVE 430
             LNR G  I+  P+S  QL  L+  I DGTIS KIAK+IF  +W++     G    I++
Sbjct: 364 SQLNRDGIEIDAIPVSAAQLALLLQRIADGTISNKIAKEIFATIWDEKATDEGAADRIID 423

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP  V 
Sbjct: 424 AKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVN 483

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 484 ELLKKKLG 491


>gi|225850110|ref|YP_002730344.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Persephonella
           marina EX-H1]
 gi|254790961|sp|C0QUH9|GATB_PERMH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|225645542|gb|ACO03728.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Persephonella marina EX-H1]
          Length = 474

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 237/481 (49%), Positives = 333/481 (69%), Gaps = 14/481 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           ++E VIG+EVH Q+S  +K F    + FGAEPNT V      MPG LP+LN + ++ A+ 
Sbjct: 2   EFEPVIGLEVHVQMSTNTKCFCSCKIEFGAEPNTNVCPVCLGMPGSLPVLNKKALEYAIK 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
             L LN  +++ SVFARKNYFYPDLP+GYQISQ+DKP+   G + + +  DK+ + R   
Sbjct: 62  ASLALNCEVHELSVFARKNYFYPDLPKGYQISQYDKPLATNGYIDIKVN-DKTERIR--- 117

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
             I R+H+E+DAGK+IH    + S +DLNR+G  LMEIV++PD+RS++ A+ +L KLR+I
Sbjct: 118 --IHRLHMEEDAGKTIHK--GSYSYVDLNRAGTPLMEIVSEPDIRSAVGARLYLEKLRNI 173

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG--EAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           +RY+G  D +ME+G +R DVN+S+ RP   E +GT+ E+KN+NS RF+  AIEYE  RQ 
Sbjct: 174 MRYIGVSDADMEKGQLRCDVNISL-RPKGEEKFGTKVEIKNINSFRFVQKAIEYEIERQA 232

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            IL  GG I QETRLFD    +T ++RTKE+A DYRYF +PDL+P+ I +++I  I+K +
Sbjct: 233 RILRKGGEIVQETRLFDEKTGKTFTMRTKEEAHDYRYFPDPDLIPVRITKEYIEEIRKSL 292

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL--AVNRDKKIVANWVINDLLGV 376
           PELPD K ER++ E  ++ YDA VLV+DK  A +FEK     + + K +ANW+IN+LLG 
Sbjct: 293 PELPDQKAERYVKELKLTEYDAEVLVADKDRALFFEKAVSVYSENPKSIANWIINELLGK 352

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN  G  I ++P+ P  + EL+ LI  G IS KI K++F  +++ G +PK IVEE GL+Q
Sbjct: 353 LNEEGIEISNSPVRPEHIAELVQLIDKGDISSKIGKEVFEEVFKTGKSPKTIVEEKGLKQ 412

Query: 437 VTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D   I K+V+EV+N++P  V +  A    L+ +FVGQVMK T GKANP +V K+L+E 
Sbjct: 413 VSDEGEIRKIVEEVLNNHPAEVEKYKAGNQKLMGFFVGQVMKATRGKANPKLVNKILQEL 472

Query: 496 L 496
           L
Sbjct: 473 L 473


>gi|83718877|ref|YP_440707.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           thailandensis E264]
 gi|167579379|ref|ZP_02372253.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           thailandensis TXDOH]
 gi|167617480|ref|ZP_02386111.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           thailandensis Bt4]
 gi|257140645|ref|ZP_05588907.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           thailandensis E264]
 gi|109892011|sp|Q2T292|GATB_BURTA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|83652702|gb|ABC36765.1| glutamyl-tRNA [Burkholderia thailandensis E264]
          Length = 490

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 250/488 (51%), Positives = 341/488 (69%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSG-QFRTI 139
           GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +   +K+G Q  + 
Sbjct: 64  GLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 184 LVVWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQ 242

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D+I  +K +
Sbjct: 243 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWIERVKGE 302

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLL 374
           +PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+ 
Sbjct: 303 MPELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAAYFEAVVAKAGAANAKIAANWLMGDVS 362

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG----GTPKEIVE 430
             LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G    I++
Sbjct: 363 SQLNRDGIDIDACPVSAAQLALVLQRIADGTISNKIAKEIFVAIWDEKAADEGAADRIID 422

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  VGQ MK T GKANP  V 
Sbjct: 423 AKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALVGQAMKATKGKANPQQVN 482

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 483 ELLKKKLG 490


>gi|119896462|ref|YP_931675.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Azoarcus sp.
           BH72]
 gi|166217732|sp|A1K1T3|GATB_AZOSB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|119668875|emb|CAL92788.1| glutamyl-tRNA(GLN) amidotransferase subunit B [Azoarcus sp. BH72]
          Length = 486

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 242/483 (50%), Positives = 331/483 (68%), Gaps = 8/483 (1%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           DWEVVIG+EVHAQL+  SK+FSGAS  FGAEPN Q S  D A+PG+LP+LN   V++A+ 
Sbjct: 5   DWEVVIGLEVHAQLNTASKIFSGASTAFGAEPNVQASAVDIALPGVLPVLNRGAVERAIR 64

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL + A +   SVFARKNYFYPDLP+GYQISQ + P+V  G +++ +G  ++   +T  
Sbjct: 65  FGLAIGATVAPTSVFARKNYFYPDLPKGYQISQFELPVVQGGTITIRVGEGENAYEKT-- 122

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           V + R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PDMRSS EA A+   L ++
Sbjct: 123 VNLTRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDMRSSAEAVAYARTLHAL 182

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +R++  CDGNM+EGS R D NVSV + G E +GTR E+KN+NS RFL  AI+YE + QI 
Sbjct: 183 VRWIDICDGNMQEGSFRCDANVSVRKKGAEKFGTRREIKNLNSFRFLQQAIDYEVQWQID 242

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
            +EDGG I+Q T LFDP   ETR +R+KEDA DYRYF +PDLLPL I  ++   ++ ++P
Sbjct: 243 TIEDGGTIQQATVLFDPDTGETRMMRSKEDAHDYRYFPDPDLLPLVISPEWKARVQGEMP 302

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL---AVNRDKKIVANWVINDLLGV 376
           ELP+A + RFI + G+S YDA+ L + K +A Y++     A     K  ANWV+ DL   
Sbjct: 303 ELPEAMKARFIEQLGLSAYDATTLTASKEVATYYQATVDAAGAALAKPCANWVMGDLAAR 362

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLR 435
           LN++   I  +P+SP QL  L+  I D TIS  IAK +F  LW  +G +  EI+++ GL+
Sbjct: 363 LNKAELDIAVSPVSPAQLAGLVARIADNTISNAIAKKVFEALWNGEGASADEIIDKQGLK 422

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           QVTD  AIE ++DEV+ +N  +V    A K    +  VGQVMK + GKA+P+ V ++LK+
Sbjct: 423 QVTDSGAIEAMIDEVLAANQKSVEEFRAGKDKAFNALVGQVMKASKGKASPAQVNELLKK 482

Query: 495 KLG 497
           KL 
Sbjct: 483 KLA 485


>gi|300692937|ref|YP_003753932.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (asp/glu-ADT subunit B) [Ralstonia solanacearum PSI07]
 gi|299079997|emb|CBJ52672.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Ralstonia solanacearum PSI07]
          Length = 488

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 245/483 (50%), Positives = 328/483 (67%), Gaps = 8/483 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS  SK+FSGAS  FGA PNTQ +  D A+PG+LP+LN   V++A+  
Sbjct: 3   WEVVIGLETHAQLSTASKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAIRF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +            V
Sbjct: 63  GLAIGATIAPKSIFARKNYFYPDLPKGYQISQYEIPVVQGGTLTIQVEGRNGQPGYEKTV 122

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L +++
Sbjct: 123 HLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKALHALV 182

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            +LG CDGNM+EGS R D NVSV R P   +GTRCE+KN+NS RFL  AI YE RRQI +
Sbjct: 183 VWLGICDGNMQEGSFRCDANVSVRRGPDAPFGTRCEIKNLNSFRFLEEAINYEVRRQIEL 242

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPL I  D++ A++  +PE
Sbjct: 243 IEDGGSVVQETRLYDPDRKETRSMRSKEDAHDYRYFPDPDLLPLMIGSDWVDAVRATLPE 302

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLGVL 377
           LP A   RF   +G+  YDAS+L + K+ A YFE     A   + K   NW++ ++   L
Sbjct: 303 LPVAMAARFESAYGLPRYDASILTATKATAAYFEAVVAAAGAANAKAATNWIMGEVASNL 362

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEELGL 434
           NR+G  I+  P+SP QL +L+  I DGTIS   A KD+F  LW  E GG    I+ E GL
Sbjct: 363 NRAGLEIDAAPVSPEQLAKLLARIADGTISNNTAKKDVFPALWAGEHGGDADAIIAEKGL 422

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           +Q++D   +EK++DEV+ +N  +V    A K    +  VGQ MK T GKANPS V ++LK
Sbjct: 423 KQMSDSGELEKIIDEVLAANAKSVEEFRAGKEKAFNALVGQAMKATRGKANPSQVNELLK 482

Query: 494 EKL 496
           +KL
Sbjct: 483 KKL 485


>gi|83748650|ref|ZP_00945668.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ralstonia solanacearum UW551]
 gi|207741933|ref|YP_002258325.1| aspartyl/glutamyl-trna(asn/gln) amidotransferase subunit b
           (asp/glu-adt subunit b) protein [Ralstonia solanacearum
           IPO1609]
 gi|83724694|gb|EAP71854.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ralstonia solanacearum UW551]
 gi|206593319|emb|CAQ60246.1| aspartyl/glutamyl-trna(asn/gln) amidotransferase subunit b
           (asp/glu-adt subunit b) protein [Ralstonia solanacearum
           IPO1609]
          Length = 488

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 248/485 (51%), Positives = 333/485 (68%), Gaps = 12/485 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS  SK+FSGAS  FGA PNTQ +  D A+PG+LP+LN   V++A+  
Sbjct: 3   WEVVIGLETHAQLSTASKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAIRF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQ-FRTIE 140
           GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +   KSGQ      
Sbjct: 63  GLAIGATIAPKSIFARKNYFYPDLPKGYQISQYEIPVVQGGTLTIQV-EGKSGQPGYEKT 121

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L ++
Sbjct: 122 VHLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSATEAVAYAKALHAL 181

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG--EAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           + +LG CDGNM+EGS R D NVSV RPG     GTRCE+KN+NS RFL  AI YE RRQI
Sbjct: 182 VVWLGICDGNMQEGSFRCDANVSV-RPGPDAPLGTRCEIKNLNSFRFLEEAINYEVRRQI 240

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPL I  D++ A++  +
Sbjct: 241 ELIEDGGTVVQETRLYDPDRKETRSMRSKEDAHDYRYFPDPDLLPLVIGADWVDAVRATL 300

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A   RF   +G+  YDAS+L + K+ A YFE     A   + K  ANW++ ++  
Sbjct: 301 PELPAAMAVRFESAYGLPKYDASILTATKATAAYFEAVVAAAGAANAKAAANWIMGEVAS 360

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEEL 432
            LNR+G  I+  P+SP QL +L+  I DGTIS   A KD+F  +W  E GG    I+ E 
Sbjct: 361 NLNRAGLEIDAAPVSPAQLAKLLARIADGTISNNTAKKDVFPAMWAGEHGGDADTIIAEK 420

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q++D   +EK++D+V+ +N  +V    A K    +  VGQ MK T GKANP+ V ++
Sbjct: 421 GLKQMSDSGELEKIIDDVLAANAKSVEEYRAGKEKAFNALVGQAMKATRGKANPAQVNEL 480

Query: 492 LKEKL 496
           LK+KL
Sbjct: 481 LKKKL 485


>gi|221201878|ref|ZP_03574915.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia multivorans CGD2M]
 gi|221207616|ref|ZP_03580624.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia multivorans CGD2]
 gi|221172462|gb|EEE04901.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia multivorans CGD2]
 gi|221178298|gb|EEE10708.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia multivorans CGD2M]
          Length = 490

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 247/488 (50%), Positives = 337/488 (69%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE- 140
           GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +  ++       E 
Sbjct: 64  GLAIGATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGAITIQVPANEKAGKPAYEK 123

Query: 141 -VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHA 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 184 LVVWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQ 242

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D++  ++  
Sbjct: 243 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGRDWVERVQAG 302

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLL 374
           +PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+ 
Sbjct: 303 MPELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAAYFEAVVAKAGAANAKIAANWLMGDVS 362

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVE 430
             LNR G  I+  P+S  QL  L+  I DGTIS KIAK++F  +WE+     G    I++
Sbjct: 363 SQLNRDGIDIDAIPVSAAQLALLLQRIADGTISNKIAKEVFATMWEEKASDDGAADRIID 422

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP  V 
Sbjct: 423 AKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVN 482

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 483 ELLKKKLG 490


>gi|118581492|ref|YP_902742.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pelobacter
           propionicus DSM 2379]
 gi|166198800|sp|A1ATL4|GATB_PELPD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|118504202|gb|ABL00685.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Pelobacter propionicus DSM 2379]
          Length = 479

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 238/481 (49%), Positives = 334/481 (69%), Gaps = 12/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           ++ VIG+EVH QL   SK+F G S +FG++PN+Q       +PG LP+LN + V+ A+  
Sbjct: 3   YQAVIGLEVHVQLKTDSKIFCGCSTSFGSDPNSQTCPVCLGLPGALPVLNKKVVEFAIKA 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL  N  I + S+FARKNYFYPDLP+GYQISQ + P+   G + + +  +      T  +
Sbjct: 63  GLATNCSITQRSIFARKNYFYPDLPKGYQISQFEDPVCQWGWLDIELNGE------TKRI 116

Query: 142 GIERIHLEQDAGKSIHDQYSAV---SCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
           GI RIH+E+DAGK +H     +   S +DLNR+   L+E+V++PD+RSS EA ++L +L 
Sbjct: 117 GITRIHMEEDAGKLVHADVPELEDGSGVDLNRACTPLLEVVSEPDLRSSDEAVSYLKQLH 176

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
            I+ +LG CDGNMEEGS R D NVSV   G E +GTR E+KN+NS RF+  AIEYE +RQ
Sbjct: 177 QIVTWLGICDGNMEEGSFRCDANVSVMEQGAEKFGTRAEIKNINSFRFVKQAIEYEIQRQ 236

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRLFDP    TRS+R+KE+A DYRYF +PDL+PL ID+D+I+ +++ 
Sbjct: 237 IDLIEDGGTVVQETRLFDPDNGVTRSMRSKEEAHDYRYFPDPDLVPLVIDDDWIQRVRQG 296

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGV 376
           +PELP+ K++RF+ EF I  YDA VL + + +A+Y+E+ +A + D K V+NWV+ ++   
Sbjct: 297 LPELPEHKKQRFMSEFSIPAYDAEVLTASRPLAEYYEECVACHHDGKAVSNWVMGEVTRG 356

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN SG SIE+ P++P  LG L+ L+ +GTISGKIAK +F+ +W+ G  P  IVEE GL Q
Sbjct: 357 LNDSGLSIENCPVTPRLLGGLLKLMDNGTISGKIAKTVFDEMWKSGKEPAVIVEEQGLVQ 416

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D  AI  ++DE++  N   VA   + K  L  +FVGQVMK + GKANPS+V ++L EK
Sbjct: 417 VSDNGAILAIIDEIMAKNQGQVAEYRSGKDKLFGFFVGQVMKASKGKANPSLVNELLLEK 476

Query: 496 L 496
           L
Sbjct: 477 L 477


>gi|308273720|emb|CBX30322.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [uncultured Desulfobacterium sp.]
          Length = 477

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 243/479 (50%), Positives = 327/479 (68%), Gaps = 9/479 (1%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           ++E VIG+EVHAQL   +K+F     +FGA PNT        MPG+LP+LN + V+ A++
Sbjct: 2   EFEPVIGLEVHAQLKTNTKIFCSCPASFGAPPNTHTCPVCLGMPGVLPVLNKKVVEYAIL 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            G+     I+K+S FARKNYFYPDLP+GYQISQ++ PI   G + V +   K        
Sbjct: 62  MGIATKCTISKFSRFARKNYFYPDLPKGYQISQYELPICENGYIDVDVNGLKK------R 115

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           +GI RIH+E+DAGK IHD     S +D NR+GV L+EIV++PD+RSS EA A+L K+RSI
Sbjct: 116 IGITRIHMEEDAGKLIHDPSRPFSMVDFNRTGVPLIEIVSEPDIRSSEEAVAYLRKIRSI 175

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           LRYL  CDGNMEEGS R D N+S+   G E +GTR E+KN+NS + +  AI YE  RQ  
Sbjct: 176 LRYLDICDGNMEEGSFRCDANISIRSKGSEPFGTRTELKNLNSFKNVEKAILYEIERQKD 235

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           I+ DG  + QETRL+DP KN T S+R KEDA DYRYF +PDLLPL ID+ +I  +KK++P
Sbjct: 236 IVFDGEEVIQETRLWDPEKNNTVSMRGKEDAHDYRYFPDPDLLPLSIDDSWIAKLKKELP 295

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVLN 378
           ELPD K+ERF+ E+G+  YDA VL     +A YFE  A   ++ K V+NW++  LLG+LN
Sbjct: 296 ELPDEKKERFVSEYGLPEYDADVLTGAVELAGYFEACAKEFQNPKQVSNWIMGSLLGLLN 355

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
             GK+IE +PI+P+ L EL+ LI    ISGKIAK +F  + + G  P+EI++E  L QVT
Sbjct: 356 AEGKTIEQSPITPSNLAELLKLIDQNIISGKIAKTVFEEMAKSGKPPQEIIKEKDLVQVT 415

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           D + +E +  ++I+S P  VA   A K  ++ +FVG++MK T GKANP IV ++LK+KL
Sbjct: 416 DEALLEDIAVKLISSCPKEVAEYKAGKTKVIGFFVGKIMKETKGKANPEIVNRILKDKL 474


>gi|114331582|ref|YP_747804.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrosomonas
           eutropha C91]
 gi|122313632|sp|Q0AFP3|GATB_NITEC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|114308596|gb|ABI59839.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Nitrosomonas eutropha C91]
          Length = 478

 Score =  478 bits (1229), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 244/481 (50%), Positives = 335/481 (69%), Gaps = 13/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+H QL   SK+FSGASV +GA PN+Q    D A+PG+LP+LN + V+ A+  
Sbjct: 3   WETVIGLEIHVQLLTRSKIFSGASVAYGARPNSQACAVDIALPGVLPVLNRQVVEYAIRF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL +NA IN  S+FARKNYFYPDLP+GYQISQ   PIV  G V++  G DK    +TI  
Sbjct: 63  GLAINATINSPSIFARKNYFYPDLPKGYQISQLAHPIVEGGHVTIRTG-DKE---KTIH- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS H+ +   + IDLNR+G  L+EIV++P+MRSS EA A+   L S++
Sbjct: 118 -LTRAHLEEDAGKSTHEGFHDKTGIDLNRAGTGLLEIVSEPEMRSSAEAVAYARVLHSLV 176

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPG--EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           R++G CDGNM+EGS R D NVSV RP   +  GTRCE+KN+NS RFL  AI+YE  RQI 
Sbjct: 177 RWIGICDGNMQEGSFRCDANVSV-RPAGSDVLGTRCEIKNLNSFRFLERAIDYEVARQID 235

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ILE GG I Q+TRL+D  ++ETR++R+KEDA DYRYF +PDLLP+ I +++I+ I++++P
Sbjct: 236 ILESGGSIVQQTRLYDADRDETRTMRSKEDAHDYRYFPDPDLLPVVIPQEWIKQIREKLP 295

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA--VNRDKKIVANWVINDLLGVL 377
           ELP+ +  R+I +F +S YDA++L + + +ADYFE+    +    K+ ANW+I ++ G L
Sbjct: 296 ELPEDRHNRYIRDFSLSAYDANILTAARELADYFEQTVKFLPEQIKLCANWIIGEVSGRL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG-GTPKEIVEELGLRQ 436
           N+ G  I+  P+SP QL  L+  I DGT+SGKIAKD+F+ +W+    +   I++   LRQ
Sbjct: 356 NKEGLEIDQCPVSPEQLAGLLLRITDGTVSGKIAKDVFDSMWQSNDNSADTIIDAKNLRQ 415

Query: 437 VTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           ++D S IEK V+EV+ +N   VA   A K    +  VGQVMK + GKANP  V  +LK+ 
Sbjct: 416 ISDNSEIEKWVNEVLAANQQQVADYRAGKEKAFNSLVGQVMKMSRGKANPVQVNTLLKKH 475

Query: 496 L 496
           L
Sbjct: 476 L 476


>gi|189183273|ref|YP_001937058.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Orientia
           tsutsugamushi str. Ikeda]
 gi|229486427|sp|B3CQQ8|GATB_ORITI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|189180044|dbj|BAG39824.1| glutamyl-tRNA amidotransferase subunit B [Orientia tsutsugamushi
           str. Ikeda]
          Length = 486

 Score =  478 bits (1229), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/485 (47%), Positives = 329/485 (67%), Gaps = 6/485 (1%)

Query: 13  SLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNG 72
           +   G T  WE VIG+E+HAQ+   +KLFS AS  FG+ PN+QV   DAAMPG LP+LN 
Sbjct: 2   TFIEGKTEKWEYVIGLEIHAQIKSNAKLFSSASTEFGSSPNSQVELLDAAMPGSLPVLNE 61

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
            CV QA+ T LG+NA INK S+F RKNYFY DLP GYQISQ   PI   G + +    D+
Sbjct: 62  FCVHQAIKTALGINAKINKLSIFDRKNYFYADLPAGYQISQFYHPIAQGGWIEIL---DE 118

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKA 192
           +G  + I+  I R+H+EQD GKS HDQ    S IDLNRSG+ALMEIV++PD+ S ++A  
Sbjct: 119 NGNIKRIQ--INRLHIEQDTGKSTHDQSDTYSYIDLNRSGIALMEIVSEPDISSPMQAAE 176

Query: 193 FLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEY 252
           ++ KLR+ILRYL +C+G+ME+GS+R D N+SV +P    GT+CE+KN+NSI+ +  A+E+
Sbjct: 177 YIKKLRAILRYLDSCNGDMEKGSLRCDANISVRKPNSELGTKCEIKNLNSIKSIVRALEF 236

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           E +RQ+ ILE GG ++QE+ LFD +  +T  +R+KE+A DYRYF +PDL P+ +D+  I 
Sbjct: 237 EGQRQVNILESGGTVKQESLLFDATLGKTFPMRSKENATDYRYFPDPDLPPIILDQSLID 296

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIND 372
            I   +PELPDAK  R+I E  +S Y+A VL +DK I+ +FE++    +  + ANW++++
Sbjct: 297 NIASSLPELPDAKIRRYINEIKLSDYNAQVLAADKDISCFFEEVIKTANPLLSANWILSE 356

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEEL 432
           L G++N+ G +I +  I+ N   ELI LI    IS KIAK +   +++ G +PK I++E 
Sbjct: 357 LFGLMNKDGITINECKITANHFSELIQLISSKAISSKIAKTVLKEMFDSGKSPKIIMQEK 416

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKM 491
            ++Q++D + I  ++D+V+  N  +V      K  L  +FVGQVMK T G ANP+++ ++
Sbjct: 417 NIQQISDPNQIADIIDDVLKDNYQSVVSYRNGKDRLFGFFVGQVMKKTAGNANPALINEI 476

Query: 492 LKEKL 496
           L  KL
Sbjct: 477 LHTKL 481


>gi|148266333|ref|YP_001233039.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Geobacter
           uraniireducens Rf4]
 gi|189045142|sp|A5G9J8|GATB_GEOUR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|146399833|gb|ABQ28466.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Geobacter uraniireducens Rf4]
          Length = 479

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 245/481 (50%), Positives = 324/481 (67%), Gaps = 12/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           ++VVIG+EVH QL   SK+F G S  FGAEPN+Q       MPG LP+LN + V+ A+  
Sbjct: 3   YQVVIGLEVHVQLLTNSKIFCGCSTRFGAEPNSQTCPVCLGMPGALPVLNKKVVEYAIRA 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL  N  I   SVFARKNYFYPDLP+GYQISQ + PI  +G + + +   + G  R   +
Sbjct: 63  GLATNCRIAPRSVFARKNYFYPDLPKGYQISQFELPICIDGHLDIEV---EGGMKR---I 116

Query: 142 GIERIHLEQDAGKSIHDQYSAV---SCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
           GI RIH+E+DAGK +H     V   SC+DLNR+   L+EIV++PDMRS+ EA A+L KL 
Sbjct: 117 GITRIHMEEDAGKLVHADVPGVGDDSCVDLNRACTPLLEIVSEPDMRSADEAVAYLKKLH 176

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
            I+ YLG  DGNMEEGS R D NVSV   G + +GTR E KNVNS +F+  AIEYE  RQ
Sbjct: 177 QIVVYLGISDGNMEEGSFRCDANVSVMPAGSDKFGTRTETKNVNSFKFVKQAIEYEIERQ 236

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++E+GG I QETRLFDP+   TRS+R KE+A DYRYF +PDL+PL I  D++   +  
Sbjct: 237 IEVIEEGGKIVQETRLFDPNTGSTRSMRGKEEAHDYRYFPDPDLVPLVIGNDWVEDARLS 296

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGV 376
           +PELPDAKR+R+  E G+ +YDA VL + + +A YFE  LA++   K VANWV+ ++   
Sbjct: 297 LPELPDAKRQRYTDELGLPVYDAEVLTATRELAGYFEACLALSPQPKPVANWVMGEVTRA 356

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN   +SI D P++P  L +L+ LI  GTISGKIAK +F+ +W  G  P++IVEE GL Q
Sbjct: 357 LNEENRSIADCPVTPPLLADLLRLIEKGTISGKIAKTVFDEMWRSGKAPEKIVEEKGLVQ 416

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D  AIE ++DEV+      V    + K  L  +FVGQVM+ + GKANP++V ++L +K
Sbjct: 417 VSDTGAIEAIIDEVLAKEAGQVEEYRSGKDKLFGFFVGQVMRASKGKANPALVNEILLKK 476

Query: 496 L 496
           L
Sbjct: 477 L 477


>gi|237746691|ref|ZP_04577171.1| glutamyl-tRNA synthetase [Oxalobacter formigenes HOxBLS]
 gi|229378042|gb|EEO28133.1| glutamyl-tRNA synthetase [Oxalobacter formigenes HOxBLS]
          Length = 487

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 247/486 (50%), Positives = 331/486 (68%), Gaps = 12/486 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS +FGAEPNTQ    D A+PG+LP++N   V++A+  
Sbjct: 3   WEVVIGLETHAQLSTVSKIFSGASTSFGAEPNTQACPVDLALPGVLPVMNRGAVEKAIQF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE- 140
           GL   A +   SVFARKNYFYPDLP+GYQISQ +KP+V  GK+   +  ++ G+   I+ 
Sbjct: 63  GLATGAQVAPVSVFARKNYFYPDLPKGYQISQFEKPVVLGGKIDCIV--EQKGRESYIKT 120

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           V + R HLE+DAGKS+H++++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L S+
Sbjct: 121 VNLTRAHLEEDAGKSLHEEFADMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKALHSL 180

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           + +LG  DGNM+EGS R D NVSV   G    GTRCEVKN+NS R L  AI YE  RQI 
Sbjct: 181 VTWLGISDGNMQEGSFRCDANVSVRPAGSTVLGTRCEVKNLNSFRNLEDAINYEVERQIE 240

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++E GG + Q TRL+DP K ETR +RTKED+ DYRYF +PDL PL I  ++I  ++  +P
Sbjct: 241 LIESGGQVVQATRLYDPDKRETREMRTKEDSDDYRYFPDPDLPPLVISSEWIERVRSGMP 300

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIV---ANWVINDLLGV 376
           ELPDA R RFI ++G+  YDA+VL   K++A Y+EKL     K +    ANW++ D+   
Sbjct: 301 ELPDAMRRRFISDYGLPEYDATVLTQSKAMAAYYEKLVSLTGKPLAKQNANWLMGDVSSA 360

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE----KGGTPKEIVEEL 432
           LNR G S+ D P+ P QL  L+  I D TIS KIAK+IF +LWE    +      I++  
Sbjct: 361 LNREGISMADVPVMPEQLALLMKRIADNTISNKIAKEIFGVLWETHPAEADAVDNIIDAR 420

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q++D  AIEK++DEV+ +N  +V    A +    +  VGQVMK T GKANP  V ++
Sbjct: 421 GLKQISDTGAIEKIIDEVLANNARSVEEFRAGRDKAFNSLVGQVMKATRGKANPVQVNEL 480

Query: 492 LKEKLG 497
           L++KL 
Sbjct: 481 LRKKLA 486


>gi|254251094|ref|ZP_04944412.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit [Burkholderia
           dolosa AUO158]
 gi|124893703|gb|EAY67583.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit [Burkholderia
           dolosa AUO158]
          Length = 491

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 245/487 (50%), Positives = 336/487 (68%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGA+PNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACAVDLALPGVLPVLNRGAVERAIRF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE- 140
           GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +  ++       E 
Sbjct: 65  GLAIGATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGAITIQVPANEKAGKPAYEK 124

Query: 141 -VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 125 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHA 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV   G+  +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRAEIKNLNSFRFLEEAINYEVRRQI 244

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D++  ++  +
Sbjct: 245 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGRDWVERVQAGM 304

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+  
Sbjct: 305 PELPAAMQQRFVEQYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAANAKIAANWLMGDVSS 364

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG----GTPKEIVEE 431
            LNR G  I+  P+S  QL  L+  I DGTIS KIAK+IF  +WE+     G    I++ 
Sbjct: 365 QLNRDGIDIDAIPVSAAQLALLLQRIADGTISNKIAKEIFATMWEEKAADEGAADRIIDA 424

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP  V +
Sbjct: 425 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVNE 484

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 485 LLKKKLG 491


>gi|17544773|ref|NP_518175.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ralstonia
           solanacearum GMI1000]
 gi|24418413|sp|Q8Y3C6|GATB_RALSO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|17427062|emb|CAD13582.1| probable aspartyl/glutamyl-trna(asn/gln) amidotransferase subunit b
           (asp/glu-adt subunit b) protein [Ralstonia solanacearum
           GMI1000]
          Length = 488

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 246/484 (50%), Positives = 329/484 (67%), Gaps = 8/484 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS  SK+FSGAS  FGA PNTQ +  D A+PG+LP+LN   V++A+  
Sbjct: 3   WEVVIGLETHAQLSTASKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAITF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +            V
Sbjct: 63  GLAIGAKIASKSIFARKNYFYPDLPKGYQISQYEIPVVQGGTLTIQVEGRNGQPGYEKTV 122

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L +++
Sbjct: 123 NLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYARALHALV 182

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            +LG CDGNM+EGS R D NVSV R P   +GTRCE+KN+NS RFL  AI YE RRQI +
Sbjct: 183 MWLGICDGNMQEGSFRCDANVSVRRGPDAPFGTRCEIKNLNSFRFLEEAINYEVRRQIEL 242

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPL I  D++ A++  +PE
Sbjct: 243 IEDGGTVVQETRLYDPDRKETRSMRSKEDAHDYRYFPDPDLLPLMIGADWVDAVRATLPE 302

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLGVL 377
           LP A   RF   +G+  YDAS+L + K+ A YFE     A   + K  ANW++ ++   L
Sbjct: 303 LPAAMAARFESAYGLPRYDASILTATKATAAYFEAVVAAAGAANAKAAANWIMGEVASNL 362

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEELGL 434
           NR+G  I+  P+SP QL  L+  I DGTIS   A KD+F  +W  E GG    I+ E GL
Sbjct: 363 NRAGLEIDAAPVSPVQLAGLLARIADGTISNNTAKKDVFPAMWAGEHGGDADAIIAEKGL 422

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           +Q++D   +EK++DEV+ +N  +V    A K    +  VGQ MK T GKANPS V ++LK
Sbjct: 423 KQMSDSGELEKIIDEVLAANAKSVEEFRAGKDKAFNALVGQAMKATRGKANPSQVNELLK 482

Query: 494 EKLG 497
           +KLG
Sbjct: 483 KKLG 486


>gi|254283200|ref|ZP_04958168.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [gamma
           proteobacterium NOR51-B]
 gi|219679403|gb|EED35752.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [gamma
           proteobacterium NOR51-B]
          Length = 475

 Score =  476 bits (1226), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 243/479 (50%), Positives = 328/479 (68%), Gaps = 14/479 (2%)

Query: 26  IGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGL 85
           +G+EVH QL+  SK+FSG+   FGAEPN Q    D  MPGMLP+LN R V+ AV  GLG+
Sbjct: 1   MGLEVHLQLATDSKIFSGSPSRFGAEPNVQADAVDLGMPGMLPVLNTRAVEFAVRFGLGV 60

Query: 86  NAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIER 145
            A I + SVF RKNYFYPDLP+GYQISQ  +PIVGEG   V + PD S       + I R
Sbjct: 61  GAKIGRRSVFDRKNYFYPDLPKGYQISQFFEPIVGEGLFEVPM-PDGS----LFPIRILR 115

Query: 146 IHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLG 205
            HLE+DAGKS+HD +   + IDLNR+G  L+EIVT+PD R++ +A A+L  L S++ YLG
Sbjct: 116 AHLEEDAGKSVHDAFPDQTGIDLNRAGTPLLEIVTEPDFRTAEQAVAYLKALHSLVTYLG 175

Query: 206 TCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILED 263
             DGNM EGSMR DVN+S+ RP   +  GTR E+KNVNS RF+  AIE E  RQ  +L++
Sbjct: 176 ISDGNMSEGSMRCDVNISL-RPVGSDTLGTRTEIKNVNSFRFVEKAIEVETERQADLLDN 234

Query: 264 GGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPD 323
           G  + QETRL+D  +NETRS+R+KE A DYRYF EPDLLP+ +DE  I +I + +PELP 
Sbjct: 235 GETVTQETRLYDADRNETRSMRSKEVANDYRYFPEPDLLPVVLDEATIESIAQSLPELPG 294

Query: 324 AKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDLLGVLNRSGK 382
            KR RFI ++ +S YDA++LVS +++ADYFE    + D+ K+VANW++ DL   +NR   
Sbjct: 295 PKRARFIEQYTLSDYDAALLVSSRAMADYFESAVADCDEPKLVANWILGDLSAAMNREDL 354

Query: 383 SIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSA 442
            I+ TP+S + L  LI  I D T+S K+AK +F  LW   G+  +I+E  GL+QV+D   
Sbjct: 355 DIDQTPVSASALAGLITRIADNTLSSKLAKQVFEGLWLGEGSADDIIEARGLKQVSDTGE 414

Query: 443 IEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +E ++D+VI +NP+ VA+      A +  L  +FVGQ+MK + G+ANP +V ++L +KL
Sbjct: 415 LEAMIDDVITNNPDQVAQYQAADEAKQKKLSGFFVGQIMKASKGQANPQLVSQLLMKKL 473


>gi|225849362|ref|YP_002729526.1| aspartyl/glutamyl-tRNA amidotransferase subunit B
           [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643915|gb|ACN98965.1| glu-trnagln amidotransferase suBunit b [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 482

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 234/481 (48%), Positives = 331/481 (68%), Gaps = 12/481 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +++VVIG+E H Q+S  +K+F G  V FGA PNT V     A PG LP++N   V+ AV 
Sbjct: 10  EFDVVIGLETHVQMSTKTKMFCGCEVEFGAPPNTNVCPVCLAHPGTLPVINKTAVEYAVK 69

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
             L LN  ++  S+ ARKNYFYPDLP+GYQISQ+DKP+  +G + + +G      F+ I 
Sbjct: 70  AALALNCKVHNLSIMARKNYFYPDLPKGYQISQYDKPLATDGYIEIKVG----DSFKKIR 125

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
             I R+H+E+DAGK+IH+   + S +DLNR+G  LMEIVT+PD+ S+ EA+ +L KLR+I
Sbjct: 126 --IHRLHIEEDAGKTIHE--GSKSYVDLNRAGTPLMEIVTEPDISSAEEARKYLEKLRNI 181

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +RY+G  + +ME+G +R DVN+S+   G +  GT+ E+KN+NS RF+  AIEYE  RQ  
Sbjct: 182 MRYIGVSEADMEKGQLRCDVNISLKPKGSSQLGTKVELKNINSFRFIVKAIEYEIERQAK 241

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           +L+ G  I QETRLFDP   +T ++RTKE+A DYRYF +PDLLP+ + +  I  IK  +P
Sbjct: 242 LLKKGEKIIQETRLFDPDSGKTYTMRTKEEAHDYRYFPDPDLLPILLKDSQIEEIKNSLP 301

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA--VNRDKKIVANWVINDLLGVL 377
           ELPD K  R+I  F +  YDA VL SDK++A+YFE++     ++ K+V+NW++N+LLG L
Sbjct: 302 ELPDQKYYRYIQSFNLPPYDAEVLTSDKNLANYFEEVVKLFPQNPKLVSNWILNELLGKL 361

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N  G  IE++PIS N L EL+ LI DGTISGKIAK++F+I +E G +PK IVEE GL+Q+
Sbjct: 362 NEKGIDIENSPISANSLAELVSLIADGTISGKIAKEVFDIAFETGKSPKTIVEEKGLKQI 421

Query: 438 TDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           ++   I  +V  V+  +P  V +  +    ++ + VGQ+MK T GKANP +V K+LKE+L
Sbjct: 422 SNEDEIRSIVKAVLERHPAEVEKYKSGNEKILGFLVGQIMKETKGKANPQLVNKILKEEL 481

Query: 497 G 497
            
Sbjct: 482 S 482


>gi|291612605|ref|YP_003522762.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sideroxydans
           lithotrophicus ES-1]
 gi|291582717|gb|ADE10375.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sideroxydans
           lithotrophicus ES-1]
          Length = 504

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 246/501 (49%), Positives = 333/501 (66%), Gaps = 27/501 (5%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE+VIG+EVH QLS  +K+FSGAS  FGAEPNTQ      A+PG+LP+LN   V++A+  
Sbjct: 3   WEIVIGLEVHTQLSTNTKIFSGASTAFGAEPNTQADAVSIALPGVLPVLNKGAVERAIKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE- 140
           GL   AHI + SVFARKNYFYPDLP+GYQISQ D P+VG+G +++ + P  SG  +    
Sbjct: 63  GLATGAHIAQRSVFARKNYFYPDLPKGYQISQFDLPVVGQGALTIQVEP-LSGNAKPYAK 121

Query: 141 -VGIERIHLEQDAGKSIH---------DQYSA------------VSCIDLNRSGVALMEI 178
            V I R HLE+DAGKS+H         D   A            V+ IDLNR+G  L+EI
Sbjct: 122 TVRITRAHLEEDAGKSVHGFEMNSESDDTLIAEDGSRIFFPRDNVTGIDLNRAGTPLLEI 181

Query: 179 VTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVK 238
           V++PDM S+ EA A+   L S++R++G CDGNM+EGS R DVNVSV +PG+  GTR E+K
Sbjct: 182 VSEPDMCSAAEAVAYAKALHSLVRWIGICDGNMQEGSFRCDVNVSVRKPGQPLGTRREIK 241

Query: 239 NVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSE 298
           N+NS +F+  AI+YE + QI  +E+GG ++Q T LF+P   ETR++R+KEDA DYRYF +
Sbjct: 242 NLNSFKFMQQAIDYEVQWQIDTIENGGKVQQATVLFNPDTGETRAMRSKEDAHDYRYFPD 301

Query: 299 PDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA- 357
           PDLLPLEI  D+I  ++  +PELP AK+ R++ + G+S YDASVL S + +AD+FE    
Sbjct: 302 PDLLPLEISSDWIEQVRGTLPELPQAKQIRYVNDLGLSAYDASVLTSSREMADFFEAALG 361

Query: 358 -VNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFN 416
                 KI ANW+I ++   LNR G  +   PI+  QLG ++  I DGTIS   AK++F 
Sbjct: 362 DATGQAKICANWIIGEVSAQLNRDGLDMAQCPITAQQLGGMLQRIADGTISNSGAKEVFR 421

Query: 417 ILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQV 475
            +W +GG    I+E  GL+QV+D  AIE +VDE+I +N + VA   + K  L  +FVG  
Sbjct: 422 TMWAEGGEADAIIEAKGLKQVSDSGAIEALVDEIIAANADKVAEYRSGKDKLFGFFVGLA 481

Query: 476 MKNTGGKANPSIVQKMLKEKL 496
           MK + GKANP+ +  +LK+KL
Sbjct: 482 MKASKGKANPAQLNDILKKKL 502


>gi|148284747|ref|YP_001248837.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Orientia
           tsutsugamushi str. Boryong]
 gi|166198799|sp|A5CEC9|GATB_ORITB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|146740186|emb|CAM80434.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Orientia
           tsutsugamushi str. Boryong]
          Length = 486

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 227/485 (46%), Positives = 328/485 (67%), Gaps = 6/485 (1%)

Query: 13  SLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNG 72
           +   G T  WE VIG+E+HAQ+   +KLFS AS  FG+ PN+QV   DAAMPG LP+LN 
Sbjct: 2   TFIEGKTEKWEYVIGLEIHAQIKSNAKLFSSASTEFGSSPNSQVELLDAAMPGSLPVLNE 61

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
            CV QA+ T LG+NA INK S+F RKNYFY DLP GYQISQ   PI   G + +    D+
Sbjct: 62  FCVHQAIKTALGINAKINKLSIFDRKNYFYADLPAGYQISQFYHPIAQGGWIEIL---DE 118

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKA 192
           +G  + I+  I R+H+EQD GKS HDQ    S IDLNRSG+ALMEIV++PD+ S ++A  
Sbjct: 119 NGNIKCIQ--INRLHIEQDTGKSTHDQSDTYSYIDLNRSGIALMEIVSEPDISSPMQAAE 176

Query: 193 FLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEY 252
           ++ KLR+ILRYL +C+G+ME+G++R D N+SV +P    GT+CE+KN+NSI+ +  A+E+
Sbjct: 177 YIKKLRAILRYLDSCNGDMEKGALRCDANISVRKPNSELGTKCEIKNLNSIKSIVRALEF 236

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           E +RQ+ ILE GG ++QE+ LFD +  +T  +R+KE+A DYRYF +PDL P+ +D+  I 
Sbjct: 237 EGQRQVNILESGGTVKQESLLFDATLGKTFPMRSKENATDYRYFPDPDLPPIILDQSLID 296

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIND 372
            I   +PELPDAK  R++ E  +S Y+A VL +DK I+ +FE++    +  + ANW++++
Sbjct: 297 NIASSLPELPDAKITRYVNEIKLSDYNAQVLAADKDISCFFEEVIKTANPILTANWILSE 356

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEEL 432
           L G++N+ G +I +  I+ N   ELI LI    IS KIAK +   +++ G +PK I++E 
Sbjct: 357 LFGLMNKDGITINECKITANHFSELIQLISSKAISSKIAKTVLKEMFDSGKSPKIIMQEK 416

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKM 491
            ++Q++D + I  ++D+V+  N  +V      K  L  +FVGQVMK T G ANP ++ ++
Sbjct: 417 NIQQISDPNQIADIIDDVLKDNYQSVVSYRNGKDRLFGFFVGQVMKKTAGNANPELINEI 476

Query: 492 LKEKL 496
           L  KL
Sbjct: 477 LHTKL 481


>gi|83648000|ref|YP_436435.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Hahella
           chejuensis KCTC 2396]
 gi|109892027|sp|Q2SBG4|GATB_HAHCH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|83636043|gb|ABC32010.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Hahella chejuensis
           KCTC 2396]
          Length = 480

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 244/483 (50%), Positives = 332/483 (68%), Gaps = 12/483 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE VIG+EVH QL+  SK+FSGA+  FGAEPNTQ    D AMPGMLP++N   V+ AVM
Sbjct: 2   EWEAVIGLEVHVQLATKSKIFSGAATTFGAEPNTQACAVDLAMPGMLPVMNEEAVRMAVM 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL + A IN  SVF RKNYFYPDLP+GYQISQ D P V +GK+ + +   ++G+ +TI 
Sbjct: 62  FGLAIGAEINTRSVFDRKNYFYPDLPKGYQISQLDHPTVKQGKLDIQL---ENGEKKTIT 118

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           V   R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++P++RS+ EA A+L KL SI
Sbjct: 119 V--TRAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSEPELRSAKEAVAYLRKLHSI 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           + YLG  DG+M +GSMR D NVSV   G+  +G R E+KNVNS RF+  AI+ E  RQI 
Sbjct: 177 VTYLGISDGDMSQGSMRCDCNVSVRPKGQKEFGVRTEIKNVNSFRFVEKAIQGEIERQID 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++E+GG + QETRL+D  K+ TRS+R+KE A DYRYF +PDLLP+EID+ +I A++  +P
Sbjct: 237 LIEEGGKVTQETRLYDADKDNTRSMRSKEFANDYRYFPDPDLLPIEIDDAYIEAVRSTLP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLN 378
           ELP+ K  RF  E+G+S YDA VL S ++ ADYFE    +  D K+ ANW++ +L   LN
Sbjct: 297 ELPEQKLARFCSEYGLSDYDAGVLASSRAQADYFEAATKIVGDAKLTANWIMGELAKRLN 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++   I  +P++   LG+L+  + D TI+GK AKD+   +W   G   EI+E+ GL  VT
Sbjct: 357 QNSLDISQSPVTAEGLGKLLLRLKDNTINGKAAKDVLEAMWNGEGEADEIIEKKGLIAVT 416

Query: 439 DLSAIEKVVDEVINSNPNNV-----ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           D SAIE  VDEV+ +N   V     A  A +  ++ +FVGQ MK + GKANP  V ++L 
Sbjct: 417 DDSAIEAFVDEVLANNAAQVEQYKAADEAKRGKMIGFFVGQTMKISKGKANPQQVNEILA 476

Query: 494 EKL 496
           +KL
Sbjct: 477 KKL 479


>gi|187479649|ref|YP_787674.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bordetella avium
           197N]
 gi|109892007|sp|Q2KU71|GATB_BORA1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|115424236|emb|CAJ50789.1| glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Bordetella avium
           197N]
          Length = 485

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 241/488 (49%), Positives = 327/488 (67%), Gaps = 18/488 (3%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE+VIG+E H QL+  SK+FSG+S  FGA PNTQ +  D A+PG LP++N    ++A++
Sbjct: 2   EWEIVIGLETHVQLATESKIFSGSSTRFGAAPNTQANEVDLALPGSLPVMNRGAAERAIL 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL + A I   SVFARKNYFYPDLP+GYQISQ++ P+V  G +S  +G ++        
Sbjct: 62  FGLAIGAKIAPRSVFARKNYFYPDLPKGYQISQYELPVVVGGTLSFFVGEEEK------T 115

Query: 141 VGIERIHLEQDAGKSIHDQY-----SAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
           + + R HLE+DAGKS+HD++     +  S IDLNR+G  L+EIVT+P+MRS+ EA A+  
Sbjct: 116 INLTRAHLEEDAGKSLHDEFHLANGAPASGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAR 175

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEA 254
            L  ++ +LG CDGNM+EGS R D NVSV   G+  +GTR E+KNVNS RFL  AI+YE 
Sbjct: 176 ALHGLVVWLGICDGNMQEGSFRCDANVSVRPRGQVEFGTRAEIKNVNSFRFLERAIQYEV 235

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           RRQI ++EDGG + QETRL+D  ++ETRS+R+KEDA DYRYF +PDL  L I +D++ A+
Sbjct: 236 RRQIELIEDGGKVVQETRLYDAERDETRSMRSKEDAHDYRYFPDPDLPTLVIGQDWVEAV 295

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA---VNRDKKIVANWVIN 371
           +  +PELP A R RF  +FG+  YDA+ L   + +A YFE +A        K+ ANW++ 
Sbjct: 296 RATMPELPSAMRARFEADFGLPAYDAAQLTISRKLAAYFEAVARALPAGQAKLAANWIMG 355

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW--EKGGTPKEIV 429
           ++   LNR  K I DTP+   QL  LI+ IIDGTIS KIA+D+F  +W  E GG P  I+
Sbjct: 356 EVTATLNREEKDIADTPVQAAQLAALINRIIDGTISNKIARDVFAAMWAGENGGEPDAII 415

Query: 430 EELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIV 488
           E  GL+Q++D   I  ++DEV+ +NP  VA   A K    +  VGQ+MK   GKANP  V
Sbjct: 416 EARGLKQISDTGTISAMIDEVLAANPAIVAEYRAGKEKAFNSLVGQIMKAARGKANPQQV 475

Query: 489 QKMLKEKL 496
             +LK KL
Sbjct: 476 NDLLKAKL 483


>gi|317050662|ref|YP_004111778.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Desulfurispirillum
           indicum S5]
 gi|316945746|gb|ADU65222.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfurispirillum
           indicum S5]
          Length = 479

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 242/483 (50%), Positives = 336/483 (69%), Gaps = 13/483 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+E+HAQ+   SK+F G S   G +PN+       AMPG LP+LN + V   + T
Sbjct: 3   YETVIGLEIHAQVLSESKIFCGCSTKVGQQPNSHTCPVCLAMPGSLPVLNRKVVDYTIKT 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL +N+ INK+S FARKNYFYPDLP+GYQISQ+++PIVGEG + + +     GQ  T  +
Sbjct: 63  GLAINSTINKFSQFARKNYFYPDLPKGYQISQYEEPIVGEGYIMIDL---PEGQ--TKRI 117

Query: 142 GIERIHLEQDAGKSIHDQ---YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
           GIERIH+E+DAGKSIH         S IDLNR+G  LMEIV++PDMR   EAKA+L K++
Sbjct: 118 GIERIHMEEDAGKSIHGSSIGKPGSSYIDLNRAGTPLMEIVSRPDMRGPEEAKAYLEKIK 177

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           SIL YL  CD NMEEGS+R DVN+S+ RP   E  GT+ E+KN+NS R +G AIEYE +R
Sbjct: 178 SILEYLEVCDCNMEEGSLRCDVNISL-RPVGQEKLGTKAEIKNMNSFRNVGRAIEYEMKR 236

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q  IL++GG + QETRL+DP KN T S+R+KE+A DYRYF EPDL+P+ + +++I A++ 
Sbjct: 237 QAQILDEGGSVVQETRLYDPEKNITVSMRSKEEAHDYRYFPEPDLVPVNLTDEWIDALRG 296

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANWVINDLLG 375
            +PELPDAK+ERF+ ++GI +YDA VL SDK +ADY+E  +  + + KI++NWV+ D+L 
Sbjct: 297 TLPELPDAKKERFVQQYGIPVYDAGVLTSDKYVADYYEAAVKTHNNGKIISNWVMGDVLR 356

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
           VL    + I +  I    +G+++ +I D  ISGKIAK +F  + E+   P+ IV+E GL 
Sbjct: 357 VLKERKQDIREFDIPAQYIGKMVKMIDDKLISGKIAKTVFEHMCEEPKDPEIIVKEKGLV 416

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           QV D  AI +++ +V++ NP  V +    +  ++ + VGQ MK + GKANP +V K+L+E
Sbjct: 417 QVVDEGAIRELLQKVLDENPGPVEQYRNGEQKVMGFLVGQSMKASKGKANPELVNKLLRE 476

Query: 495 KLG 497
            LG
Sbjct: 477 LLG 479


>gi|134297282|ref|YP_001121017.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           vietnamiensis G4]
 gi|166217744|sp|A4JIS9|GATB_BURVG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|134140439|gb|ABO56182.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Burkholderia vietnamiensis G4]
          Length = 490

 Score =  474 bits (1221), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 245/488 (50%), Positives = 338/488 (69%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGA   FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGAPTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE- 140
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++       E 
Sbjct: 64  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKPAYEK 123

Query: 141 -VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHA 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 184 LVVWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQ 242

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I +D+I  ++  
Sbjct: 243 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGQDWIERVQAG 302

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLL 374
           +PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+ 
Sbjct: 303 MPELPAAIQQRFVDQYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAANAKIAANWLMGDVS 362

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG----GTPKEIVE 430
             LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G    I++
Sbjct: 363 SQLNRDGIEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFATIWDEKATDEGAADRIID 422

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++DEV+ +N  +V    A K    +  +GQ MK T GKANP  V 
Sbjct: 423 AKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVN 482

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 483 ELLKKKLG 490


>gi|254787705|ref|YP_003075134.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Teredinibacter
           turnerae T7901]
 gi|259647241|sp|C5BSY9|GATB_TERTT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|237686633|gb|ACR13897.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Teredinibacter turnerae T7901]
          Length = 481

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 241/483 (49%), Positives = 319/483 (66%), Gaps = 12/483 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE +IG+EVH QL+  +K+FSG+S  FGAEPNTQ    D AMPG LP  N    + A M
Sbjct: 2   EWETIIGLEVHVQLATNTKIFSGSSTAFGAEPNTQACAIDLAMPGTLPTPNAEAFRFATM 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL +NA I K SVF RKNYFYPDLP+GYQ +Q  +PIVG G V + +      + R   
Sbjct: 62  FGLAVNAEIGKRSVFERKNYFYPDLPKGYQTTQLAEPIVGPGYVDIQLADGSEKRVR--- 118

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
             I   HLE+DAGKS+H+ +  +S IDLNR+G  L+E+VT+PDMRS+ EA AF  KL SI
Sbjct: 119 --IHHAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLIEVVTEPDMRSAEEAVAFARKLHSI 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +  LG CDG M +GSMR DVN+SV   G E  GTR E KN+NS RF+   IE E  RQI 
Sbjct: 177 VTSLGICDGEMSQGSMRFDVNISVRLKGDEKLGTRTETKNLNSFRFMERCIEQEVERQIE 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++EDGG I QETRL+D   ++ RS+R+KE+A DYRYF  PDLLP+ +D+DFI A +  +P
Sbjct: 237 VIEDGGKIIQETRLYDGETHKARSMRSKEEANDYRYFPCPDLLPVMLDDDFIDAARAAMP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVLN 378
           ELPDA++ RF   +G+S YDA ++ +D + AD+FE +A    D K+ ANWV+ ++   LN
Sbjct: 297 ELPDARQLRFEESYGLSPYDAGIISADAATADFFEAVAAKCSDAKLAANWVMGEISARLN 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
                I    +S  QL  LI  I D TIS KIAK +F+ +W   G    I+E  GL+QV+
Sbjct: 357 AEEIRITAAKVSAEQLAGLIARIKDQTISNKIAKQVFDAMWNGEGDADTIIEAKGLKQVS 416

Query: 439 DLSAIEKVVDEVINSNPNNV-----ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           D  A+EK+VD+V+N+NP  V     A  A +P ++ +FVGQVMK + G+ANP  +  +LK
Sbjct: 417 DSGALEKMVDDVMNANPAQVENYRKADPAKQPKMLGFFVGQVMKASKGQANPQQLNDILK 476

Query: 494 EKL 496
           +KL
Sbjct: 477 KKL 479


>gi|114778058|ref|ZP_01452958.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mariprofundus
           ferrooxydans PV-1]
 gi|114551664|gb|EAU54217.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mariprofundus
           ferrooxydans PV-1]
          Length = 477

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 238/475 (50%), Positives = 320/475 (67%), Gaps = 8/475 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+EVH Q++  +K F G S  FG+EPNTQ       MPG LP+LNG   ++ ++T
Sbjct: 3   WEVVIGLEVHVQINTATKAFCGCSTEFGSEPNTQTCPVCLGMPGQLPVLNGEAAEKTILT 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL +NA IN  S F RKNYFYPDLP+GYQISQ   P+V  G + +   P K G  + I  
Sbjct: 63  GLAINADINLESKFDRKNYFYPDLPKGYQISQFAVPLVENGYLDI---PVKDGGEKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI RIH+E+DAGKS+H+    VS IDLNRSGV LMEIV++PDMRS+ EA A+L +L  ++
Sbjct: 118 GITRIHMEEDAGKSMHEGLDGVSHIDLNRSGVPLMEIVSEPDMRSADEAIAYLKQLHQLI 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
            +L     NME G  R D NVSV +PG  +GTR E+KN+NS RF+  AIEYE  RQI ++
Sbjct: 178 VFLDVSGANMEMGQFRCDANVSVHQPGTPFGTRAELKNLNSFRFIKQAIEYEVNRQIELI 237

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           EDGG + QETRLFD +K E+R +R+KE+A DYRYF EPDL PL + +  + AI+  +PEL
Sbjct: 238 EDGGEVVQETRLFDSAKGESRPMRSKEEAHDYRYFPEPDLPPLRVTQQQVDAIRDGMPEL 297

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR--DKKIVANWVINDLLGVLNR 379
           P   R RF  E+G+S YDA VL   +++AD++E L      D K  ANW+ N+LLG L  
Sbjct: 298 PGQLRHRFETEYGLSSYDADVLTQTRALADWYESLVAAHPADPKRCANWLANELLGRLKE 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            GK IE +P+S  +L  ++D I D TISGKIAKD+ + + E       I+E  GL+QV+D
Sbjct: 358 LGKEIEHSPVSAQRLAGMLDRIADNTISGKIAKDVLDAMLESDDDADAIIEAKGLKQVSD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
             AI+ +++ V+ +NP+ +A   A K  L+ +FVGQVMK + G+ANP++V + L+
Sbjct: 418 SGAIDAIIEAVMAANPDQLAGYRAGKDKLMGFFVGQVMKASKGQANPAMVNQRLQ 472


>gi|167585098|ref|ZP_02377486.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           ubonensis Bu]
          Length = 490

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 244/488 (50%), Positives = 340/488 (69%), Gaps = 13/488 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGA   FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGAPTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSG-QFRTI 139
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +   +K+G Q  + 
Sbjct: 64  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 124 TINLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE RRQ
Sbjct: 184 LVVWLGICDGNMQEGSFRCDANVSV-RPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQ 242

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D++  +K  
Sbjct: 243 IELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWVERVKAG 302

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLL 374
           +PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + K  ANW++ D+ 
Sbjct: 303 MPELPAAMQQRFVEQYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAANAKSAANWLMGDVS 362

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK----EIVE 430
             LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF ++W++  T +     I++
Sbjct: 363 SQLNRDGIEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFAMIWDEKATDERAADRIID 422

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q++D  A+E ++D+V+ +N  +V    A K    +  +GQ MK T GKANP  V 
Sbjct: 423 AKGLKQISDTGALEAIIDDVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVN 482

Query: 490 KMLKEKLG 497
           ++LK+KLG
Sbjct: 483 ELLKKKLG 490


>gi|206889686|ref|YP_002248975.1| glu-trnagln amidotransferase suBunit b [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|226709608|sp|B5YL60|GATB_THEYD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|206741624|gb|ACI20681.1| glu-trnagln amidotransferase suBunit b [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 475

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 239/475 (50%), Positives = 330/475 (69%), Gaps = 12/475 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+EVHAQL   SK+F G S  FGAEPNTQV      MPG+LP+LN + V+  V T
Sbjct: 3   YEAVIGLEVHAQLLTESKIFCGCSTQFGAEPNTQVCPVCLGMPGVLPVLNKKAVEYTVKT 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL +N  I  YS FARKNYFYPDLP+GYQISQ++ P+  +G + + +   K       ++
Sbjct: 63  GLAMNCKIAPYSRFARKNYFYPDLPKGYQISQYELPLCEDGYLEIMLNGTKR------KI 116

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            I+RIHLE+DAGK+IHD  S  S +D NR+GV LMEIV++PD+RS  EA  ++ KLR+IL
Sbjct: 117 RIKRIHLEEDAGKNIHDP-SGYSFVDFNRTGVPLMEIVSEPDIRSPKEAALYMKKLRAIL 175

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           RYLG CDGN+E+GS+R D NVSV RP     +G + E+KN+NS RF+  A+EYE +RQI 
Sbjct: 176 RYLGVCDGNLEQGSLRCDANVSV-RPVGSTEFGVKTEIKNINSFRFVEKALEYEIKRQIK 234

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++E+G  I QETRL+D     T+S+R+KE+A DYRYF EPDL+P+ + ED+I  IKK +P
Sbjct: 235 LIENGEKIIQETRLWDSQTGTTQSMRSKEEAHDYRYFPEPDLVPVVVSEDWIEKIKKDMP 294

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLN 378
           ELPD K ERFI E+G+  YD+ +L  +K+++++FE+ + +    K VANW++ +LL +LN
Sbjct: 295 ELPDQKIERFIKEYGLPQYDSEILTEEKALSEWFEEAVKLGGKPKEVANWIMVELLRLLN 354

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
             GK I +  + P QL ELI+LI  GTI+   AK++F  +++ G T + IV E GL Q++
Sbjct: 355 EEGKDINECSLKPIQLVELIELINKGTINRNTAKEVFEEMYKTGKTAEAIVREKGLTQIS 414

Query: 439 DLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           D S I + + EV+N NP  V R    +  L+ +FVGQVMK T GKANP +V +++
Sbjct: 415 DDSVIIEAIKEVMNKNPKEVERFRNGEEKLIGFFVGQVMKITKGKANPKLVNELI 469


>gi|187930758|ref|YP_001901245.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ralstonia
           pickettii 12J]
 gi|309780246|ref|ZP_07674997.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Ralstonia sp.
           5_7_47FAA]
 gi|229486431|sp|B2U7W0|GATB_RALPJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|187727648|gb|ACD28813.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Ralstonia pickettii
           12J]
 gi|308920949|gb|EFP66595.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Ralstonia sp.
           5_7_47FAA]
          Length = 488

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 246/487 (50%), Positives = 336/487 (68%), Gaps = 14/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E H QLS VSK+FSGAS  FGA PNTQ +  D A+PG+LP+LN   V++A++ 
Sbjct: 3   WEVVIGLETHTQLSTVSKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAIVF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF---RT 138
           GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G ++  +   K+GQ    +T
Sbjct: 63  GLAIGAKIAPKSIFARKNYFYPDLPKGYQISQYEIPVVQGGTLTFQV-EGKNGQPGYEKT 121

Query: 139 IEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
           ++  + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L 
Sbjct: 122 VQ--LTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKALH 179

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           +++ +LG CDGNM+EGS R D NVSV R P   +GTRCE+KN+NS RFL  AI YE RRQ
Sbjct: 180 ALVMWLGICDGNMQEGSFRCDANVSVRRGPDAPFGTRCEIKNLNSFRFLEEAINYEVRRQ 239

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPL I +D+I  ++  
Sbjct: 240 IELIEDGGTVVQETRLYDPDRKETRSMRSKEDAQDYRYFPDPDLLPLVIGDDWIERVRAT 299

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL---AVNRDKKIVANWVINDLL 374
           +PELP A   RF   +G+  YDAS+L + K+ A YFE +   A   + K  ANW++ ++ 
Sbjct: 300 LPELPAAMAARFESAYGLPKYDASILTATKATAAYFEAVVADAGAANAKAAANWIMGEVA 359

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEE 431
             LNR+   I+  P+SP QL +L+  I DGTIS   A KD+F  +W  E GG    I+ E
Sbjct: 360 SNLNRADLDIDAAPVSPAQLAKLLARIADGTISNNTAKKDVFPAMWAGEHGGDADAIIAE 419

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D   +EK++D+V+ +N  +V    A K    +  VGQ MK T GKANP+ V  
Sbjct: 420 KGLKQMSDSGELEKIIDDVLAANAKSVEEFRAGKEKAFNALVGQAMKATRGKANPAQVND 479

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 480 LLKKKLG 486


>gi|322421571|ref|YP_004200794.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Geobacter sp. M18]
 gi|320127958|gb|ADW15518.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacter sp. M18]
          Length = 480

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 238/482 (49%), Positives = 327/482 (67%), Gaps = 13/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           ++VVIG+EVH QL+  +K+F G S  FGAEPN+Q        PG LP+LN + V+ A++ 
Sbjct: 3   YQVVIGLEVHTQLTTNTKIFCGCSTRFGAEPNSQTCPVCLGFPGALPVLNRQVVEFAILA 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL  N  I + +VFARKNYFYPDLP+GYQISQ D PI   G + + +  ++        +
Sbjct: 63  GLATNCSITQRNVFARKNYFYPDLPKGYQISQFDLPICQHGHLDIEVEGEQK------RI 116

Query: 142 GIERIHLEQDAGKSIHDQYSAV---SCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
           GI RIH+E+DAGK +H     V   SC+DLNR+   L+EIV++PDMRS  EA A+L KL 
Sbjct: 117 GITRIHMEEDAGKLVHADIPGVGDDSCVDLNRACTPLLEIVSEPDMRSPDEAIAYLKKLH 176

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQ 257
            I+ YLG CDGN+EEGS R D NVS+   G + +GTR E+KN+NS +F+  AIEYE  RQ
Sbjct: 177 QIVMYLGICDGNLEEGSFRCDANVSLMPVGSSVFGTRAELKNINSFKFIKQAIEYEMERQ 236

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
             IL++GG I QETRLFDP+   TRS+R KE+A DYRYF +PDL+P+ I + +I  ++  
Sbjct: 237 AEILDEGGRIIQETRLFDPTTGTTRSMRGKEEAHDYRYFPDPDLVPVIIPDQWIEEVRGT 296

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGV 376
           +PELP+AKR R+I E G+  YDA VLV+   +A Y+E+ +A+    K V+NWV+ ++   
Sbjct: 297 LPELPEAKRARYIAELGLPAYDAEVLVASCELARYYEETVALFPQAKTVSNWVMGEVTRA 356

Query: 377 LNRSG-KSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
           LN  G + I D P++P  L +L+ L+  GTISGKIAK +F+ +++ G  P++IVEE GL 
Sbjct: 357 LNDDGNRCISDCPVTPALLADLLKLMEKGTISGKIAKTVFDEMYKTGKAPEKIVEEKGLV 416

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           QV+D  AIE +VDEV+  NP  VA     K  L  +FVGQVM+ + GKANP++V ++L +
Sbjct: 417 QVSDTGAIEAMVDEVLEKNPGQVAEYKGGKETLFGFFVGQVMRASKGKANPAVVNELLLK 476

Query: 495 KL 496
           KL
Sbjct: 477 KL 478


>gi|73539777|ref|YP_294297.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ralstonia
           eutropha JMP134]
 gi|109892053|sp|Q477I0|GATB_RALEJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|72117190|gb|AAZ59453.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ralstonia eutropha JMP134]
          Length = 485

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 240/484 (49%), Positives = 328/484 (67%), Gaps = 9/484 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E H QLS  SK+FSG S  FGAEPNTQ S  D A+PG+LP+LN   V++A+  
Sbjct: 3   WEVVIGLETHTQLSTASKIFSGTSTAFGAEPNTQASPVDLALPGVLPVLNKGAVERAIQF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +   K G+     V
Sbjct: 63  GLAIGATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGSITIQV-EGKKGEVYEKTV 121

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L S++
Sbjct: 122 QLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKALHSLV 181

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            +LG CDGNM+EGS R D NVSV   G+  +GTR E+KN+NS RFL  AIEYE + QI  
Sbjct: 182 VWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRREIKNLNSFRFLQQAIEYEVQWQINE 241

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDG  I+Q T LFDP   ETR++RTKEDA DYRYF +PDL+PLEID  +I  ++ ++PE
Sbjct: 242 IEDGRKIQQATVLFDPDTGETRAMRTKEDAHDYRYFPDPDLMPLEIDAAWIERVRGELPE 301

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVINDLLGVL 377
           LP A + RF+ ++G+S YDAS L + K++A Y+E +       + K  ANW++ D+   L
Sbjct: 302 LPAAMQARFVSQYGLSAYDASTLTASKAMASYYEAVVAEVGAANAKPAANWLMGDVASQL 361

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEELGL 434
           NR G SI+  P+ P QL  L+  I DGT+S   A KD+F  +W  E  G    I+   GL
Sbjct: 362 NREGISIDAAPVKPLQLARLLARIADGTVSNNTAKKDVFPAMWAGESNGDADAIIAAKGL 421

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           +Q++D   +EK++D+V+ +N  +V    A K    +  VGQ MK T GKANP+ V ++LK
Sbjct: 422 KQMSDTGELEKIIDDVLAANAKSVEEFRAGKEKAFNALVGQAMKATKGKANPAQVNELLK 481

Query: 494 EKLG 497
           +KLG
Sbjct: 482 KKLG 485


>gi|113866139|ref|YP_724628.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ralstonia
           eutropha H16]
 gi|123329661|sp|Q0KFG1|GATB_RALEH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|113524915|emb|CAJ91260.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Ralstonia eutropha
           H16]
          Length = 485

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 240/484 (49%), Positives = 333/484 (68%), Gaps = 9/484 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS  SK+FSG S  FGAE NTQ S  D A+PG+LP+LN   V++A+  
Sbjct: 3   WEVVIGLETHAQLSTASKIFSGTSTAFGAEANTQASPVDLALPGVLPVLNKGAVERAIQF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A I+  SVFARKNYFYPDLP+GYQISQ++ P+V  G +++ +   + G+F    V
Sbjct: 63  GLAIGATISPRSVFARKNYFYPDLPKGYQISQYEIPVVQGGTITIQV-EGRKGEFYEKTV 121

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L S++
Sbjct: 122 NLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKALHSLV 181

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            +LG CDGNM+EGS R D NVSV   G+  +GTR E+KN+NS RFL  AIEYE + QIA 
Sbjct: 182 VWLGICDGNMQEGSFRCDANVSVRPLGQKEFGTRREIKNLNSFRFLQQAIEYEVQWQIAE 241

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDG  I+Q T LFDP   ETR++RTKEDA DYRYF +PDL+PLEID  ++  ++ ++PE
Sbjct: 242 IEDGRKIQQATVLFDPETGETRAMRTKEDAHDYRYFPDPDLMPLEIDASWVERVRGELPE 301

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVINDLLGVL 377
           LP A + RF+ ++G+S YDA+ L + K+ A Y+E +  +    + K  ANW++ D+   L
Sbjct: 302 LPVAMQARFVSQYGLSAYDATTLTATKAFAAYYEAVVADAGAANAKPAANWLMGDVASQL 361

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEELGL 434
           NR G +I+  P++P QL  L+  I DGT+S   A KD+F  +W  E GG    I+   GL
Sbjct: 362 NREGIAIDAAPVTPAQLARLLARIADGTVSNNTAKKDVFPAMWAGEHGGDADAIIAAKGL 421

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           +Q++D   +EK++D+V+ +N  +V    A K    +  VGQ MK T GKANP+ V ++LK
Sbjct: 422 KQMSDTGELEKIIDDVLAANARSVEEFRAGKEKAFNALVGQAMKATKGKANPAQVNELLK 481

Query: 494 EKLG 497
           +KLG
Sbjct: 482 KKLG 485


>gi|192362412|ref|YP_001983279.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Cellvibrio
           japonicus Ueda107]
 gi|229486051|sp|B3PC09|GATB_CELJU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|190688577|gb|ACE86255.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Cellvibrio japonicus Ueda107]
          Length = 481

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 238/471 (50%), Positives = 324/471 (68%), Gaps = 12/471 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+EVH QL+  +K+FSGAS  FGAEPNTQ    D A+PG LP  N    + A M 
Sbjct: 3   WETVIGLEVHVQLATKTKIFSGASTAFGAEPNTQACAIDLALPGTLPTPNAEAFRFATMF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL +NA I K SVF RKNYFYPDLP+GYQ +Q  +PIVG G V + +   + G  RT  V
Sbjct: 63  GLAVNAEIGKRSVFERKNYFYPDLPKGYQTTQLAEPIVGAGYVDLEL---EGG--RTKRV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            I   HLE+DAGKS+H+ ++ +S IDLNR+G  L+E+VT+PDMRS+ EA AF  KL SI+
Sbjct: 118 RIHHAHLEEDAGKSLHEDFAGMSGIDLNRAGTPLIEVVTEPDMRSAEEAVAFAKKLHSIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
             L  CDG+M +GSMR DVN+SV   G E +GTR E KN+NS +F+  AI  E  RQI +
Sbjct: 178 TSLEICDGDMSQGSMRFDVNISVRPKGQEKFGTRTETKNLNSFKFMEEAIALEVERQIDV 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LEDGG I QETRL++    + RS+R+KED+ DYRYF  PDLLP+ +D+D+I A+++Q+PE
Sbjct: 238 LEDGGKIIQETRLYNGDTKKARSMRSKEDSNDYRYFPCPDLLPVILDDDYIDAVRQQMPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNR 379
           LPDA++ RFIG++ +S YDA  L +DK +A +FE+ A +++D K+ ANWV+ +L   LN+
Sbjct: 298 LPDARQARFIGQYALSSYDAGQLSADKLVAAFFEQTAQLSQDAKLSANWVLGELAAHLNK 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           + + I ++ ++P  L  LI  I DGT+S KIAK +F  +    G    I++  GL+QV+D
Sbjct: 358 TEQRISNSTVTPELLAGLIARIKDGTLSSKIAKLVFEAICNGEGDADSIIDTRGLKQVSD 417

Query: 440 LSAIEKVVDEVINSNPNNV-----ARIATKPNLVSWFVGQVMKNTGGKANP 485
             A+EK++DEVI  NP  V     A  + +P ++ +FVGQVMK + G+ANP
Sbjct: 418 TGALEKMIDEVIAKNPQQVDNYRNADDSKRPKMLGFFVGQVMKASQGQANP 468


>gi|298528799|ref|ZP_07016203.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298512451|gb|EFI36353.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 476

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 237/480 (49%), Positives = 328/480 (68%), Gaps = 9/480 (1%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           D+E VIG+EVHAQL   SK+F   S  FG +PNT        MPG+LP+LN R V+ AV 
Sbjct: 3   DYETVIGLEVHAQLKTRSKIFCSCSTQFGNDPNTNTCPICTGMPGVLPVLNKRAVEFAVK 62

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
             L L+  +N+ SVFARKNYFYPDLP+GYQISQ+D+P+   G + +        Q R  +
Sbjct: 63  MALALDCRVNERSVFARKNYFYPDLPKGYQISQYDQPLAEHGHIKIL------AQNREKD 116

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           VGI RIH+E+DAGKSIH     +S +DLNR+GV LMEIV++PDMRS  EA A+L  LRSI
Sbjct: 117 VGITRIHMEEDAGKSIHSHSEGLSYVDLNRTGVPLMEIVSEPDMRSPEEAAAYLKALRSI 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGE-AWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           LRYL   DGNMEEGS R D NVS+   G+   GTR E+KN+NS R +  A+EYE  RQ+ 
Sbjct: 177 LRYLDISDGNMEEGSFRCDANVSIRPRGKNELGTRTEIKNLNSFRNVQKALEYEVSRQMD 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ILED   + QETRLFDP +  T S+R KE+A DYRYF +PDL+PL +D D+   +KK++P
Sbjct: 237 ILEDKEEVIQETRLFDPDRGITVSMRGKEEAHDYRYFPDPDLVPLLVDRDWTLRLKKELP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLN 378
           ELP A+  RFI ++ +   D+ VL S++ +AD+FE+   +    K ++NWV+ +LL  LN
Sbjct: 297 ELPMARLARFISQYELPHEDSQVLTSERDLADFFEECTRLYAQPKKISNWVMTELLRELN 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++  SI+++  SP  L +L+ ++ +GTIS KIAK +F  ++  G  P+++V++ GL Q++
Sbjct: 357 QAATSIKESGFSPGLLAKLVRMVDEGTISNKIAKSLFPEVFASGSDPEKLVQDKGLGQIS 416

Query: 439 DLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D   +E+VVDEVI+ NP+ V +    +  L+S+FVGQVMK T G+ANP +V +++  KLG
Sbjct: 417 DSGELERVVDEVISENPDEVQKYQQGRKKLMSFFVGQVMKKTKGQANPGLVNELINRKLG 476


>gi|238028926|ref|YP_002913157.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           glumae BGR1]
 gi|237878120|gb|ACR30453.1| Glutamyl-tRNA [Burkholderia glumae BGR1]
          Length = 490

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 241/490 (49%), Positives = 341/490 (69%), Gaps = 17/490 (3%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS  SK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTASKIFSGASTQFGAEPNTQACAVDLALPGVLPLLNRGAVERAIRL 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD----KSGQFR 137
           GL ++A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  +    K+   +
Sbjct: 64  GLAVDATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGRITIQVPANEKAGKAAYAK 123

Query: 138 TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
           TI   + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L
Sbjct: 124 TIH--LTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKAL 181

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
            +++ +LG CDGNM+EGS R D NVSV RP   E +GTR E+KN+NS RFL  AI YE R
Sbjct: 182 HALVVWLGICDGNMQEGSFRCDANVSV-RPLGQETFGTRAEIKNLNSFRFLEDAINYEVR 240

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI +++DGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+P+ ID +++  ++
Sbjct: 241 RQIELIKDGGQVVQETRLYDPDKRETRSMRSKEDAQDYRYFPDPDLMPVVIDPEWVERVR 300

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVIND 372
            ++PELP A ++RF  ++G++ YDA VL S K++A YFE     A   + K  ANW++ D
Sbjct: 301 GEMPELPAAMQQRFADQYGVTPYDAVVLTSSKAMAAYFEAVVAKAGAANAKAAANWLMGD 360

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK----EI 428
           +  +LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++  T +     I
Sbjct: 361 VSSLLNREGIEIDACPVSAAQLALVLQRIADGTISNKIAKEIFQAIWDEQATDEAAADRI 420

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSI 487
           +E  GL+Q++D   +E ++D V+ +N  +V    A K    +  VGQ MK T GKANP+ 
Sbjct: 421 IEAKGLKQISDTGELEAIIDAVLAANAKSVEEFRAGKEKAFNALVGQAMKATKGKANPAQ 480

Query: 488 VQKMLKEKLG 497
           V ++LK+KLG
Sbjct: 481 VNELLKKKLG 490


>gi|297539763|ref|YP_003675532.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Methylotenera sp.
           301]
 gi|297259110|gb|ADI30955.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylotenera sp.
           301]
          Length = 481

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 240/480 (50%), Positives = 319/480 (66%), Gaps = 5/480 (1%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WEVVIG+E H QL   +K+FSGAS+ +GAEPNTQ      A+PG+LP+LN   VQ A+ 
Sbjct: 2   EWEVVIGLETHTQLKTNTKIFSGASIKYGAEPNTQACEVSIALPGVLPVLNKEAVQCAIK 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSGQFRTI 139
            GL +NAHI   SVFARKNYFYPDLP+GYQISQ + P+VG+G V++ +    K+  +  +
Sbjct: 62  FGLAINAHIAPRSVFARKNYFYPDLPKGYQISQFELPVVGKGAVTIQVPAVGKNAAYEKV 121

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V I R HLE+DAGKS+H     +S IDLNR+G  L+EIVT+PDMRS+ EA A+  KL  
Sbjct: 122 -VNITRAHLEEDAGKSVHGAVEGMSGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKKLHE 180

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           +++++G CDGNM+EGS R DVNVSV   G E  GTR E+KN+NS +F+  AIEYE R QI
Sbjct: 181 LVQWIGICDGNMQEGSFRCDVNVSVRPKGTEKLGTRREIKNLNSFKFMTQAIEYETRWQI 240

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
             LEDGG I+Q T LF+P   ETR++R+KE+A DYRYF +PDLLPL I E    A+K  +
Sbjct: 241 ETLEDGGTIQQATVLFNPDTGETRAMRSKEEANDYRYFPDPDLLPLVISEADKDAVKATM 300

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYF-EKLAVNRDKKIVANWVINDLLGVL 377
           PELP+A + RF  ++ +S YDA+ L + + +A+YF   +    D K  ANWV+  L   L
Sbjct: 301 PELPEAMKARFEAQYALSSYDANALTTSRDLANYFVATVDAGADAKQSANWVMGTLAAKL 360

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N    SI D+PI+  QL +L+  I D TIS   AK +F  LW   G+  +I+   GL+Q 
Sbjct: 361 NAVDTSISDSPINAQQLAQLLKRIGDNTISNNAAKQVFEALWNAEGSVDDIIAAKGLKQE 420

Query: 438 TDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D  AIE ++DEV+ +N   V    A K    +  VGQ MK + GKANP+ V  +LK+KL
Sbjct: 421 SDSGAIEAIIDEVLAANAAMVEEFKAGKEKAFNALVGQAMKASKGKANPAQVNDILKKKL 480


>gi|291280306|ref|YP_003497141.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Deferribacter desulfuricans SSM1]
 gi|290755008|dbj|BAI81385.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Deferribacter desulfuricans SSM1]
          Length = 478

 Score =  471 bits (1213), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 237/481 (49%), Positives = 336/481 (69%), Gaps = 12/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+EVH QLS  SK+F   S  FGA+PNT V      MPG+LP+LN + V+  +  
Sbjct: 3   YEAVIGLEVHVQLSTKSKIFCSCSTEFGADPNTHVCPVCLGMPGVLPVLNKQVVEYTIKA 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL LN  I + SVFARKNYFYPDLP+GYQISQ++ PI   G + + I   K       ++
Sbjct: 63  GLALNCDIQRKSVFARKNYFYPDLPKGYQISQYELPICLNGFIEIEIDGVKK------KI 116

Query: 142 GIERIHLEQDAGKSIHDQ---YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
           GI RIH+E+DAGKSIH +     A S +DLNR+GV L+EIV++PD+R+  EA+A+L KL+
Sbjct: 117 GITRIHMEEDAGKSIHGENLGSPAHSYVDLNRTGVPLIEIVSEPDIRTPEEARAYLQKLK 176

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           +IL Y+   D NMEEGS+R D N+S+   GE  +GT+ E+KN+NS R +  AIE+E +RQ
Sbjct: 177 TILEYIEVSDCNMEEGSLRCDANISLRPVGETKFGTKTEIKNMNSFRNVQRAIEFEIKRQ 236

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
             IL++GG I QETRL+DP+K  T S+R+KE+A DYRYF +PDL+PL ++ D+I  +K  
Sbjct: 237 AKILDEGGTIVQETRLWDPNKGITVSMRSKEEAHDYRYFPDPDLVPLIVENDWIEKVKST 296

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDLLGV 376
           +PELPDAK+ERF+ E+G+  YDA VL+S+K  ADYFE+   N +  K ++NW+++++L  
Sbjct: 297 LPELPDAKKERFMKEYGLPSYDAEVLISNKHYADYFEQSVKNHNNPKAISNWIMSEVLRD 356

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           +N  G +I +  + P  + E++ LI DG ISGKI K+++ ++ E G +P +IVEE GL Q
Sbjct: 357 VNEKGCNIFELNVKPEHIAEIVKLIDDGKISGKIGKEVYQLVLESGKSPAKIVEEKGLIQ 416

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           ++D SAIE++V +V+ +NP  V R    +  L  +FVGQVMK T GKANP +V ++L++ 
Sbjct: 417 ISDESAIEEIVKKVLEANPKEVERYKNGEKKLQGFFVGQVMKETKGKANPKLVNQLLQKL 476

Query: 496 L 496
           L
Sbjct: 477 L 477


>gi|241664948|ref|YP_002983308.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ralstonia
           pickettii 12D]
 gi|240866975|gb|ACS64636.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Ralstonia pickettii
           12D]
          Length = 488

 Score =  471 bits (1212), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 246/488 (50%), Positives = 336/488 (68%), Gaps = 16/488 (3%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E H QLS VSK+FSGAS  FGA PNTQ +  D A+PG+LP+LN   V++A++ 
Sbjct: 3   WEVVIGLETHTQLSTVSKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAIVF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF---RT 138
           GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G ++  +   K+GQ    +T
Sbjct: 63  GLAIGAKIAPKSIFARKNYFYPDLPKGYQISQYEIPVVQGGTLTFQV-EGKNGQPGYEKT 121

Query: 139 IEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
           ++  + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L 
Sbjct: 122 VQ--LTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKALH 179

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCRPG--EAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           +++ +LG CDGNM+EGS R D NVSV RPG    +GTRCE+KN+NS RFL  AI YE RR
Sbjct: 180 ALVMWLGICDGNMQEGSFRCDANVSV-RPGPDAPFGTRCEIKNLNSFRFLEEAINYEVRR 238

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPL I +D+I  ++ 
Sbjct: 239 QIELIEDGGTVVQETRLYDPDRKETRSMRSKEDAQDYRYFPDPDLLPLVIGDDWIERVRA 298

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL---AVNRDKKIVANWVINDL 373
            +PELP A   RF   +G+  YDAS+L + K+ A YFE +   A   + K  ANW++ ++
Sbjct: 299 TLPELPAAMAARFESAYGLPKYDASILTATKATAAYFEAVVADAGAANAKAAANWIMGEV 358

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVE 430
              LNR+   I+  P+ P QL +L+  I DGTIS   A KD+F  +W  E GG    I+ 
Sbjct: 359 ASNLNRADLDIDAAPVKPAQLAKLLARIADGTISNNTAKKDVFPAMWAGEHGGDADAIIA 418

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
           E GL+Q++D   +EK++D+V+ +N  +V    A K    +  VGQ MK T GKANP+ V 
Sbjct: 419 EKGLKQMSDSGELEKIIDDVLAANAKSVEEFRAGKEKAFNALVGQAMKATRGKANPAQVN 478

Query: 490 KMLKEKLG 497
            +LK+KLG
Sbjct: 479 DLLKKKLG 486


>gi|94501671|ref|ZP_01308186.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Oceanobacter sp.
           RED65]
 gi|94426158|gb|EAT11151.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Oceanobacter sp.
           RED65]
          Length = 472

 Score =  471 bits (1212), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 242/474 (51%), Positives = 327/474 (68%), Gaps = 13/474 (2%)

Query: 34  LSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYS 93
           L+  SK+FSG+S  FGAEPNTQ S  D  +PG+LP+ N   ++ AV  GL ++A I K S
Sbjct: 3   LATKSKIFSGSSTEFGAEPNTQASLVDLGLPGVLPVFNEEALRMAVKFGLAIDAEIGKVS 62

Query: 94  VFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAG 153
           VF RKNYFYPD P+GYQ +Q   PIVG G + + +   + G  + I V   R HLE+DAG
Sbjct: 63  VFDRKNYFYPDSPKGYQTTQLHHPIVGMGHIDIDL---EDGTTKRINV--TRAHLEEDAG 117

Query: 154 KSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEE 213
           KS+H+ +  +S IDLNR+G  L+EIV++P++RS+ EA A+  K+ SI+ YLG CDG++ +
Sbjct: 118 KSLHEDFHGMSGIDLNRAGTPLIEIVSEPEIRSAKEAAAYFKKMHSIVTYLGICDGDLSQ 177

Query: 214 GSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETR 272
           GSMR D NVS+   G E +GTR E+KNVNS RF+  AI  E  RQ+ ILEDGG I QETR
Sbjct: 178 GSMRCDCNVSLRPKGQEEFGTRTEIKNVNSFRFVEQAINVEIERQMDILEDGGEIVQETR 237

Query: 273 LFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGE 332
           LFDP K ETRS+R+KE   DYRYF  PDLLP+ ID+D+I+AI   +PELPD K++RF+ E
Sbjct: 238 LFDPVKMETRSMRSKEVENDYRYFPCPDLLPVVIDDDYIQAINDSLPELPDQKKQRFMDE 297

Query: 333 FGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVLNRSGKSIEDTPISP 391
            G+S YDA VL + ++IADYFE +A    D K+ ANWV+ +L   LN++   I+D+PIS 
Sbjct: 298 HGLSEYDAGVLSATRAIADYFEAVAAKCGDFKLAANWVMGELSAALNKNEVEIQDSPISA 357

Query: 392 NQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKE-IVEELGLRQVTDLSAIEKVVDEV 450
            QLG+++  I D TISGK  K +F  LWE+ G   + +++ LGL+QVTD  AIE +V++V
Sbjct: 358 KQLGQMLVRIKDDTISGKGGKTLFQALWEQQGDDVDALIDSLGLKQVTDTGAIEAIVEDV 417

Query: 451 INSNPNNVAR-IATKPN----LVSWFVGQVMKNTGGKANPSIVQKMLKEKLGIK 499
           I +N   V + +  +P+    ++ +FVGQVMK + G ANP +  KMLKEKL  K
Sbjct: 418 IANNQAQVDQYVNAEPDKRGKMIGFFVGQVMKASKGTANPGMANKMLKEKLDAK 471


>gi|149925922|ref|ZP_01914185.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Limnobacter sp.
           MED105]
 gi|149825210|gb|EDM84421.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Limnobacter sp.
           MED105]
          Length = 479

 Score =  471 bits (1212), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 232/481 (48%), Positives = 332/481 (69%), Gaps = 12/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE+V+G+E H QL+  SK+FSGAS  FGAEPN Q    D A+PG+LP++N   VQ+A+  
Sbjct: 3   WEIVVGLETHTQLTTESKIFSGASTAFGAEPNAQACAVDLALPGVLPVMNKAAVQRAIQF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A + ++SVFARKNYFYPDLP+GYQISQ + P+V  G VS  +G     Q +T+  
Sbjct: 63  GLAVGAKVAEHSVFARKNYFYPDLPKGYQISQFEIPVVQGGTVSFLLG----DQMKTVR- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS+H+ ++  S IDLNR+G  L+EIVT+PDMRS+ EA A+   L +++
Sbjct: 118 -LVRAHLEEDAGKSLHEDFAGQSGIDLNRAGTPLLEIVTEPDMRSAEEAVAYAKTLHTLV 176

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            +LG CDGNM+EGS R D NVSV   GE+  GTRCE+KN+NS +FL  AI YEA+RQI I
Sbjct: 177 TWLGICDGNMQEGSFRCDANVSVRPKGESKLGTRCEIKNLNSFKFLQAAILYEAQRQIEI 236

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG I+QETRL+DP +NETRS+R+KED+ DYRYF +PDL PL I  +++  ++ ++PE
Sbjct: 237 IEDGGVIKQETRLYDPDRNETRSMRSKEDSEDYRYFPDPDLPPLVISPEWVEQVRAEMPE 296

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK--LAVNRDK-KIVANWVINDLLGVL 377
           LP  K+ R+  + G+S YDA  L   +++ ++FE   +A   DK K +ANW++ +    L
Sbjct: 297 LPGQKQARYTADLGLSEYDAVTLTGSRAMTNFFEAALVAAGNDKAKPLANWLLGEFSANL 356

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLRQ 436
           NR  K+  ++PI+P  +  L+  ++DGT++ K AK +F  LWE K       ++  GL Q
Sbjct: 357 NRDDKTPAESPITPVLMAALVKRVVDGTLNNKTAKVVFAALWEGKYSDVDACIKGEGLEQ 416

Query: 437 VTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           ++D  A+EK++D+V+ ++P  VA   A K    ++ VGQ+M+   GKANP+ V ++LK K
Sbjct: 417 ISDSGAVEKMIDDVLAAHPGPVAEYKAGKEASFNFLVGQIMRAARGKANPAQVNEILKAK 476

Query: 496 L 496
           L
Sbjct: 477 L 477


>gi|15605949|ref|NP_213326.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Aquifex aeolicus
           VF5]
 gi|7674038|sp|O66766|GATB_AQUAE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|254574884|pdb|3H0L|B Chain B, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574887|pdb|3H0L|E Chain E, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574890|pdb|3H0L|H Chain H, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574893|pdb|3H0L|K Chain K, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574896|pdb|3H0L|N Chain N, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574899|pdb|3H0L|Q Chain Q, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574902|pdb|3H0L|T Chain T, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574905|pdb|3H0L|W Chain W, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574908|pdb|3H0M|B Chain B, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574911|pdb|3H0M|E Chain E, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574914|pdb|3H0M|H Chain H, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574917|pdb|3H0M|K Chain K, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574920|pdb|3H0M|N Chain N, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574923|pdb|3H0M|Q Chain Q, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574926|pdb|3H0M|T Chain T, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574929|pdb|3H0M|W Chain W, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574932|pdb|3H0R|B Chain B, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574935|pdb|3H0R|E Chain E, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574938|pdb|3H0R|H Chain H, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574941|pdb|3H0R|K Chain K, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574944|pdb|3H0R|N Chain N, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574947|pdb|3H0R|Q Chain Q, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574950|pdb|3H0R|T Chain T, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|254574953|pdb|3H0R|W Chain W, Structure Of Trna-Dependent Amidotransferase Gatcab From
           Aquifex Aeolicus
 gi|2983123|gb|AAC06727.1| glutamyl-tRNA (Gln) amidotransferase subunit B [Aquifex aeolicus
           VF5]
          Length = 478

 Score =  471 bits (1212), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 228/477 (47%), Positives = 331/477 (69%), Gaps = 12/477 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+E+H Q+   +K+F G  V FGAEPNT V      MPG LPI+N R V+ A+  
Sbjct: 5   YEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEYAIRA 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
            L LN  +++ SVFARK+YFYPDLP+GYQISQ++KP+   G V +++   +  + R    
Sbjct: 65  SLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVR---- 120

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            I R+H+E+DAGK+IH+     + +DLNR+G  LMEIVT+PD+R+  EA+ FL KLR+I+
Sbjct: 121 -IRRLHIEEDAGKNIHE--GDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNIM 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           RY G    +ME+G +R D+NVS+ RP   + +GTR E+KNVNS RF+  A+EYE  RQI 
Sbjct: 178 RYAGVSKADMEKGQLRCDINVSI-RPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQIN 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++E+GG + QETR FDP   +T  +RTKE+A DYRYF +PDL+PL++ +++I  IKK +P
Sbjct: 237 VVEEGGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVLN 378
           ELPD + ER I E+G+S Y+A +LV+ K + D+FE+   + ++ K + NW+INDLLG+L 
Sbjct: 297 ELPDQRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLR 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
             G SIE++P+ P  L EL+ LI +  IS KI K++   + E G TP +IVEE GL+Q+T
Sbjct: 357 DKGISIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQIT 416

Query: 439 DLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           D + I+++V ++   +P  V R+   +  L+ +FVGQVM+ T GKANP +V K+++E
Sbjct: 417 DENQIKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRE 473


>gi|300705542|ref|YP_003747145.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit B
           [Ralstonia solanacearum CFBP2957]
 gi|299073206|emb|CBJ44564.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Ralstonia solanacearum
           CFBP2957]
          Length = 488

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 249/485 (51%), Positives = 333/485 (68%), Gaps = 12/485 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS  SK+FSGAS  FGA PNTQ +  D A+PG+LP+LN   V++A+  
Sbjct: 3   WEVVIGLETHAQLSTASKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAIRF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQ-FRTIE 140
           GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ I   KSGQ      
Sbjct: 63  GLAIGATIAPKSIFARKNYFYPDLPKGYQISQYEIPVVQGGTLTIQI-EGKSGQPGYEKT 121

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L ++
Sbjct: 122 VHLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKALHAL 181

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG--EAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           + +LG CDGNM+EGS R D NVSV RPG     GTRCE+KN+NS RFL  AI YE RRQI
Sbjct: 182 VVWLGICDGNMQEGSFRCDANVSV-RPGPDAPLGTRCEIKNLNSFRFLEEAINYEVRRQI 240

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPL I  D++ A++  +
Sbjct: 241 ELIEDGGTVVQETRLYDPDRKETRSMRSKEDAHDYRYFPDPDLLPLVIGADWVDAVRATL 300

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A   RF   +G+  YDAS+L + K+ A YFE     A   + K  ANW++ ++  
Sbjct: 301 PELPAAMAVRFESAYGLPKYDASILTATKATAAYFEAVVAAAGAANAKAAANWIMGEVAS 360

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEEL 432
            LNR+G  I+  P+SP QL +L+  I DGTIS   A KD+F  +W  E GG    I+ E 
Sbjct: 361 NLNRAGLEIDAAPVSPAQLAKLLARIADGTISNNTAKKDVFPAMWAGEHGGDADTIIAEK 420

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q++D   +EK++D+V+ +N  +V    A K    +  VGQ MK T GKANP+ V ++
Sbjct: 421 GLKQMSDSGELEKIIDDVLAANAKSVEEYRAGKEKAFNALVGQAMKATRGKANPAQVNEL 480

Query: 492 LKEKL 496
           LK+KL
Sbjct: 481 LKKKL 485


>gi|253997615|ref|YP_003049679.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Methylotenera
           mobilis JLW8]
 gi|253984294|gb|ACT49152.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylotenera
           mobilis JLW8]
          Length = 482

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 236/480 (49%), Positives = 315/480 (65%), Gaps = 3/480 (0%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WEVVIG+E H QL   +K+FSGAS  +GAEPNTQ      A+PG+LP+LN   V  A+ 
Sbjct: 2   EWEVVIGLETHTQLKTNTKIFSGASTTYGAEPNTQACEVSIALPGVLPVLNKEAVNCAIK 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL ++A I   SVFARKNYFYPDLP+GYQISQ++ P+VG+G V++ +            
Sbjct: 62  FGLAIHADIAPRSVFARKNYFYPDLPKGYQISQYELPVVGKGAVTIQVPAVGKNAAYEKA 121

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           + I R HLE+DAGKS+H     +S IDLNR+G  L+EIVT+PDMRS+ EA A+  KL  +
Sbjct: 122 INITRAHLEEDAGKSVHGAVEGMSGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKKLHEL 181

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           ++++G CDGNM+EGS R DVNVSV   G E  GTR E+KN+NS +F+  AIEYE R QI 
Sbjct: 182 VQWIGICDGNMQEGSFRCDVNVSVRPKGTEKLGTRREIKNLNSFKFMQQAIEYETRWQIE 241

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
            LEDGG I+Q T LF+P   ETR++R+KE+A DYRYF +PDLLPLEI E     I+ ++P
Sbjct: 242 TLEDGGTIQQATVLFNPDTGETRAMRSKEEANDYRYFPDPDLLPLEITEADKARIQAEMP 301

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLN 378
           ELP+A + RF  +FG++ YDA+ L +D+++ADYF  +     + K  ANWV+  +   LN
Sbjct: 302 ELPEAMKARFESQFGLTSYDAATLTADRALADYFVAVVNAGAEAKPAANWVMGAISAKLN 361

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
              KS+  +P+    L  LI  I D TIS   AK +F  +W   G    I+E  GL+QV+
Sbjct: 362 AEEKSLAASPVGAESLAALIKRITDNTISNNAAKQVFEAMWNGEGEVDAIIEAKGLKQVS 421

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  AIE ++DEV+ +N   V    A K    +  VGQ MK + GKANP+ V ++LK KLG
Sbjct: 422 DTGAIEAIIDEVLAANAAMVEEFKAGKEKAFNALVGQAMKASKGKANPAQVNEVLKRKLG 481


>gi|253702340|ref|YP_003023529.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Geobacter sp.
           M21]
 gi|259647234|sp|C6E6Z3|GATB_GEOSM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|251777190|gb|ACT19771.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacter sp. M21]
          Length = 479

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 239/481 (49%), Positives = 325/481 (67%), Gaps = 12/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           ++VVIG+EVH QL+  +K+F G S  FGAEPN+Q       +PG LP+LN + V+ A+  
Sbjct: 3   YQVVIGLEVHTQLTTNTKIFCGCSTRFGAEPNSQTCPVCLGLPGALPVLNRQVVEYAIRA 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL  N  I + +VFARKNYFYPDLP+GYQISQ D PI   G + +    D  G+ + I  
Sbjct: 63  GLATNCSITQRNVFARKNYFYPDLPKGYQISQFDLPICQHGHLDI----DLEGERKRI-- 116

Query: 142 GIERIHLEQDAGKSIHDQYSAV--SCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           GI RIH+E+DAGK +H     V  SC+DLNR+   L+EIV++PDMRS  EA A+L KL  
Sbjct: 117 GITRIHMEEDAGKLVHADIPGVDDSCVDLNRACTPLLEIVSEPDMRSPDEAIAYLKKLHQ 176

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGE-AWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+ YLG CDGN+EEGS R D NVS+   G   +GTR E+KN+NS +F+  AIEYE  RQ 
Sbjct: 177 IVMYLGICDGNLEEGSFRCDANVSLMPVGSNVFGTRAELKNINSFKFIKQAIEYEIERQA 236

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            IL+DGG + QETRLFDP+   TRS+R KE+A DYRYF +PDL+P+ I +D+I  ++ ++
Sbjct: 237 EILDDGGKVIQETRLFDPNTGTTRSMRGKEEAHDYRYFPDPDLVPVIISDDWIERVRGEL 296

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANWVINDLLGVL 377
           PELP+AKR RF+ E  +  YDA VL + + +A YFE   A+    K V+NWV+ ++   L
Sbjct: 297 PELPEAKRARFMSELSLPEYDAEVLAASRELAQYFEDTFALFPQAKTVSNWVMGEVTRAL 356

Query: 378 N-RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           N  + +SI + P++P  L +L+ L+  GTISGKIAK +F+ +++ G  P++IVEE GL Q
Sbjct: 357 NDDNNRSIAECPVTPALLADLLKLMEKGTISGKIAKTVFDEMYKTGKAPEKIVEEKGLVQ 416

Query: 437 VTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D  AIE ++DEV+  N   VA     K  L  +FVGQVM+ + GKANP +V +ML +K
Sbjct: 417 VSDTGAIEAMIDEVLEKNAGQVAEYRGGKETLFGFFVGQVMRASKGKANPGVVNEMLLKK 476

Query: 496 L 496
           L
Sbjct: 477 L 477


>gi|197120006|ref|YP_002140433.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Geobacter
           bemidjiensis Bem]
 gi|229486068|sp|B5ED20|GATB_GEOBB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|197089366|gb|ACH40637.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Geobacter bemidjiensis Bem]
          Length = 488

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 241/490 (49%), Positives = 328/490 (66%), Gaps = 21/490 (4%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           ++VVIG+EVH QL+  +K+F G S  FGAEPN+Q       +PG LP+LN + V+ A+  
Sbjct: 3   YQVVIGLEVHTQLTTNTKIFCGCSTRFGAEPNSQTCPVCLGLPGALPVLNQQVVEYAIRA 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL  N  I K +VFARKNYFYPDLP+GYQISQ D PI   G + + +  +K        +
Sbjct: 63  GLATNCSITKRNVFARKNYFYPDLPKGYQISQFDLPICQHGHLDIEVEGEKK------RI 116

Query: 142 GIERIHLEQDAGKSIHDQYSAV--SCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           GI RIH+E+DAGK +H     V  SC+DLNR+   L+EIV++PDMRS  EA A+L KL  
Sbjct: 117 GITRIHMEEDAGKLVHADIPGVDDSCVDLNRACTPLLEIVSEPDMRSPDEAIAYLKKLHQ 176

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGE-AWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+ YLG CDGN+EEGS R D NVS+   G   +GTR E+KN+NS +F+  AIEYE  RQ 
Sbjct: 177 IVMYLGICDGNLEEGSFRCDANVSLMPVGSNVFGTRAELKNINSFKFIKQAIEYEIERQA 236

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            IL+DGG + QETRLFDP+   TRS+R KE+A DYRYF +PDL+P+ I +D+I  ++  +
Sbjct: 237 EILDDGGKVVQETRLFDPNTGTTRSMRGKEEAHDYRYFPDPDLVPVIISDDWIEKVRGGL 296

Query: 319 PELPDAKRERFIGE---------FGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANW 368
           PELP+AKR RF+ E         FG+  YDA VLV+ + +A YFE  +A+    K V+NW
Sbjct: 297 PELPEAKRARFMSEGGAVFGGSAFGLPEYDAEVLVASRELAQYFEDTVALFPQAKTVSNW 356

Query: 369 VINDLLGVLN-RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKE 427
           V+ ++   LN  + +SI + P++P  L +L+ L+  GTISGKIAK +F+ +++ G   ++
Sbjct: 357 VMGEVTRALNDDNNRSIAECPVTPALLADLLKLMEKGTISGKIAKTVFDEMYKTGKASEK 416

Query: 428 IVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPS 486
           IVEE GL QV+D  AIE +VDEV+  NP  VA     K  L  +FVGQVM+ + GKANP+
Sbjct: 417 IVEEKGLVQVSDTGAIEAMVDEVLEKNPGQVAEYRGGKETLFGFFVGQVMRASKGKANPA 476

Query: 487 IVQKMLKEKL 496
           +V ++L +KL
Sbjct: 477 VVNELLLKKL 486


>gi|152979910|ref|YP_001351883.1| aspartyl/glutamyl-tRNA amidotransferase subunit B
           [Janthinobacterium sp. Marseille]
 gi|166217765|sp|A6SUD6|GATB_JANMA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|151279987|gb|ABR88397.1| glutamyl-tRNA (Gln) amidotransferase subunit B [Janthinobacterium
           sp. Marseille]
          Length = 486

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 241/484 (49%), Positives = 333/484 (68%), Gaps = 11/484 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E H QL+  +K+FSG+   FGAEPNTQ S  D A+PG LP++N   V++A+  
Sbjct: 3   WEVVIGLETHTQLTTQTKIFSGSPTQFGAEPNTQTSPVDLALPGALPVMNRGAVERAIQF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A I  +SVFARKNYFYPDLP+GYQISQ D PIV  G+VS ++  D   + R+++ 
Sbjct: 63  GLAIGATIAPHSVFARKNYFYPDLPKGYQISQMDLPIVQGGRVSFALEVDGKTEIRSVQ- 121

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS+H+ Y  ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L +++
Sbjct: 122 -LTRAHLEEDAGKSLHEDYQGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKALHTLV 180

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            +LG CDGNM+EGS R D NVSV   G+  +GTRCE+KN+NS RFL  AI YE RRQI +
Sbjct: 181 TWLGICDGNMQEGSFRCDANVSVRPVGQKEYGTRCEIKNLNSFRFLEDAINYEVRRQIEL 240

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + Q TRL+DP K ETR +R+KEDA DYRYF +PDL PL +  ++I  ++  +PE
Sbjct: 241 IEDGGRVVQATRLYDPDKKETREMRSKEDAHDYRYFPDPDLPPLVVSAEWIARVQAAMPE 300

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK---KIVANWVINDLLGVL 377
           LP A RERF+ ++ +S YDA+VL   K +A+YFE +     K   K  ANW++ D+   L
Sbjct: 301 LPGAMRERFVRDYALSEYDAAVLTQSKGMANYFEAVVAAAGKEQAKPAANWLMGDVASTL 360

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPK---EIVEELG 433
           NR    I   P++  QL  L+  I DGTIS KIAK++F  +WE K  + K   E++E  G
Sbjct: 361 NREDIEIAAAPVAAAQLALLLQRIADGTISNKIAKEVFGAMWEAKSDSAKLADELIESKG 420

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           L+Q++D  A+EK+VD+V+ +N  +V    A K   ++  +GQ MK + GKANP+ + ++L
Sbjct: 421 LKQISDSGALEKIVDDVLAANAKSVEEFRAGKEQAINALMGQAMKASKGKANPAQLTELL 480

Query: 493 KEKL 496
           K+KL
Sbjct: 481 KKKL 484


>gi|303248217|ref|ZP_07334480.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfovibrio
           fructosovorans JJ]
 gi|302490355|gb|EFL50266.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfovibrio
           fructosovorans JJ]
          Length = 476

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 245/480 (51%), Positives = 320/480 (66%), Gaps = 11/480 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+EVHAQL   SK+F G S  FG +PN  V    + MPG+LP+LN + V+ A   
Sbjct: 4   YETVIGVEVHAQLKTESKIFCGCSTRFGDDPNENVCPVCSGMPGVLPVLNAKVVEFAAKM 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL  +  +N  SVFARKNYFYPDLP+GYQISQ ++PI   G + V +        +T  +
Sbjct: 64  GLATDCTVNPVSVFARKNYFYPDLPKGYQISQFEQPICEHGHIDVVV------DGKTRRI 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI RIH+E+DAGK+IH     +S +DLNRS V L+EIV++PDMRS  E  A+L  LR+IL
Sbjct: 118 GITRIHMEEDAGKNIHSAADNLSYVDLNRSCVPLLEIVSEPDMRSPEEVVAYLKALRAIL 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
            YL  CDGNMEEGS R D NVS+ RP   EA+GTR E+KN+NS R +  AIEYE  RQ  
Sbjct: 178 VYLDICDGNMEEGSFRCDANVSL-RPVGQEAFGTRAELKNLNSFRHVQKAIEYEVERQGD 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           IL+DGG + QETRL+D +KN T S+R KE+A DYRYF +PDL+PL +D D I     ++P
Sbjct: 237 ILDDGGVVVQETRLYDAAKNSTASMRGKEEANDYRYFPDPDLVPLHLDRDTIARWGTELP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANWVINDLLGVLN 378
           ELP A+RERF   FG+S YDA VL +++ +ADYFE  +    D K  ANWV  +LL   +
Sbjct: 297 ELPAARRERFATAFGLSDYDADVLTAERDMADYFEAAVMAGADPKKAANWVQTELLRECH 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           +SG +     +SP +L  L+ LI +G ISGKIAK IF  L+  G  P + V + GL Q++
Sbjct: 357 QSGATPGTCKLSPERLAGLLRLIDEGVISGKIAKQIFPELFASGDDPADYVRDKGLVQIS 416

Query: 439 DLSAIEKVVDEVINSNPNNV-ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D SA+E  VD V+ +NP  V A    K  L+ +FVGQVMK T G+ANP +V ++L++KLG
Sbjct: 417 DTSALETAVDTVLAANPAEVDAYRGGKTKLMGFFVGQVMKATKGQANPGLVNELLRKKLG 476


>gi|118602377|ref|YP_903592.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus
           Ruthia magnifica str. Cm (Calyptogena magnifica)]
 gi|166198817|sp|A1AW14|GATB_RUTMC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|118567316|gb|ABL02121.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
          Length = 476

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 227/480 (47%), Positives = 321/480 (66%), Gaps = 10/480 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE VIG+E+HAQL+  SK+FS AS  +G +PN+Q    D  +PG+LP+LN   + +A+ 
Sbjct: 2   EWETVIGLEIHAQLNTKSKIFSAASTQYGQKPNSQACAVDLGLPGVLPVLNVEVINKAIK 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            G+ +NAHIN+ S+F RKNYFYPDLP+GYQISQ D+PIVGEGK+ ++         +T  
Sbjct: 62  FGVAINAHINQRSIFDRKNYFYPDLPKGYQISQMDRPIVGEGKIEITFDD------QTKI 115

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           VGI R HLE+DAGKS+HD +   + ID NR+G+ L+EIV++PDMRS+ EA  +  K+ ++
Sbjct: 116 VGITRAHLEEDAGKSMHDMFDDDTAIDFNRAGIPLLEIVSEPDMRSAKEAVIYAKKIHAL 175

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           ++Y+  CDGNM+EGS R D NVS+   GE   GTR E+KN+NS +FL  AI  E  RQ  
Sbjct: 176 VQYIDICDGNMQEGSFRFDANVSIRPKGEKELGTRTELKNINSFKFLERAINLEVERQQD 235

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ILE+ G I QETRL+D  K+ETRS+R+KE+  +YRYF +PDLL +EI  + +  I++ +P
Sbjct: 236 ILEESGSIVQETRLYDSVKHETRSMRSKEETNNYRYFPDPDLLSVEISNELLEKIRQTLP 295

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR--DKKIVANWVINDLLGVL 377
           ELP  K+ RF+ E G+S YDA VL   K +ADYFE +  +   + K+ ANW++ +L   L
Sbjct: 296 ELPTQKKARFVSELGLSDYDADVLTLQKPLADYFETMLEHHASNAKLCANWIMGELSASL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+    I+++PI+   L  LI  I D TISGK AKD+F  +W   G   EI++  GL+Q+
Sbjct: 356 NKHKIDIQNSPITAQALSLLISRISDDTISGKAAKDVFKAMWNSEGNADEIIQAKGLKQM 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
             +  IE +V++VI +N     +       +  +FVGQ+MK T GKANP  V ++L+ KL
Sbjct: 416 IGMGEIEAIVEQVIANNARQAVQFKLGNDKIFGFFVGQIMKLTAGKANPKQVNELLRNKL 475


>gi|326568374|gb|EGE18454.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Moraxella
           catarrhalis BC7]
          Length = 490

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 228/480 (47%), Positives = 328/480 (68%), Gaps = 5/480 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +EVVIGIE+H QL+  SK+FS A   FG EPNTQ +  D   PG+LP+LN   +++A+  
Sbjct: 11  YEVVIGIEIHCQLNTDSKIFSNAPTVFGQEPNTQATIVDLGFPGVLPVLNAGVIERALKF 70

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           G+G+NA +  Y+ F RKNYFYPDLP+GYQI+Q   PIVGEG + + +   +  ++ T  +
Sbjct: 71  GMGVNAKLGTYNTFDRKNYFYPDLPKGYQITQMANPIVGEGYIDILVNAGQKDEY-TKRI 129

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+HD    ++ +DLNR+G  L+EIV++PDMRS  EA A++  +  ++
Sbjct: 130 GITRAHLEEDAGKSVHDAVPQMTGVDLNRAGTPLIEIVSEPDMRSVDEAVAYVKTIHELV 189

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
            +LG  D  M EGS RAD+NVSV +P   +GTRCE+KN+NS RF+  AI+ E  RQI ++
Sbjct: 190 TWLGISDAIMAEGSFRADINVSVHKPNTPFGTRCELKNLNSFRFIHRAIKSEIERQIDVI 249

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           EDGG + Q TRL+DP ++ETR++RTKE+A DYRYF +PDLLP+ I ++ +  ++  +PEL
Sbjct: 250 EDGGKVVQATRLYDPERDETRAMRTKEEANDYRYFPDPDLLPVIISDETLAKVRADMPEL 309

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEK---LAVNRDKKIVANWVINDLLGVLN 378
           P  ++ERF+ EFG++ YDA+VL   + ++DYF +   +    + KI ANWV+ +L G LN
Sbjct: 310 PSVRKERFVSEFGLTAYDANVLNGSRELSDYFLQVLDIIGKNNAKIAANWVMGELSGSLN 369

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++  +I+ +PIS  +L  LI  I+D TISGKIAK++F  LWE   +  EI+ E GL+Q T
Sbjct: 370 KNELTIDQSPISAKRLAGLIVRILDDTISGKIAKEVFGHLWESDKSADEIITEKGLKQET 429

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  AIE ++ +V+ +N   V      K    +  VGQVMK + GKANP+ V  +LK+ +G
Sbjct: 430 DTGAIEAIIVDVLANNQAMVDEYKGGKEKAFNGLVGQVMKASRGKANPAQVNALLKQMIG 489


>gi|326576197|gb|EGE26112.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Moraxella
           catarrhalis CO72]
          Length = 490

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 227/480 (47%), Positives = 327/480 (68%), Gaps = 5/480 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +EVVIGIE+H QL+  SK+FS A   FG EPNTQ +  D   PG LP+LN   +++A+  
Sbjct: 11  YEVVIGIEIHCQLNTDSKIFSNAPTVFGQEPNTQATIVDLGFPGALPVLNAGVIERALKF 70

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           G+G+NA +  Y+ F RKNYFYPDLP+GYQI+Q   PIVGEG + + +   +  ++ T  +
Sbjct: 71  GMGVNAKLGTYNTFDRKNYFYPDLPKGYQITQMANPIVGEGYIDILVNAGQKDEY-TKRI 129

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+HD    ++ +DLNR+G  L+EIV++PDMRS  EA A++  +  ++
Sbjct: 130 GITRAHLEEDAGKSVHDAVPQMTGVDLNRAGTPLIEIVSEPDMRSVDEAVAYVKTIHELV 189

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
            +LG  D  M EGS RAD+NVSV +P   +GTRCE+KN+NS RF+  AI+ E  RQI ++
Sbjct: 190 TWLGISDAIMAEGSFRADINVSVHKPNTPFGTRCELKNLNSFRFIHRAIKSEIERQIDVI 249

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           EDGG + Q TRL+DP ++ETR++RTKE+A DYRYF +PDLLP+ I ++ +  ++  +PEL
Sbjct: 250 EDGGKVVQATRLYDPERDETRAMRTKEEANDYRYFPDPDLLPVIISDETLAKVRADMPEL 309

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEK---LAVNRDKKIVANWVINDLLGVLN 378
           P  ++ERF+ EFG++ YDA+VL   + ++DYF +   +    + KI ANWV+ +L G LN
Sbjct: 310 PSVRKERFVNEFGLTAYDANVLNGSRELSDYFLQVLDIIGKNNAKIAANWVMGELSGSLN 369

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++  +I+ +PIS  +L  LI  I+D TISGKIAK++F  LWE   +  EI+ E GL+Q T
Sbjct: 370 KNELTIDQSPISAKRLAGLIVRILDDTISGKIAKEVFGHLWESDKSADEIISEHGLKQET 429

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  AI+ ++ +V+ +N   V      K    +  VGQVMK + GKANP+ V  +LK+ +G
Sbjct: 430 DTGAIQAIIADVLANNQTMVDEYKGGKEKAFNGLVGQVMKASRGKANPAQVNALLKQMIG 489


>gi|8039792|sp|Q49092|GATB_MORCA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|15636539|gb|AAA92127.2| glutamyl-tRNAGln amidotransferase subunit B [Moraxella catarrhalis]
 gi|326567110|gb|EGE17232.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Moraxella
           catarrhalis BC1]
 gi|326574289|gb|EGE24236.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Moraxella
           catarrhalis O35E]
          Length = 490

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 228/480 (47%), Positives = 328/480 (68%), Gaps = 5/480 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +EVVIGIE+H QL+  SK+FS A   FG EPNTQ +  D   PG+LP+LN   +++A+  
Sbjct: 11  YEVVIGIEIHCQLNTDSKIFSNAPTVFGQEPNTQATIVDLGFPGVLPVLNAGVIERALKF 70

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           G+G+NA +  Y+ F RKNYFYPDLP+GYQI+Q   PIVGEG + + +   +  ++ T  +
Sbjct: 71  GMGVNAKLGTYNTFDRKNYFYPDLPKGYQITQMANPIVGEGYIDILVNAGQKDEY-TKRI 129

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+HD    ++ +DLNR+G  L+EIV++PDMRS  EA A++  +  ++
Sbjct: 130 GITRAHLEEDAGKSVHDAVPQMTGVDLNRAGTPLIEIVSEPDMRSVDEAVAYVKTIHELV 189

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
            +LG  D  M EGS RAD+NVSV +P   +GTRCE+KN+NS RF+  AI+ E  RQI ++
Sbjct: 190 TWLGISDAIMAEGSFRADINVSVHKPNTPFGTRCELKNLNSFRFIHRAIKSEIERQIDVI 249

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           EDGG + Q TRL+DP ++ETR++RTKE+A DYRYF +PDLLP+ I ++ +  ++  +PEL
Sbjct: 250 EDGGKVVQATRLYDPERDETRAMRTKEEANDYRYFPDPDLLPVIISDETLAKVRADMPEL 309

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEK---LAVNRDKKIVANWVINDLLGVLN 378
           P  ++ERF+ EFG++ YDA+VL   + ++DYF +   +    + KI ANWV+ +L G LN
Sbjct: 310 PSVRKERFVNEFGLTAYDANVLNGSRELSDYFLQVLDIIGKNNAKIAANWVMGELSGSLN 369

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++  +I+ +PIS  +L  LI  I+D TISGKIAK++F  LWE   +  EI+ E GL+Q T
Sbjct: 370 KNELTIDQSPISAKRLAGLIVRILDDTISGKIAKEVFGHLWESDKSADEIITEKGLKQET 429

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  AIE ++ +V+ +N   V      K    +  VGQVMK + GKANP+ V  +LK+ +G
Sbjct: 430 DTGAIEAIIVDVLANNQAMVDEYKGGKEKAFNGLVGQVMKASRGKANPAQVNALLKQMIG 489


>gi|283850824|ref|ZP_06368110.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfovibrio sp.
           FW1012B]
 gi|283573747|gb|EFC21721.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfovibrio sp.
           FW1012B]
          Length = 476

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 243/480 (50%), Positives = 321/480 (66%), Gaps = 11/480 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIGIEVHAQL   SK+F G S  FG EPN  V    A MPG+LP+LN   V+ A   
Sbjct: 4   YETVIGIEVHAQLKTASKIFCGCSTRFGNEPNENVCPVCAGMPGVLPVLNATAVEYAAKM 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL     +N  SVFARKNYFYPDLP+GYQISQ+++PI   G + +++G    G  + I  
Sbjct: 64  GLATGCVVNPVSVFARKNYFYPDLPKGYQISQYEQPICEHGHIDITVG----GAAKRI-- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI RIH+E+DAGK+IH     VS +DLNR+ V L+EIV++PDMR++ E  A+L  LR+IL
Sbjct: 118 GITRIHMEEDAGKNIHSVAEGVSYVDLNRACVPLIEIVSEPDMRNAEEVVAYLKALRAIL 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
            YL  CDGNMEEGS R D NVS+ RP   EA+GTR E+KN+NS R +  AIEYE  RQ  
Sbjct: 178 VYLDICDGNMEEGSFRCDANVSL-RPVGREAFGTRTELKNLNSFRHVQKAIEYEVNRQAD 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           +L+DGG + QETRL+D  KN T S+R KE+A DYRYF +PDL+PL +D   +   + ++P
Sbjct: 237 VLDDGGAVIQETRLYDAGKNVTVSMRGKEEANDYRYFPDPDLVPLSLDPVLLARWQDELP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLN 378
           ELP A+R+RF+   G+S YDA VL +++ +ADYFE  LA   D K  ANWV  +LL  LN
Sbjct: 297 ELPVARRDRFVTALGLSEYDAEVLTAERDMADYFEATLAAGADPKKAANWVQTELLRELN 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++G +  D  ++P++L  L+ L+ +G ISGKIAK IF  L   G  P   V + GL Q++
Sbjct: 357 QAGIAARDCKLTPDKLAGLMRLVDEGAISGKIAKQIFPDLCATGLDPAAYVRDKGLVQIS 416

Query: 439 DLSAIEKVVDEVINSNPNNV-ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  A+E  VD VI +NP    A    K  L+ +FVGQ+MK T G+ANP +V ++L++KLG
Sbjct: 417 DSGALESAVDAVIAANPAEAEAYRGGKTKLMGFFVGQIMKATKGQANPGLVNELLRKKLG 476


>gi|254429333|ref|ZP_05043040.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Alcanivorax sp. DG881]
 gi|196195502|gb|EDX90461.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Alcanivorax sp. DG881]
          Length = 486

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 237/483 (49%), Positives = 326/483 (67%), Gaps = 8/483 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+EVH QL+ VSKLFSG+ ++ GAEPNTQ S  D  +PG LP++N   V++A + 
Sbjct: 3   WEVVIGLEVHVQLNTVSKLFSGSKLSTGAEPNTQASLVDLGLPGTLPVVNREAVRKAALF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP--DKSGQFRTI 139
           GL +NA I ++SVF RKNYFYPDLP+GYQ +Q  +P+VG G+V + + P  +K G+    
Sbjct: 63  GLAINADICRHSVFERKNYFYPDLPKGYQTTQLAEPVVGAGEVEIQLAPKGNKGGEGEKK 122

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V I   HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDM ++ EA AF  KL +
Sbjct: 123 IVRIHHAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLIEIVSEPDMANAEEAVAFARKLHA 182

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           I+  +G CDG+M +G+MR DVN+SV +PGE  GTR E KN+NS RF+  AI  E  RQI 
Sbjct: 183 IVTSIGICDGDMSQGNMRFDVNISVRKPGEPLGTRTETKNLNSFRFMEKAIALEVERQID 242

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           +LEDGG I QETRL++   +  RS+R+KEDA DYRYF  PDLLP+ I +  I  +K  +P
Sbjct: 243 VLEDGGEIVQETRLYNGDTHTARSMRSKEDANDYRYFPCPDLLPVAITDADIEELKAAMP 302

Query: 320 ELPDAKRERFIGEFGISLYDASVLV-SDKSIADYFEKLAVNRDKKIVANWVINDLLGVLN 378
           ELPD+++ RFI ++ +S YDA +L  S  + A +        D K+ ANWV+ +L   LN
Sbjct: 303 ELPDSRKARFINDYQLSEYDADLLSGSIATAAFFEAAAKAGGDAKLAANWVMGELAAKLN 362

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
              K I D+P+S  QLG+LI  + DGTIS KIAK +F   W   G P +I+E  GL+Q++
Sbjct: 363 AEEKDIADSPVSAEQLGQLIARLKDGTISSKIAKQVFEACWAGEGNPDDIIEAKGLKQMS 422

Query: 439 DLSAIEKVVDEVINSNPNNV-----ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           D   +EK+VD++I +N + V     +  A K   + +FVGQ MK T GKANP  + K+L+
Sbjct: 423 DTGELEKIVDDIIANNASQVDDYRNSDDAKKKKKIGFFVGQAMKATQGKANPQQLNKLLQ 482

Query: 494 EKL 496
           EKL
Sbjct: 483 EKL 485


>gi|93005305|ref|YP_579742.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Psychrobacter
           cryohalolentis K5]
 gi|109892052|sp|Q1QDJ5|GATB_PSYCK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|92392983|gb|ABE74258.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Psychrobacter cryohalolentis K5]
          Length = 509

 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 238/500 (47%), Positives = 324/500 (64%), Gaps = 14/500 (2%)

Query: 7   HVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGM 66
           H  R E    G    +EVVIGIE+H QL+  SK+FS A  +FG EPN+Q S  D  +PG+
Sbjct: 15  HDVRKELFVDG----YEVVIGIEIHCQLNTESKIFSSAPTDFGHEPNSQASIVDLGLPGV 70

Query: 67  LPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSV 126
           LP+LN   V +A+  G+G+NA +  ++ F RKNYFYPDLP+GYQI+Q   PIVGEG + V
Sbjct: 71  LPVLNAGVVDRALKFGIGVNAELGLFNTFDRKNYFYPDLPKGYQITQMANPIVGEGYIDV 130

Query: 127 SIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRS 186
            +   +  ++    +GI R HLE+DAGKS+HD    ++ +DLNR+G  L+EIV++PDMRS
Sbjct: 131 VVNEGEKNEYPK-RMGITRAHLEEDAGKSVHDAVDGMTGVDLNRAGTPLIEIVSEPDMRS 189

Query: 187 SLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFL 246
           + EA A++  +  ++ +LG  D  M EGS R D NVS+ +PG   GTR E+KN+NS RF+
Sbjct: 190 AHEALAYIKAIHQLVTWLGISDAIMAEGSFRCDCNVSIRKPGAELGTRTELKNLNSFRFI 249

Query: 247 GLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEI 306
             AI  E  RQI ILEDGG + Q T L+DP ++ETR +RTKEDA DYRYF +PDLLP+ I
Sbjct: 250 ERAINREIERQIDILEDGGKVVQATMLYDPERDETRVMRTKEDANDYRYFPDPDLLPVRI 309

Query: 307 DEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV---NRDKK 363
           ++  + +I+  +PELP A+R RF    G+S YDA +L   + IADYFE +       D K
Sbjct: 310 EQHTVDSIRAAMPELPVARRARFEEALGLSEYDARILTGSRQIADYFENVVAEVGQADAK 369

Query: 364 IVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG 423
           + ANWV+ DLLG LN+  K I D+PIS  QL  ++  I D T+SGK+AK +F+ L+E+ G
Sbjct: 370 MAANWVMGDLLGALNKDDKEITDSPISAKQLAGMLSRIKDDTLSGKLAKKVFSALYEREG 429

Query: 424 -----TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMK 477
                   +I+EE GL+Q TD  AI+ +V++VI  N   V      K    +  VGQVMK
Sbjct: 430 GDADDAADKIIEEKGLKQETDTGAIKAIVEDVIAKNAAMVEEYRGGKEKAFNGLVGQVMK 489

Query: 478 NTGGKANPSIVQKMLKEKLG 497
            + G ANP  V ++LKE LG
Sbjct: 490 ASRGSANPQQVNQILKELLG 509


>gi|296113804|ref|YP_003627742.1| aspartyl/glutamyl(asn/Gln)-tRNA amidotransferase subunit B
           [Moraxella catarrhalis RH4]
 gi|295921498|gb|ADG61849.1| aspartyl/glutamyl(asn/Gln)-tRNA amidotransferase subunit B
           [Moraxella catarrhalis RH4]
 gi|326564487|gb|EGE14713.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Moraxella
           catarrhalis 46P47B1]
          Length = 490

 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/480 (47%), Positives = 327/480 (68%), Gaps = 5/480 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +EVVIGIE+H QL+  SK+FS A   FG EPNTQ +  D   PG LP+LN   +++A+  
Sbjct: 11  YEVVIGIEIHCQLNTDSKIFSNAPTVFGQEPNTQATIVDLGFPGALPVLNAGVIERALKF 70

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           G+G+NA +  Y+ F RKNYFYPDLP+GYQI+Q   PIVGEG + + +   +  ++ T  +
Sbjct: 71  GMGVNAKLGTYNTFDRKNYFYPDLPKGYQITQMANPIVGEGYIDILVNAGQKDEY-TKRI 129

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+HD    ++ +DLNR+G  L+EIV++PDMRS  EA A++  +  ++
Sbjct: 130 GITRAHLEEDAGKSVHDAVPQMTGVDLNRAGTPLIEIVSEPDMRSVDEAVAYVKTIHELV 189

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
            +LG  D  M EGS RAD+NVSV +P   +GTRCE+KN+NS RF+  AI+ E  RQI ++
Sbjct: 190 TWLGISDAIMAEGSFRADINVSVHKPNTPFGTRCELKNLNSFRFIHRAIKSEIERQIDVI 249

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           EDGG + Q TRL+DP ++ETR++RTKE+A DYRYF +PDLLP+ I ++ +  ++  +PEL
Sbjct: 250 EDGGKVVQATRLYDPERDETRAMRTKEEANDYRYFPDPDLLPVIISDETLAKVRADMPEL 309

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEK---LAVNRDKKIVANWVINDLLGVLN 378
           P  ++ERF+ EFG++ YDA+VL   + ++DYF +   +    + KI ANWV+ +L G LN
Sbjct: 310 PSVRKERFVNEFGLTAYDANVLNGSRELSDYFLQVLDIIGKNNAKIAANWVMGELSGSLN 369

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++  +I+ +PIS  +L  LI  I+D TISGKIAK++F  LWE   +  EI+ E GL+Q T
Sbjct: 370 KNELTIDQSPISAKRLAGLIVRILDDTISGKIAKEVFGHLWESDKSADEIITEKGLKQET 429

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  AIE ++ +V+ +N   V      K    +  VGQVMK + GKANP+ V  +LK+ +G
Sbjct: 430 DTGAIEAIIVDVLANNQAMVDEYKGGKEKAFNGLVGQVMKASRGKANPAQVNALLKQMIG 489


>gi|326565669|gb|EGE15832.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Moraxella
           catarrhalis 12P80B1]
          Length = 490

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/480 (47%), Positives = 327/480 (68%), Gaps = 5/480 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +EVVIGIE+H QL+  SK+FS A   FG EPNTQ +  D   PG LP+LN   +++A+  
Sbjct: 11  YEVVIGIEIHCQLNTDSKIFSNAPTAFGQEPNTQATIVDLGFPGALPVLNEGVIERALKF 70

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           G+G+NA +  Y+ F RKNYFYPDLP+GYQI+Q   PIVGEG + + +   +  ++ T  +
Sbjct: 71  GMGVNAKLGTYNTFDRKNYFYPDLPKGYQITQMANPIVGEGYIDILVNAGQKDEY-TKRI 129

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+HD    ++ +DLNR+G  L+EIV++PDMRS  EA A++  +  ++
Sbjct: 130 GITRAHLEEDAGKSVHDAVPQMTGVDLNRAGTPLIEIVSEPDMRSVDEAVAYVKTIHELV 189

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
            +LG  D  M EGS RAD+NVSV +P   +GTRCE+KN+NS RF+  AI+ E  RQI ++
Sbjct: 190 TWLGISDAIMAEGSFRADINVSVHKPNTPFGTRCELKNLNSFRFIHRAIKSEIERQIDVI 249

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           EDGG + Q TRL+DP ++ETR++RTKE+A DYRYF +PDLLP+ I ++ +  ++  +PEL
Sbjct: 250 EDGGKVVQATRLYDPERDETRAMRTKEEANDYRYFPDPDLLPVIISDETLAKVRADMPEL 309

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEK---LAVNRDKKIVANWVINDLLGVLN 378
           P  ++ERF+ EFG++ YDA+VL   + ++DYF +   +    + KI ANWV+ +L G LN
Sbjct: 310 PSVRKERFVSEFGLTAYDANVLNGSRELSDYFLQVLDIIGKNNAKIAANWVMGELSGSLN 369

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++  +I+ +PIS  +L  LI  I+D TISGKIAK++F  LWE   +  EI+ E GL+Q T
Sbjct: 370 KNELTIDQSPISAKRLAGLIVRILDDTISGKIAKEVFGHLWESDKSADEIITEKGLKQET 429

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  AIE ++ +V+ +N   V      K    +  VGQVMK + GKANP+ V  +LK+ +G
Sbjct: 430 DTGAIEAIIVDVLANNQAMVDEYKGGKEKAFNGLVGQVMKASRGKANPAQVNALLKQMIG 489


>gi|256828112|ref|YP_003156840.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Desulfomicrobium
           baculatum DSM 4028]
 gi|256577288|gb|ACU88424.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfomicrobium
           baculatum DSM 4028]
          Length = 476

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 239/481 (49%), Positives = 322/481 (66%), Gaps = 11/481 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           D+EVVIG+EVHAQL   SK+F   S  FGA PN         MPGMLP+LN R V+ AV 
Sbjct: 3   DYEVVIGLEVHAQLKTKSKIFCSCSTQFGAGPNENTCPVCTGMPGMLPVLNARAVEYAVK 62

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
             + ++  +N+ S+FARKNYFYPDLP GYQISQ + P+   G + +     + G+ R   
Sbjct: 63  MAMAVDCTVNRRSLFARKNYFYPDLPMGYQISQFELPVAEHGHIVIHT---EKGEKR--- 116

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           +GI RIH+E DAGK+IH      S +DLNR+GV L+EIV++PDMRS+ EA A+L  LR+I
Sbjct: 117 IGITRIHMENDAGKNIHSATDNASYVDLNRAGVPLIEIVSEPDMRSAEEAVAYLKSLRAI 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRP--GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           L YLG CDGN+EEGS R D NVS+ RP   E +GTR E+KN+NS R +  AIEYE  RQI
Sbjct: 177 LVYLGICDGNLEEGSFRCDANVSI-RPRGQEEFGTRAELKNMNSFRNIQRAIEYEVERQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDG  + QETRLFD +K  TRS+R KE+A DYRYF +PDLLPL I E+ +   + ++
Sbjct: 236 DLVEDGEQVVQETRLFDTAKGVTRSMRGKEEAHDYRYFPDPDLLPLIIKEEQMVKWRGEL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVL 377
           PELP+A+  RF  E G+  YD+ VL ++K +ADYFE  LA   + K ++NWV+ +++  L
Sbjct: 296 PELPEARCRRFQEELGLPGYDSLVLTAEKEVADYFETALATYTEPKKISNWVMGEVMREL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N  G ++ +  +    L  L+ L+ DG +SG IAK++F  L+E GG P+  V+  GL Q+
Sbjct: 356 NDRGATLAECKLRAQDLARLVKLVDDGLVSGTIAKNVFKELFETGGDPEAYVKAKGLVQI 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D SAIE +VDEV+  NP+ V R       L  +FVGQVMK + GKANP +V ++L +KL
Sbjct: 416 SDTSAIEGLVDEVLAENPSEVERYKGGDKKLTGFFVGQVMKKSKGKANPGLVNQLLAKKL 475

Query: 497 G 497
           G
Sbjct: 476 G 476


>gi|326562149|gb|EGE12477.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Moraxella
           catarrhalis 7169]
          Length = 490

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 227/480 (47%), Positives = 326/480 (67%), Gaps = 5/480 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +EVVIGIE+H QL+  SK+FS A   FG EPNTQ +  D   PG LP+LN   +++A+  
Sbjct: 11  YEVVIGIEIHCQLNTDSKIFSNAPTAFGQEPNTQATIVDLGFPGALPVLNAGVIERALKF 70

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           G+G+NA +  Y+ F RKNYFYPDLP+GYQI+Q   PIVGEG + + +   +  ++ T  +
Sbjct: 71  GMGVNAKLGTYNTFDRKNYFYPDLPKGYQITQMANPIVGEGYIDILVNAGQKDEY-TKRI 129

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+HD    ++ +DLNR+G  L+EIV++PDMRS  EA A++  +  ++
Sbjct: 130 GITRAHLEEDAGKSVHDAVPQMTGVDLNRAGTPLIEIVSEPDMRSVDEAVAYVKTIHELV 189

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
            +LG  D  M EGS RAD+NVSV +P   +GTRCE+KN+NS RF+  AI+ E  RQI ++
Sbjct: 190 TWLGISDAIMAEGSFRADINVSVHKPNTPFGTRCELKNLNSFRFIHRAIKSEIERQIDVI 249

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           EDGG + Q TRL+DP ++ETR++RTKE+A DYRYF +PDLLP+ I ++ +  +   +PEL
Sbjct: 250 EDGGKVVQATRLYDPERDETRAMRTKEEANDYRYFPDPDLLPVIISDETLAKVCADMPEL 309

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEK---LAVNRDKKIVANWVINDLLGVLN 378
           P  ++ERF+ EFG++ YDA+VL   + ++DYF +   +    + KI ANWV+ +L G LN
Sbjct: 310 PSVRKERFVSEFGLTAYDANVLNGSRELSDYFLQVLDIIGKNNAKIAANWVMGELSGSLN 369

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++  +I+ +PIS  +L  LI  I+D TISGKIAK++F  LWE   +  EI+ E GL+Q T
Sbjct: 370 KNELTIDQSPISAKRLAGLIVRILDDTISGKIAKEVFGHLWESDKSADEIISEHGLKQET 429

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  AI+ ++ +V+ +N   V      K    +  VGQVMK + GKANP+ V  +LK+ +G
Sbjct: 430 DTEAIQAIIADVLANNQTMVDEYKGGKEKAFNGLVGQVMKASRGKANPAQVNALLKQMIG 489


>gi|163854729|ref|YP_001629027.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bordetella
           petrii DSM 12804]
 gi|229486043|sp|A9I0H0|GATB_BORPD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|163258457|emb|CAP40756.1| glutamyl-tRNA(GLN) amidotransferase subunit B [Bordetella petrii]
          Length = 485

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 240/488 (49%), Positives = 326/488 (66%), Gaps = 18/488 (3%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE+VIG+E H QLS  +K+FSG+S  FGA PNTQ +  D A+PG LP++N    ++A+ 
Sbjct: 2   NWEIVIGLETHTQLSTDAKIFSGSSTRFGAAPNTQANVIDLALPGSLPVMNRGAAERAIR 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL +   +   SVFARKNYFYPDLP+GYQISQ++ P+V  G +S  +G  +        
Sbjct: 62  FGLAVGGKVAPRSVFARKNYFYPDLPKGYQISQYELPVVLGGSLSFFVGEQEK------T 115

Query: 141 VGIERIHLEQDAGKSIHDQYS-----AVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
           V + R HLE+DAGKS+HD ++       S IDLNR+G  L+EIVT+P+MRS+ EA A+  
Sbjct: 116 VNLTRAHLEEDAGKSLHDDFALASGAPASGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAR 175

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEA 254
            L S++ +LG CDGNM+EGS R D NVSV   G+  +GTR E+KNVNS RFL  AI +EA
Sbjct: 176 ALHSLVVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRTEIKNVNSFRFLERAILFEA 235

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           RRQI ++EDGG + QETRL+D  ++ETRS+R+KEDA DYRYF +PDL PL I  +++  +
Sbjct: 236 RRQIELIEDGGTVVQETRLYDADRDETRSMRSKEDAHDYRYFPDPDLPPLVISPEWVEEV 295

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA---VNRDKKIVANWVIN 371
           +  +PELP A RERF  ++G+S YDA+ L + + +A YFE +A        K  ANW++ 
Sbjct: 296 RANMPELPAALRERFQRDYGLSAYDAAQLSASRGLASYFEDVARALPAGQAKQAANWIMG 355

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW--EKGGTPKEIV 429
           ++   LNR  K I D P+    L  LI  IIDGTIS KIA+D+F+ +W  E GG P  I+
Sbjct: 356 EVTATLNREEKDIADAPVQAPALAALIGRIIDGTISNKIARDVFSAMWAGEHGGQPDAII 415

Query: 430 EELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIV 488
           E  GL+Q++D  AI  ++DEV+ +NP  VA   A K    +  VGQ+MK   GKANP  V
Sbjct: 416 EARGLKQISDTGAIGAMIDEVLAANPAIVAEYRAGKQKAFNSLVGQIMKAAKGKANPQQV 475

Query: 489 QKMLKEKL 496
            ++LK+KL
Sbjct: 476 NELLKQKL 483


>gi|39998469|ref|NP_954420.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Geobacter
           sulfurreducens PCA]
 gi|47115631|sp|P61343|GATB_GEOSL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|39985416|gb|AAR36770.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacter
           sulfurreducens PCA]
          Length = 479

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 239/482 (49%), Positives = 323/482 (67%), Gaps = 12/482 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +++ VIG+EVH QL   +K+F G S  FGA PN+Q       MPG+LP+LN + V+ A+ 
Sbjct: 2   NYQAVIGLEVHVQLKTDTKIFCGCSTTFGASPNSQTCPVCLGMPGVLPVLNKKVVEFAIR 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL  N  I   SVFARKNYFYPDLP+GYQISQ++ PI   G + + +     GQ + I 
Sbjct: 62  AGLATNCRIAPRSVFARKNYFYPDLPKGYQISQYELPICQNGHLDIEV----DGQVKRI- 116

Query: 141 VGIERIHLEQDAGKSIHDQYSAV---SCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
            GI RIH+E+DAGK +H     +   S +DLNR+   L+EIV++PD+RS+ EA A+L KL
Sbjct: 117 -GITRIHMEEDAGKLVHADVPGLGSGSGVDLNRACTPLLEIVSEPDIRSADEAVAYLRKL 175

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARR 256
             I+ YLG CDGNMEEGS R D NVSV   G   +GTR E KNVNS RF+  AIE+E  R
Sbjct: 176 HQIVVYLGICDGNMEEGSFRCDANVSVMPVGSTTFGTRTETKNVNSFRFVKQAIEHEIER 235

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI ++E+GG + QETRLFDP+  ETRS+R KE+A DYRYF +PDL+PL I  D++   + 
Sbjct: 236 QIELIEEGGKVVQETRLFDPNTGETRSMRGKEEAHDYRYFPDPDLVPLVISNDWVEDTRL 295

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLG 375
            +PELPDA+R R+  E G+S YDA VL + + +A+YFE  LA     K  ANWV+ ++  
Sbjct: 296 SLPELPDARRSRYRSELGLSDYDAEVLTATREMAEYFENCLAAGAPAKGAANWVMGEVTR 355

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            LN +GK I + P++P +L  L+ LI  GTISGKIAK +F+ +W+    P+ IVEE GL 
Sbjct: 356 ALNEAGKDIAECPVAPARLTALLQLIEKGTISGKIAKTVFDEMWQSDKAPEAIVEEKGLV 415

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           QV+D  AIEK++DE++ +N   V      K  +  +FVGQVM+ + GKANP++V ++L +
Sbjct: 416 QVSDTGAIEKIIDEIMAANMGQVEEFRGGKEKVFGFFVGQVMRASKGKANPAVVNELLMK 475

Query: 495 KL 496
           KL
Sbjct: 476 KL 477


>gi|326566238|gb|EGE16390.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Moraxella
           catarrhalis 103P14B1]
 gi|326572275|gb|EGE22270.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Moraxella
           catarrhalis BC8]
 gi|326574873|gb|EGE24803.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Moraxella
           catarrhalis 101P30B1]
          Length = 490

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 227/480 (47%), Positives = 326/480 (67%), Gaps = 5/480 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +EVVIGIE+H QL+  SK+FS A   FG EPNTQ +  D   PG LP+LN   +++A+  
Sbjct: 11  YEVVIGIEIHCQLNTDSKIFSNAPTAFGQEPNTQATIVDLGFPGALPVLNEGVIERALKF 70

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           G+G+NA +  Y+ F RKNYFYPDLP+GYQI+Q   PIVG G + + +   +  ++ T  +
Sbjct: 71  GMGVNAELGTYNTFDRKNYFYPDLPKGYQITQMANPIVGRGYIDILVNAGQKDEY-TKRI 129

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+HD    ++ +DLNR+G  L+EIV++PDMRS  EA A++  +  ++
Sbjct: 130 GITRAHLEEDAGKSVHDAVPQMTGVDLNRAGTPLIEIVSEPDMRSVDEAVAYVKTIHELV 189

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
            +LG  D  M EGS RAD+NVSV +P   +GTRCE+KN+NS RF+  AI+ E  RQI ++
Sbjct: 190 TWLGISDAIMAEGSFRADINVSVHKPNTPFGTRCELKNLNSFRFIHRAIKSEIERQIDVI 249

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           EDGG + Q TRL+DP ++ETR++RTKE+A DYRYF +PDLLP+ I ++ +  ++  +PEL
Sbjct: 250 EDGGKVVQATRLYDPERDETRAMRTKEEANDYRYFPDPDLLPVIISDETLAKVRADMPEL 309

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEK---LAVNRDKKIVANWVINDLLGVLN 378
           P  ++ERF+ EFG++ YDA+VL   + ++DYF +   +    + KI ANWV+ +L G LN
Sbjct: 310 PSVRKERFVNEFGLTAYDANVLNGSRELSDYFLQVLDIIGKNNAKIAANWVMGELSGSLN 369

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++  +I+ +PIS  +L  LI  I+D TISGKIAK++F  LWE   +  EI+ E GL+Q T
Sbjct: 370 KNELTIDQSPISAKRLAGLIVRILDDTISGKIAKEVFGHLWESDKSADEIITEKGLKQET 429

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  AIE ++ +V+ +N   V      K    +  VGQVMK + GKANP+ V  +LK+ +G
Sbjct: 430 DTGAIEAIIVDVLANNQAMVDEYKGGKEKAFNGLVGQVMKASRGKANPAQVNALLKQMIG 489


>gi|188590843|ref|YP_001795443.1| aspartyl/glutamyl-tRNA amidotransferase subunit b [Cupriavidus
           taiwanensis LMG 19424]
 gi|229486064|sp|B2AG22|GATB_CUPTR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|170937737|emb|CAP62721.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Cupriavidus taiwanensis LMG
           19424]
          Length = 485

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 236/484 (48%), Positives = 331/484 (68%), Gaps = 9/484 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS  SK+FSG S  FGAE NTQ S  D A+PG+LP+LN   V++A+  
Sbjct: 3   WEVVIGLETHAQLSTASKIFSGTSTAFGAEANTQASPVDLALPGVLPVLNQGAVERAIQF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +   + G+F    V
Sbjct: 63  GLAIGATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGTITIQV-EGRKGEFYEKTV 121

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L S++
Sbjct: 122 NLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKALHSLV 181

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            +LG CDGNM+EGS R D NVSV   G+  +GTR E+KN+NS RFL  AIEYE + QIA 
Sbjct: 182 VWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRREIKNLNSFRFLQQAIEYEVQWQIAE 241

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDG  I+Q T LFDP   ETR++RTKEDA DYRYF +PDL+PLEI+  ++  ++  +PE
Sbjct: 242 IEDGRKIQQATVLFDPDTGETRAMRTKEDAHDYRYFPDPDLMPLEIEPAWVERVRDALPE 301

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVINDLLGVL 377
           LP A + RF+ ++G+S YDA+ L + K+ A Y+E +  +    + K  ANW++ D+   L
Sbjct: 302 LPAAMQARFVSQYGLSAYDATTLTATKAFAAYYEAVVADAGAANAKPAANWLMGDVSSQL 361

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEELGL 434
           NR G +I+D P+ P QL +L+  I DGT+S   A KD+F  +W  E  G    I+   GL
Sbjct: 362 NREGIAIDDAPVRPAQLAKLLARIADGTVSNNTAKKDVFPAMWAGEHDGDADAIIAAKGL 421

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           +Q++D   +EK++D+V+ +N  +V    + K    +  VGQ MK T GKANP+ V ++L+
Sbjct: 422 KQMSDSGELEKIIDDVLAANAKSVEEFRSGKEKAFNALVGQAMKATRGKANPAQVNELLR 481

Query: 494 EKLG 497
           +KLG
Sbjct: 482 KKLG 485


>gi|33591599|ref|NP_879243.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bordetella
           pertussis Tohama I]
 gi|47115740|sp|Q7VSN3|GATB_BORPE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|33571242|emb|CAE44703.1| glutamyl-tRNA(GLN) amidotransferase subunit B [Bordetella pertussis
           Tohama I]
 gi|332380999|gb|AEE65846.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bordetella
           pertussis CS]
          Length = 484

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 244/489 (49%), Positives = 332/489 (67%), Gaps = 18/489 (3%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE+VIG+E H QLS  SK+FSG+S  FGA PNTQ +  D A+PG LP++N    ++A++
Sbjct: 2   NWEIVIGLETHTQLSTDSKIFSGSSTRFGAAPNTQANAVDLALPGSLPVMNRGAAERAIL 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL +   +   SVFARKNYFYPDLP+GYQISQ++ P+V  G +S  +G ++        
Sbjct: 62  FGLAVGGKVAPRSVFARKNYFYPDLPKGYQISQYELPVVEGGTLSFFVGEEEK------T 115

Query: 141 VGIERIHLEQDAGKSIHDQYS-----AVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
           V + R HLE+DAGKS+HD++S       S IDLNR+G  L+EIVT+P+MRS+ EA A+  
Sbjct: 116 VNLTRAHLEEDAGKSLHDEFSLASGAPASGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAR 175

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEA 254
            L S++ +LG CDGNM+EGS R D NVSV   G+  +GTR E+KNVNS RFL  AI +EA
Sbjct: 176 ALHSLVVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRTEIKNVNSFRFLERAILFEA 235

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           RRQI ++EDGG + QETRL+D  ++ETRS+R+KEDA DYRYF +PDL PL I +D+I A+
Sbjct: 236 RRQIELIEDGGTVVQETRLYDADRDETRSMRSKEDAHDYRYFPDPDLPPLVIGQDWIDAV 295

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA---VNRDKKIVANWVIN 371
           +  +PELP A+R RF  ++G+  YDA+ L   +++ADYFE +A        K+ ANW++ 
Sbjct: 296 RAGMPELPAAQRARFEADYGLPAYDAAQLTVSRAMADYFEAVARALPAGQAKLAANWIMG 355

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW--EKGGTPKEIV 429
           ++   LNR  K I+  P+S   L  LI+ IIDGTIS KIA+D+F  +W  E GG    I+
Sbjct: 356 EVAATLNREEKDIDAAPVSAAALAALINRIIDGTISNKIARDVFAAMWAGENGGDADAII 415

Query: 430 EELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIV 488
           E  GL+Q++D  AI  ++DEV+ +NP  V    A K    +  VGQ+MK   GKANP  V
Sbjct: 416 EARGLKQISDSGAIGAMIDEVLAANPAIVEEYRAGKQKAFNSLVGQIMKAAKGKANPQQV 475

Query: 489 QKMLKEKLG 497
            ++LKEKLG
Sbjct: 476 NELLKEKLG 484


>gi|110833388|ref|YP_692247.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Alcanivorax
           borkumensis SK2]
 gi|123149688|sp|Q0VS73|GATB_ALCBS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|110646499|emb|CAL15975.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Alcanivorax
           borkumensis SK2]
          Length = 479

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 237/486 (48%), Positives = 324/486 (66%), Gaps = 21/486 (4%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE+VIG+EVH QL+  SKLFSG+ ++ GAEPNTQ S  D  +PG LP++N   V++A + 
Sbjct: 3   WEIVIGLEVHVQLNTASKLFSGSKLSTGAEPNTQASLVDLGLPGTLPVVNREAVRKAALF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL ++A I ++SVF RKNYFYPDLP+GYQ +Q  +PIVG G V + +    +G+ ++I  
Sbjct: 63  GLAIDADICRHSVFERKNYFYPDLPKGYQTTQLAEPIVGAGTVEIQL---DNGEKKSIR- 118

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            I   HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDM ++ EA AF  KL +I+
Sbjct: 119 -IHHAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLIEIVSEPDMANAEEAVAFARKLHAIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
             +G CDG+M +G+MR DVN+SV +PGE  GTR E KN+NS RF+  AI  E  RQI +L
Sbjct: 178 TSIGICDGDMSQGNMRFDVNISVRKPGEPLGTRTETKNLNSFRFMEKAIALEVERQIDVL 237

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           EDGG I QETRL++   +  RS+R+KEDA DYRYF  PDLLP+ I +  I  +K  +PEL
Sbjct: 238 EDGGEIVQETRLYNGDTHTARSMRSKEDANDYRYFPCPDLLPVAITDADIEELKAAMPEL 297

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR---DKKIVANWVINDLLGVLN 378
           PD+++ RF  ++ +S YDA +L    SIA      A  +   D K+ ANWV+ +L   LN
Sbjct: 298 PDSRKARFTNDYQLSEYDADLLSG--SIATAAFFEAAAKSGGDAKLAANWVMGELAAKLN 355

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
              KSI D+P+S  QLG+LI  + DGTIS KIAK +F   W   G P EI+E  GL+Q++
Sbjct: 356 AEEKSITDSPVSAEQLGQLIARLKDGTISSKIAKQVFEACWAGEGNPDEIIEAKGLKQMS 415

Query: 439 DLSAIEKVVDEVINSNPNNVARI--------ATKPNLVSWFVGQVMKNTGGKANPSIVQK 490
           D   +EK+VD++I    NN A+         A K   + +FVGQ MK T GKANP  + K
Sbjct: 416 DTGELEKIVDDII---ANNAAQADDYRNSDDAKKKKKIGFFVGQAMKATQGKANPQQLNK 472

Query: 491 MLKEKL 496
           +L+EKL
Sbjct: 473 LLQEKL 478


>gi|311109324|ref|YP_003982177.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           subunit B [Achromobacter xylosoxidans A8]
 gi|310764013|gb|ADP19462.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Achromobacter xylosoxidans A8]
          Length = 485

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 237/488 (48%), Positives = 322/488 (65%), Gaps = 18/488 (3%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE+VIG+E H QLS  SK+FSG+S  FGA PNT  +  D A+PG LP++N    ++A+ 
Sbjct: 2   NWEIVIGLETHTQLSTDSKIFSGSSTEFGAAPNTHANVVDLALPGSLPVMNRGAAERAIR 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL + A I   SVFARKNYFYPDLP+GYQISQ++ P+V  G +S  +G ++        
Sbjct: 62  FGLAVGATIAPRSVFARKNYFYPDLPKGYQISQYELPVVVGGSLSFFVGEEEK------T 115

Query: 141 VGIERIHLEQDAGKSIHDQY-----SAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
           V + R HLE+DAGKS+HD +     +  S IDLNR+G  L+EIVT+P+MRS+ EA ++  
Sbjct: 116 VNLTRAHLEEDAGKSLHDDFNLANGAPASGIDLNRAGTPLLEIVTEPEMRSAAEAVSYAR 175

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEA 254
            L S++ +LG CDGNM+EGS R D NVSV   G+  +GTR E+KNVNS RFL  AI YEA
Sbjct: 176 ALHSLVVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRTEIKNVNSFRFLERAIVYEA 235

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           RRQI ++EDGG + QETRL+D  ++ETRS+R+KEDA DYRYF +PDL  L I   ++  +
Sbjct: 236 RRQIELIEDGGTVVQETRLYDADRDETRSMRSKEDAHDYRYFPDPDLPTLVISSAWVDEV 295

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA---VNRDKKIVANWVIN 371
           +  +PELP A+R RF  E+G+  YDA+ L   + +A YFE +A        K+ ANWV+ 
Sbjct: 296 RAAMPELPAAQRARFESEYGLPAYDAAQLTVSRDLAAYFEAVAHALPAGQAKLAANWVMG 355

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW--EKGGTPKEIV 429
           ++   LN+  KSI D+P+    L  LI  IIDGTIS KIA+++F  +W  E GG    I+
Sbjct: 356 EVSAALNKDEKSIADSPVQAPALAALIGRIIDGTISNKIAREVFGAMWAGENGGQADAII 415

Query: 430 EELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIV 488
           +  GL+Q++D  AI  ++DEV+ +NP  V    A K    +  VGQ+MK   GKANP  V
Sbjct: 416 DARGLKQISDTGAIGAMIDEVLAANPAIVEEYRAGKQKAFNSLVGQIMKAARGKANPQQV 475

Query: 489 QKMLKEKL 496
             +LK+KL
Sbjct: 476 NDLLKQKL 483


>gi|74316275|ref|YP_314015.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Thiobacillus
           denitrificans ATCC 25259]
 gi|109892076|sp|Q3SM40|GATB_THIDA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|74055770|gb|AAZ96210.1| glutamyl-tRNA(Gln) amidotransferase B subunit [Thiobacillus
           denitrificans ATCC 25259]
          Length = 475

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 241/478 (50%), Positives = 329/478 (68%), Gaps = 9/478 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+EVH QL+  SK+FS +S  FGA PNTQ S  D A+PG+LP+LN   V+ A+  
Sbjct: 3   WETVIGLEVHTQLATQSKIFSASSTAFGAAPNTQASAVDIALPGVLPVLNKAAVECAIKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A +N+ +VF RKNYFYPDLP+GYQISQ  KPIV  G +++ +     G  +TI  
Sbjct: 63  GLAIGATLNRVNVFDRKNYFYPDLPKGYQISQLAKPIVEGGALTIVV----DGVEKTIH- 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R H+E+DAGKS+H+ +  ++ IDLNR+G  L+EIV++P+MRSS EA A+   L +++
Sbjct: 118 -LTRAHMEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSEPEMRSSAEAVAYARALHTLV 176

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            ++G CDGNM+EGS R D NVSV   G+A +GTR E+KN+NS RFL  AI+YE R QI  
Sbjct: 177 TWIGICDGNMQEGSFRVDANVSVRPLGQAEFGTRREIKNLNSFRFLQQAIDYEVRWQIET 236

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LEDGG I+Q T LFDP   ETR +R+KE+A DYRYF +PDLLP+++DE +I A++  +PE
Sbjct: 237 LEDGGRIQQATVLFDPDTGETRMMRSKEEAHDYRYFPDPDLLPVKLDEAWIDAVRTTLPE 296

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDLLGVLNR 379
           LP A R RF  ++G+S YDASVL   +++A YFE  A    + K+ ANWV+ +L   LN+
Sbjct: 297 LPAAMRTRFQQDYGVSAYDASVLTGSRALAAYFEAAAQQSGQPKLAANWVMGELSAALNK 356

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           +   I ++P+S  QLG LI  I DGT+SGK+AK +F  LWE  G    I+   GL+Q++D
Sbjct: 357 AELDIGESPVSAVQLGTLITRIQDGTLSGKLAKQVFEGLWEGAGDVDGIIAARGLKQMSD 416

Query: 440 LSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
              +EK+VDEV+ +N  +V    A K    +  VGQVMK + GKANP+ V ++LK KL
Sbjct: 417 AGELEKIVDEVLAANQKSVEEFRAGKDKAFNALVGQVMKASRGKANPAQVNELLKAKL 474


>gi|33598560|ref|NP_886203.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bordetella
           parapertussis 12822]
 gi|47115742|sp|Q7W3H6|GATB_BORPA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|33574689|emb|CAE39342.1| glutamyl-tRNA(GLN) amidotransferase subunit B [Bordetella
           parapertussis]
          Length = 484

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 242/489 (49%), Positives = 331/489 (67%), Gaps = 18/489 (3%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE+VIG+E H QLS  SK+FSG+S  FGA PNTQ +  D A+PG LP++N    ++A++
Sbjct: 2   NWEIVIGLETHTQLSTDSKIFSGSSTRFGAAPNTQANAVDLALPGSLPVMNRGAAERAIL 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL +   +   SVFARKNYFYPDLP+GYQISQ++ P+V  G +S  +G ++        
Sbjct: 62  FGLAVGGKVAPRSVFARKNYFYPDLPKGYQISQYELPVVEGGTLSFFVGEEEK------T 115

Query: 141 VGIERIHLEQDAGKSIHDQYS-----AVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
           V + R HLE+DAGKS+HD++S       S IDLNR+G  L+EIVT+P+MRS+ EA A+  
Sbjct: 116 VNLTRAHLEEDAGKSLHDEFSLASGAPASGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAR 175

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEA 254
            L S++ +LG CDGNM+EGS R D NVSV   G+  +GTR E+KNVNS RFL  AI +EA
Sbjct: 176 ALHSLVVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRTEIKNVNSFRFLERAILFEA 235

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           RRQI ++EDGG + QETRL+D  ++ETRS+R+KEDA DYRYF +PDL PL I +D++ A+
Sbjct: 236 RRQIELIEDGGTVVQETRLYDADRDETRSMRSKEDAHDYRYFPDPDLPPLVIGQDWVDAV 295

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA---VNRDKKIVANWVIN 371
           +  +PELP A+R RF  ++G+  YDA+ L   +++ADYFE +A        K+ ANW++ 
Sbjct: 296 RAGMPELPTAQRARFEADYGLPAYDAAQLTVSRAMADYFEAVARALPAGQAKLAANWIMG 355

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW--EKGGTPKEIV 429
           ++   LNR  K I+  P+S   L  LI+ IIDGTIS KIA+D+F  +W  E GG    I+
Sbjct: 356 EVAATLNREEKDIDAAPVSAAALATLINRIIDGTISNKIARDVFAAMWAGENGGDADAII 415

Query: 430 EELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIV 488
              GL+Q++D  AI  ++DEV+ +NP  V    A K    +  VGQ+MK   GKANP  V
Sbjct: 416 AARGLKQISDSGAIGAMIDEVLAANPAIVEEYRAGKQKAFNSLVGQIMKAAKGKANPQQV 475

Query: 489 QKMLKEKLG 497
            ++LKEKLG
Sbjct: 476 NELLKEKLG 484


>gi|332977671|gb|EGK14439.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Psychrobacter sp.
           1501(2011)]
          Length = 506

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 239/497 (48%), Positives = 331/497 (66%), Gaps = 14/497 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           R E L  G    +EVVIGIE+H QL+  SK+FS +S  FG EPNTQ S  D  +PG+LP+
Sbjct: 15  RKELLIDG----YEVVIGIEIHCQLNTESKIFSSSSTKFGNEPNTQASIVDLGLPGVLPV 70

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           LN   +++A+  G+G+NA +   + F RKNYFYPDLP+GYQI+Q   PIVG+G + + + 
Sbjct: 71  LNAGLIERALKFGIGVNAELGMLNTFDRKNYFYPDLPKGYQITQMANPIVGKGYIDIVVN 130

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
             +  ++    +GI R HLE+DAGKS+HD  + ++ IDLNR+G  L+EIV++PDMRSS E
Sbjct: 131 EGEKNEYGK-RIGITRGHLEEDAGKSVHDAVAGMTGIDLNRAGTPLIEIVSEPDMRSSKE 189

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           A A++  +  ++ +L   D  M EGS R D NVSV +PGE +GTR E+KN+NS R +  A
Sbjct: 190 AVAYIKAIHQLVTWLDISDAIMAEGSFRCDCNVSVRQPGEEFGTRTELKNLNSFRNIENA 249

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           I  E  RQI I+EDGG + Q T L+DP+ +ETR +RTKEDA DYRYF +PDLLP+ I+++
Sbjct: 250 INREIERQIDIIEDGGQVIQATMLYDPANDETRIMRTKEDADDYRYFPDPDLLPIRIEQE 309

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL---AVNRDKKIVA 366
            + AI+K +PELP A+R RF   FG+S YDA +L   + +ADYFE +     +   K+ A
Sbjct: 310 TVEAIRKSMPELPVARRARFEEAFGLSEYDARILTDSRELADYFEAVLESVGSEHAKLTA 369

Query: 367 NWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTP 425
           NW++ DLLG LN+  K+I D+PIS  QL  L+  + D T+SGK+AK +F  L++ +GGT 
Sbjct: 370 NWIMGDLLGALNKDDKTITDSPISEVQLAGLLKRLNDNTLSGKLAKQVFTALYDGEGGTD 429

Query: 426 KE----IVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTG 480
            +    I+E  GL+Q TD  AI+ +V+EVI +N   V      K    +  VGQVMK + 
Sbjct: 430 ADAADKIIEAKGLKQETDTGAIKAMVEEVIANNQAMVDEYKGGKEKAFNGLVGQVMKASR 489

Query: 481 GKANPSIVQKMLKEKLG 497
           GKANP  V ++LKE LG
Sbjct: 490 GKANPQQVNQILKEILG 506


>gi|33603506|ref|NP_891066.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bordetella
           bronchiseptica RB50]
 gi|47115745|sp|Q7WEV0|GATB_BORBR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|33577630|emb|CAE34895.1| glutamyl-tRNA(GLN) amidotransferase subunit B [Bordetella
           bronchiseptica RB50]
          Length = 484

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 242/489 (49%), Positives = 331/489 (67%), Gaps = 18/489 (3%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE+VIG+E H QLS  SK+FSG+S  FGA PNTQ +  D A+PG LP++N    ++A++
Sbjct: 2   NWEIVIGLETHTQLSTDSKIFSGSSTRFGAAPNTQANAVDLALPGSLPVMNRGAAERAIL 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL +   +   SVFARKNYFYPDLP+GYQISQ++ P+V  G +S  +G ++        
Sbjct: 62  FGLAVGGKVAPRSVFARKNYFYPDLPKGYQISQYELPVVEGGTLSFFVGEEEK------T 115

Query: 141 VGIERIHLEQDAGKSIHDQYS-----AVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
           V + R HLE+DAGKS+HD++S       S IDLNR+G  L+EIVT+P+MRS+ EA A+  
Sbjct: 116 VNLTRAHLEEDAGKSLHDEFSLASGAPASGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAR 175

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEA 254
            L S++ +LG CDGNM+EGS R D NVSV   G+  +GTR E+KNVNS RFL  AI +EA
Sbjct: 176 ALHSLVVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRTEIKNVNSFRFLERAILFEA 235

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           RRQI ++EDGG + QETRL+D  ++ETRS+R+KEDA DYRYF +PDL PL I +D++ A+
Sbjct: 236 RRQIELIEDGGTVVQETRLYDADRDETRSMRSKEDAHDYRYFPDPDLPPLVIGQDWVDAV 295

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA---VNRDKKIVANWVIN 371
           +  +PELP A+R RF  ++G+  YDA+ L   +++ADYFE +A        K+ ANW++ 
Sbjct: 296 RAGMPELPAAQRARFEADYGLPAYDAAQLTVSRAMADYFEAVARALPAGQAKLAANWIMG 355

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW--EKGGTPKEIV 429
           ++   LNR  K I+  P+S   L  LI+ IIDGTIS KIA+D+F  +W  E GG    I+
Sbjct: 356 EVAATLNREEKDIDAAPVSAAALAALINRIIDGTISNKIARDVFAAMWAGENGGDADAII 415

Query: 430 EELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIV 488
              GL+Q++D  AI  ++DEV+ +NP  V    A K    +  VGQ+MK   GKANP  V
Sbjct: 416 AARGLKQISDSGAIGAMIDEVLAANPAIVEEYRAGKQKAFNSLVGQIMKAAKGKANPQQV 475

Query: 489 QKMLKEKLG 497
            ++LKEKLG
Sbjct: 476 NELLKEKLG 484


>gi|332285650|ref|YP_004417561.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pusillimonas sp.
           T7-7]
 gi|330429603|gb|AEC20937.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pusillimonas sp.
           T7-7]
          Length = 484

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 242/489 (49%), Positives = 326/489 (66%), Gaps = 18/489 (3%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE+VIG+E HAQLS  SK+FS +S  +GAE NTQ +  D A+PG LP++N   V++A+ 
Sbjct: 2   EWEIVIGLETHAQLSTESKIFSDSSTRYGAEANTQANEVDMALPGSLPVMNKGAVERAIR 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL L +HI   S+FARKNYFYPDLP+ YQISQ + P+V  G ++  +     G+ +T  
Sbjct: 62  LGLALGSHIAPRSIFARKNYFYPDLPKNYQISQFEIPVVQGGSITFFV----DGEEKT-- 115

Query: 141 VGIERIHLEQDAGKSIHDQYS-----AVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
           V + R HLE+DAGKS+H+ +      + + IDLNR+G  L+EIV++P+MRS+ EA A+  
Sbjct: 116 VNLTRAHLEEDAGKSLHENFKGPHGESSTGIDLNRAGTPLLEIVSEPEMRSAAEAVAYAR 175

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-AWGTRCEVKNVNSIRFLGLAIEYEA 254
            L  ++ +LG CDGNM+EGS R D NVSV R G+   GTR EVKNVNS RFL  AI YEA
Sbjct: 176 ALHGLVVWLGICDGNMQEGSFRCDANVSVRRKGDPVLGTRSEVKNVNSFRFLERAILYEA 235

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           RRQI ++EDGG + QETRL+D   +ETRS+R+KEDA DYRYF +PDL PL I  +++  +
Sbjct: 236 RRQIELIEDGGTVVQETRLYDSDLDETRSMRSKEDAHDYRYFPDPDLPPLVIAPEWVERV 295

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK---KIVANWVIN 371
           K  +PELP  KR RF  + G+S YDA+ L   ++ ADYFE +A    +   K+ ANWV+ 
Sbjct: 296 KADMPELPAQKRARFEQDMGLSAYDAAQLTMSRASADYFESVAAQLPQGQAKLAANWVLG 355

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW--EKGGTPKEIV 429
           +    LNR    I+ +P++P QL  LI  IIDGTIS K+A+D+FN +W  E  G P  I+
Sbjct: 356 EFSAALNREELDIDQSPVTPAQLAALIARIIDGTISNKMARDVFNAMWAGEHEGQPDAII 415

Query: 430 EELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIV 488
           E  GL+Q++D  AI  ++DEV+ ++P  V    A K    +  VGQVMK   GKANP  V
Sbjct: 416 EARGLKQISDSGAIGAMIDEVLAAHPAIVEEYRAGKQKAFNSLVGQVMKAAKGKANPQQV 475

Query: 489 QKMLKEKLG 497
             +LKEKL 
Sbjct: 476 NDLLKEKLA 484


>gi|71065050|ref|YP_263777.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Psychrobacter
           arcticus 273-4]
 gi|109892051|sp|Q4FUG5|GATB_PSYA2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|71038035|gb|AAZ18343.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Psychrobacter arcticus 273-4]
          Length = 509

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 238/499 (47%), Positives = 322/499 (64%), Gaps = 14/499 (2%)

Query: 7   HVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGM 66
           H  R E    G    +EVVIGIE+H QL+  SK+FS A  +FG EPNTQ S  D  +PG+
Sbjct: 15  HDVRPELFVDG----YEVVIGIEIHCQLNTESKIFSSAPTDFGHEPNTQASIVDLGLPGV 70

Query: 67  LPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSV 126
           LP+LN   V +A+  G+G+NA +  ++ F RKNYFYPDLP+GYQI+Q   PIVGEG + V
Sbjct: 71  LPVLNAGVVDRALKFGIGVNAELGLFNTFDRKNYFYPDLPKGYQITQMANPIVGEGYIDV 130

Query: 127 SIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRS 186
            +   +  ++    +GI R HLE+DAGKS+HD    ++ +DLNR+G  L+EIV++PDMRS
Sbjct: 131 VVNEGEKNEYPK-RMGITRAHLEEDAGKSVHDAVDGMTGVDLNRAGTPLIEIVSEPDMRS 189

Query: 187 SLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFL 246
           + EA A++  +  ++ +LG  D  M EGS R D NVS+ +PG   GTR E+KN+NS RF+
Sbjct: 190 AHEALAYIKAIHQLVTWLGISDAIMAEGSFRCDCNVSIRKPGAELGTRTELKNLNSFRFI 249

Query: 247 GLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEI 306
             AI  E  RQI ILEDGG + Q T L+DP ++ETR +RTKEDA DYRYF +PDLLP+ I
Sbjct: 250 ERAINREIERQIDILEDGGKVVQATMLYDPERDETRVMRTKEDANDYRYFPDPDLLPVRI 309

Query: 307 DEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV---NRDKK 363
           ++  + +I+  +PELP A+R RF    G+S YDA +L   + IADYFE +      +D K
Sbjct: 310 EQLTVDSIRAAMPELPVARRARFEEALGLSEYDARILTGSRQIADYFEDVVAEIDQQDAK 369

Query: 364 IVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK-- 421
           + ANWV+ DLLG LN+  K I D+PIS  QL  ++  I D T+SGK+AK +F  L+E+  
Sbjct: 370 MAANWVMGDLLGALNKDDKDIIDSPISAKQLAGMLARIKDDTLSGKLAKKVFGALYERAG 429

Query: 422 ---GGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMK 477
                   +I+EE GL+Q TD  AI+ +V+EVI  N   V      K    +  VGQVMK
Sbjct: 430 GDADDAADKIIEEKGLKQETDTGAIKAIVEEVIAKNTAMVEEYRGGKEKAFNGLVGQVMK 489

Query: 478 NTGGKANPSIVQKMLKEKL 496
            + G ANP  V ++LKE L
Sbjct: 490 ASRGSANPQQVNQILKELL 508


>gi|317401345|gb|EFV81982.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Achromobacter xylosoxidans C54]
          Length = 485

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 239/488 (48%), Positives = 323/488 (66%), Gaps = 18/488 (3%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WE+VIG+E H QLS  SK+FSG+S  FGA PNT  +  D A+PG LP++N    ++A+ 
Sbjct: 2   NWEIVIGLETHTQLSTDSKIFSGSSTEFGAAPNTHANEVDLALPGSLPVMNRGAAERAIR 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL + A I   SVFARKNYFYPDLP+GYQISQ++ P+V  G +S  +G ++        
Sbjct: 62  FGLAVGAEIAPRSVFARKNYFYPDLPKGYQISQYELPVVVGGSLSFFVGEEEK------T 115

Query: 141 VGIERIHLEQDAGKSIHDQY-----SAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
           V + R HLE+DAGKS HD +     S  S IDLNR+G  L+EIVT+P+MRS+ EA A+  
Sbjct: 116 VNLTRAHLEEDAGKSSHDNFALANGSPASGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAR 175

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEA 254
            L S++ +LG CDGNM+EGS R D NVSV   G+  +GTR E+KNVNS RFL  AI YEA
Sbjct: 176 ALHSLVVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRTEIKNVNSFRFLERAITYEA 235

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           RRQI ++EDGG + QETRL+D  ++ETRS+R+KEDA DYRYF +PDL  L I  +++  +
Sbjct: 236 RRQIELIEDGGTVVQETRLYDADRDETRSMRSKEDAHDYRYFPDPDLPTLVISREWVDEV 295

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA---VNRDKKIVANWVIN 371
           +  +PELP A+R RF  E+G+  YDA+ L   + +A YFE +A        K+ ANW++ 
Sbjct: 296 RAAMPELPAAQRARFESEYGLPAYDAAQLTVSRDLAAYFEAVAHALPAGQAKLAANWIMG 355

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW--EKGGTPKEIV 429
           ++   LN+  K+I D P+    L  LI+ IIDGTIS KIA+++F  +W  E GG P  I+
Sbjct: 356 EVAATLNKEEKAIADAPVQAPALAALINRIIDGTISNKIAREVFGAMWAGENGGQPDAII 415

Query: 430 EELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIV 488
           E  GL+Q++D  AI  ++DEV+ +NP  V    A K    +  VGQ+MK   GKANP  V
Sbjct: 416 EARGLKQISDSGAIGAMIDEVLAANPAIVEEYRAGKQKAFNSLVGQIMKAARGKANPQQV 475

Query: 489 QKMLKEKL 496
             +LK+KL
Sbjct: 476 NDLLKQKL 483


>gi|298507413|gb|ADI86136.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Geobacter sulfurreducens KN400]
          Length = 479

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 236/482 (48%), Positives = 321/482 (66%), Gaps = 12/482 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +++ VIG+EVH QL   +K+F G S  FGA PN+Q       MPG+LP+LN + V+ A+ 
Sbjct: 2   NYQAVIGLEVHVQLKTDTKIFCGCSTTFGAAPNSQTCPVCLGMPGVLPVLNKKVVEFAIR 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL  N  I   SVFARKNYFYPDLP+GYQISQ++ PI   G + + +      +  T  
Sbjct: 62  AGLATNCRIAPRSVFARKNYFYPDLPKGYQISQYELPICQNGHLDIEV------EGETKR 115

Query: 141 VGIERIHLEQDAGKSIHDQYSAV---SCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
           +GI RIH+E+DAGK +H     +   S +DLNR+   L+EIV++PD+RS+ EA A+L KL
Sbjct: 116 IGITRIHMEEDAGKLVHADVPGLGSGSGVDLNRACTPLLEIVSEPDIRSADEAVAYLRKL 175

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARR 256
             I+ YLG CDGNMEEGS R D NVSV   G   +GTR E KNVNS RF+  AIE+E  R
Sbjct: 176 HQIVVYLGICDGNMEEGSFRCDANVSVMPVGSTTFGTRTETKNVNSFRFVKQAIEHEIER 235

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI ++E+GG + QETRLFDP+  ETRS+R KE+A DYRYF +PDL+PL I  D++   + 
Sbjct: 236 QIELIEEGGKVVQETRLFDPNTGETRSMRGKEEAHDYRYFPDPDLVPLVISNDWVEDARL 295

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLG 375
            +PELPDA+R R+  E G+S YDA VL + + +A+YFE  LA     K  ANWV+ ++  
Sbjct: 296 SLPELPDARRSRYRSELGLSDYDAEVLTATREMAEYFEACLAAGAPAKGAANWVMGEVTR 355

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            LN +G  I +  ++P +L  L+ LI  GTISGKIAK +F+ +W+   TP+ IVEE GL 
Sbjct: 356 ALNEAGTGIAECLVTPARLTALLQLIEKGTISGKIAKTVFDEMWQSDKTPEAIVEEKGLV 415

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           QV+D  AIEK++DE++ +N   V      K  +  +FVGQVM+ + GKANP++V ++L +
Sbjct: 416 QVSDTGAIEKIIDEIMAANMGQVEEFRGGKEKVFGFFVGQVMRASKGKANPAVVNELLMK 475

Query: 495 KL 496
           KL
Sbjct: 476 KL 477


>gi|261377507|ref|ZP_05982080.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Neisseria cinerea ATCC 14685]
 gi|269146242|gb|EEZ72660.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Neisseria cinerea ATCC 14685]
          Length = 476

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 236/480 (49%), Positives = 325/480 (67%), Gaps = 10/480 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+H QL+  SK+FSGAS  FGAEPN   S  + A+PG+LP++N   V++A+  
Sbjct: 3   WETVIGLEIHVQLNTKSKIFSGASTAFGAEPNAHASVVECALPGVLPVMNREVVEKAIKL 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL L+A IN+ +VF RKNYFYPDLP+GYQISQ D PIV  GK+ + +G D     +TI V
Sbjct: 63  GLALDAKINQKNVFDRKNYFYPDLPKGYQISQLDLPIVEHGKLEIVVGDD----VKTINV 118

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
              R H+E+DAGKS+H+  +  + IDLNR+G  L+E+V++P+MRS+ EA A+   L S++
Sbjct: 119 --TRAHMEEDAGKSVHEGLNGATGIDLNRAGTPLLEVVSEPEMRSAAEAVAYAKALHSLV 176

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            +L  CDGNM EGS R D NVSV   G+A +GTR E+KN+NS RFL  AI YE   QI I
Sbjct: 177 TWLDICDGNMAEGSFRVDANVSVRPKGQAEFGTRREIKNLNSFRFLEQAINYEVEAQIEI 236

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LEDGG ++Q T LFDP K ETR +R KEDA DYRYF +PDLLP+ I +D ++  K ++PE
Sbjct: 237 LEDGGKVQQATMLFDPEKGETRVMRLKEDAHDYRYFPDPDLLPVIISDDRLQKAKAEMPE 296

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDLLGVLNR 379
           LP     RF+ ++G+S YDA +L + ++ A YFE+ A    + K+ ANW+  +L   LN+
Sbjct: 297 LPKEMAARFVADYGVSDYDARLLTTGRAQAAYFEEAAKESGQGKLTANWMNGELAATLNK 356

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW-EKGGTPKEIVEELGLRQVT 438
            G  + D+PI+  +L  L+  I DGT+S K+AK  F  +W E   T  EI+E+ GL+Q+T
Sbjct: 357 EGMELADSPITAPRLAALVGKIADGTLSSKLAKKAFEAMWAEPEATIAEIIEKHGLQQMT 416

Query: 439 DLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  AIE +VDEV+ +N   V +  +     ++  VGQVMK + GKANP+ VQ+++K KL 
Sbjct: 417 DTGAIEAMVDEVLANNAKAVEQFKSGNEKALNAIVGQVMKASKGKANPAQVQELIKAKLA 476


>gi|303256314|ref|ZP_07342330.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Burkholderiales bacterium 1_1_47]
 gi|330999009|ref|ZP_08322734.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Parasutterella excrementihominis YIT 11859]
 gi|302861043|gb|EFL84118.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Burkholderiales bacterium 1_1_47]
 gi|329575751|gb|EGG57277.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Parasutterella excrementihominis YIT 11859]
          Length = 482

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 226/482 (46%), Positives = 328/482 (68%), Gaps = 7/482 (1%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +WEVVIG+E H QLS  SK+FSGAS  FGAEPNT     D A+PG LP+LN   V++A+ 
Sbjct: 2   EWEVVIGLETHVQLSTKSKIFSGASAAFGAEPNTHACPIDLALPGCLPVLNREAVEKAIR 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI-GPDKSGQFRTI 139
            GL +NA +   SVF RK+YFYPDLP+ YQISQ + P+V  G++++ +  PD +   +T+
Sbjct: 62  FGLAINAKVANRSVFDRKHYFYPDLPKAYQISQFEHPVVIGGELTIQVENPDGTTYAKTV 121

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
              + R HLE+DAGKS+H      + IDLNR+G  L+EIV++P+MRSS EA A+   L  
Sbjct: 122 H--LTRAHLEEDAGKSVHGIVHGKTGIDLNRAGTPLLEIVSEPEMRSSAEAVAYARALHE 179

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ ++G  DG+M++G+ R D NVSV   G+  +GTRCE+KN+NS +FL  AI+YE RRQI
Sbjct: 180 LVTWIGVSDGDMQKGNFRCDANVSVRPKGQKEFGTRCEIKNLNSFKFLQAAIDYEVRRQI 239

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++ +GG + Q TRL+DP  +ETR +RTKED++DYRYF +PDL PLEI +++I  ++  +
Sbjct: 240 ELISEGGKVVQATRLYDPDNDETREMRTKEDSMDYRYFPDPDLQPLEISDEWIDEVRATM 299

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVL 377
           PELP A   R I E+GI+  DA  L S + +  YFE  A N +DKK VANW+  ++L  L
Sbjct: 300 PELPGAALNRLIQEYGINEADAIQLTSHRPLTVYFETAAANVKDKKAVANWIRGEVLAKL 359

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPKEIVEELGLRQ 436
           N +  +IE++P+S  Q+G++++ + DGT++ K A+ +F+ +WE KG     ++E LGL+Q
Sbjct: 360 NAAELTIEESPVSAEQVGQILNRMSDGTLNQKGARTVFSAIWEKKGDNVDALIETLGLKQ 419

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           ++D  AIE  +D V+ +NP  VA   + K    +  VGQ M+ T GKANP+ V ++L+ K
Sbjct: 420 ISDTGAIEAAIDAVLAANPKMVAEFKSGKEKAFNALVGQTMRATKGKANPAQVNEILRAK 479

Query: 496 LG 497
           L 
Sbjct: 480 LA 481


>gi|294668802|ref|ZP_06733895.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Neisseria elongata subsp. glycolytica ATCC 29315]
 gi|291309319|gb|EFE50562.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Neisseria elongata subsp. glycolytica ATCC 29315]
          Length = 476

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 236/480 (49%), Positives = 325/480 (67%), Gaps = 10/480 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+H QL+  SK+FSGAS  FGAEPN   S  + A+PG+LP++N   V++A+  
Sbjct: 3   WETVIGLEIHVQLNTKSKIFSGASTAFGAEPNAHASVVECALPGVLPVMNREVVEKAIKL 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL L+A IN+ +VF RKNYFYPDLP+GYQISQ D PIV  GK+ + +G D     +TI V
Sbjct: 63  GLALDAKINQKNVFDRKNYFYPDLPKGYQISQLDLPIVEHGKLEIVVGDD----VKTINV 118

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
              R H+E+DAGKS+H+  +  + IDLNR+G  L+E+V++P+MRS+ EA A+   L S++
Sbjct: 119 --TRAHMEEDAGKSVHEGLNGATGIDLNRAGTPLLEVVSEPEMRSAAEAVAYAKALHSLV 176

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            +L  CDGNM EGS R D NVSV   G+A +GTR E+KN+NS RFL  AI YE   QI I
Sbjct: 177 TWLDICDGNMAEGSFRVDANVSVRPKGQAEFGTRREIKNLNSFRFLEQAINYEVEAQIEI 236

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LEDGG ++Q T LFDP K ETR +R KEDA DYRYF +PDLLP+ I +D ++  K ++PE
Sbjct: 237 LEDGGKVQQATMLFDPEKGETRVMRLKEDAHDYRYFPDPDLLPVIISDDRLQKAKAEMPE 296

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDLLGVLNR 379
           LP     RF+ ++G+S YDA +L + +  A YFE+ A    + K+ ANW+  +L   LN+
Sbjct: 297 LPKEMAARFVADYGVSDYDARLLTASRVQAAYFEEAAKESGQGKLTANWMNGELAATLNK 356

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW-EKGGTPKEIVEELGLRQVT 438
            G  + D+PI+  +L  L+  I DGT+S K+AK  F  +W E   T  EI+E+ GL+Q+T
Sbjct: 357 EGMELADSPITAPRLAALVGKIADGTLSSKLAKKAFEAMWAEPEATIAEIIEKHGLQQMT 416

Query: 439 DLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  AIE +VDEV+ +N   V +  +     ++  VGQVMK + GKANP+ VQ++++ KLG
Sbjct: 417 DTGAIEAMVDEVLANNAKAVEQFKSGNEKALNAIVGQVMKASKGKANPAQVQELVRAKLG 476


>gi|310819540|ref|YP_003951898.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit b
           [Stigmatella aurantiaca DW4/3-1]
 gi|309392612|gb|ADO70071.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Stigmatella aurantiaca DW4/3-1]
          Length = 481

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 234/482 (48%), Positives = 319/482 (66%), Gaps = 11/482 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           D++ VIG+EVHAQL   SKLF G S  FGAEPN        AMPG+LP+ N R  + A+ 
Sbjct: 5   DFQPVIGLEVHAQLLTKSKLFCGCSTEFGAEPNQNTCPVCLAMPGVLPVFNQRVAEFAIR 64

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
           TGL L   I K SV++RKNYFYPDLP+GYQI+Q+D+PI   G +++   P+     R   
Sbjct: 65  TGLALGCTIKKTSVWSRKNYFYPDLPKGYQITQYDQPICEWGALTIDT-PEGEKTVR--- 120

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
             I RIH+E+DAGK++HD     S +DLNR+GV L+EIV++PD+RS+ EA  +L  LR +
Sbjct: 121 --IRRIHMEEDAGKNVHDAAVGESLVDLNRAGVPLLEIVSEPDLRSADEAVEYLKALRDV 178

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           L YLG  DGNMEEGS R DVNVSV R GE  +G RCE+KN+NS RF+  A EYE  R + 
Sbjct: 179 LVYLGVNDGNMEEGSFRCDVNVSVMRKGETQYGQRCELKNINSFRFIKQAAEYEISRHVE 238

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           +LE GG I QETRL+D  + ETRS+R+KEDA DYRYF EPDL PL + +  I  + + +P
Sbjct: 239 VLESGGKIDQETRLWDTQRGETRSMRSKEDAHDYRYFPEPDLPPLHLADALIDEVAQGLP 298

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVLN 378
           ELP  K +RF+ ++GI  YDA +L +++ +A++FE    + +D K ++NW   +L  +LN
Sbjct: 299 ELPRTKFKRFMSQYGIPAYDAKLLCAERPLAEFFEACTQHYKDYKKLSNWFQGELARLLN 358

Query: 379 RSGK--SIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
            SG   SI     +P Q GEL+  +  GT+S   AKD+F  ++ +G +P+ I+ E GL Q
Sbjct: 359 ESGGTVSISTLKFTPAQFGELLSAVEKGTLSNNAAKDVFAEMFREGKSPEAIIAEKGLAQ 418

Query: 437 VTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D  A+E VVD+V+  N     +  A K  +  +FVGQVMK   GK NP++V ++LK+K
Sbjct: 419 VSDAGAVEAVVDDVLAKNAGEAEKYRAGKKQIFGFFVGQVMKAMKGKGNPALVNELLKKK 478

Query: 496 LG 497
           LG
Sbjct: 479 LG 480


>gi|309378846|emb|CBX22551.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 476

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 237/480 (49%), Positives = 326/480 (67%), Gaps = 10/480 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+H QL+  SK+FSGAS  FGAEPN   S  + A+PG+LP++N   V++A+  
Sbjct: 3   WETVIGLEIHVQLNTKSKIFSGASTAFGAEPNAHASVVECALPGVLPVMNREVVEKAIKL 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL L+A IN+ +VF RKNYFYPDLP+GYQISQ D PIV  GK+ + +G D     +TI V
Sbjct: 63  GLALDAKINQRNVFDRKNYFYPDLPKGYQISQLDLPIVEHGKLEIVVGDD----VKTINV 118

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
              R H+E+DAGKS+H+  +  + IDLNR+G  L+E+V++P+MRS+ EA A+   L S++
Sbjct: 119 --TRAHMEEDAGKSVHEGLNGATGIDLNRAGTPLLEVVSEPEMRSAAEAVAYAKALHSLV 176

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            +L  CDGNM EGS R D NVSV   G+A +GTR E+KN+NS RFL  AI YEA  QI I
Sbjct: 177 TWLDICDGNMAEGSFRVDANVSVRPKGQAEFGTRREIKNLNSFRFLEQAINYEAEAQIEI 236

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LEDGG ++Q T LFDP K ETR +R KEDA DYRYF +PDLLP+ I +  ++  K ++PE
Sbjct: 237 LEDGGKVQQATMLFDPEKGETRVMRLKEDAHDYRYFPDPDLLPVIISDAQMQKAKAEMPE 296

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDLLGVLNR 379
           LP     RF+ ++G+S YDA +L + ++ A YFE+ A    + K  ANW+  +L   LN+
Sbjct: 297 LPKEMAARFVADYGVSEYDARLLTASRAQAAYFEEGAKESGQGKPTANWMNGELAAALNK 356

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW-EKGGTPKEIVEELGLRQVT 438
           +G  + D+PI+  +L  L+  I DGT+SGK+AK  F  +W E   T  EI+E+ GL+Q+T
Sbjct: 357 AGLELADSPITAPRLAALVGKIADGTLSGKLAKKAFEAMWAEPEATIAEIIEKHGLQQMT 416

Query: 439 DLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  AIE +VDEV+ +N   V +  +     ++  VGQVMK + GKANP+ VQ+++K KL 
Sbjct: 417 DTGAIEAMVDEVLANNAKAVEQFKSGNEKALNAIVGQVMKASKGKANPTQVQELIKAKLA 476


>gi|218506919|ref|ZP_03504797.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhizobium etli
           Brasil 5]
          Length = 349

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 224/342 (65%), Positives = 270/342 (78%), Gaps = 7/342 (2%)

Query: 163 VSCIDLNRSGVALME-IVTKPDMRSSLEAKAFLTKL---RSILRYLGTCDGNMEEGSMRA 218
           +S +DLNRSGVA+ME     PDMRSS E++    +    R++ R+    DGNM+EGSMRA
Sbjct: 11  MSYVDLNRSGVAMMENRFQSPDMRSSDESQGLYDQAAFDRALSRHF---DGNMDEGSMRA 67

Query: 219 DVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSK 278
           DVNVSV RPGEA+GTRCE+KNVNSIRF+G AIEYEARRQI ILEDGG I QETRLFDP+K
Sbjct: 68  DVNVSVRRPGEAFGTRCEIKNVNSIRFIGQAIEYEARRQIGILEDGGTIEQETRLFDPNK 127

Query: 279 NETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLY 338
            ETRS+R+KEDA DYRYF +PDLLPLE D+ F+ A+   +PELPD K+ERF+ E G+S+Y
Sbjct: 128 GETRSMRSKEDAHDYRYFPDPDLLPLEFDDAFVTALAADLPELPDDKKERFVRELGLSVY 187

Query: 339 DASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELI 398
           DASVLVS+K+IADYFE +A  RD K  ANWVINDLLG LNR+GK IE TP+SP QLG +I
Sbjct: 188 DASVLVSEKAIADYFEAVAAGRDGKTAANWVINDLLGALNRTGKDIEQTPVSPAQLGAII 247

Query: 399 DLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNV 458
           DLI  GTISGKIAKD+F I+  +GG P EIVE  G++QVTD  AIEK VDE+I +NP+ V
Sbjct: 248 DLIKAGTISGKIAKDLFEIVLTEGGDPAEIVESRGMKQVTDTGAIEKAVDEIIAANPDQV 307

Query: 459 ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLGIKE 500
            ++  KP + +WFVGQVMK TGGKANP  VQ ++K KLGI+E
Sbjct: 308 EKVKAKPTMAAWFVGQVMKATGGKANPQAVQALVKAKLGIEE 349


>gi|261364027|ref|ZP_05976910.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Neisseria mucosa ATCC 25996]
 gi|288568057|gb|EFC89617.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Neisseria mucosa ATCC 25996]
          Length = 476

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 235/480 (48%), Positives = 327/480 (68%), Gaps = 10/480 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+H QL+  SK+FSGAS  FGAEPN   S  + A+PG+LP++N   V++A+  
Sbjct: 3   WETVIGLEIHVQLNTQSKIFSGASTAFGAEPNAHASVVECALPGVLPVMNREVVEKAIKL 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL L+A IN+ +VF RKNYFYPDLP+GYQISQ D PIV  GK+ + +G D     +TI V
Sbjct: 63  GLALDAKINQKNVFDRKNYFYPDLPKGYQISQLDLPIVEHGKLEIVVGDD----VKTINV 118

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
              R H+E+DAGKS+H+  +  + IDLNR+G  L+E+V++P+MRS+ EA A+   L S++
Sbjct: 119 --TRAHMEEDAGKSVHEGLNGATGIDLNRAGTPLLEVVSEPEMRSAAEAVAYAKALHSLV 176

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            +L  CDGNM EGS R D NVSV   G+A +GTR E+KN+NS RFL  AI YE   QI I
Sbjct: 177 TWLDICDGNMAEGSFRVDANVSVRPKGQAEFGTRREIKNLNSFRFLEQAINYEVEAQIEI 236

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LEDGG ++Q T LFDP K ETR +R KEDA DYRYF +PDLLP+ I +D ++  K+++PE
Sbjct: 237 LEDGGKVQQATMLFDPEKGETRVMRLKEDAHDYRYFPDPDLLPVIISDDRLQKAKEEMPE 296

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDLLGVLNR 379
           LP     RF+ ++G+S YDA +L + +  A YFE+ A    + K+ ANW+  +L   LN+
Sbjct: 297 LPKEMAVRFVADYGVSEYDARLLTASRVQAAYFEEAAKESGQGKLTANWMNGELAATLNK 356

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW-EKGGTPKEIVEELGLRQVT 438
           +G  ++D+PI+  +L  L+  I DGT+S K+AK  F  +W E   +  EI+E+ GL+Q+T
Sbjct: 357 AGMELDDSPITAPRLAALVGKIADGTLSSKLAKKAFEAMWAEPEASIAEIIEKHGLQQMT 416

Query: 439 DLSAIEKVVDEVINSNPNNVARIAT-KPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  AIE +VDEV+ +N   V +  +     ++  VGQVMK + GKANP+ VQ+++K KL 
Sbjct: 417 DTGAIEAMVDEVLANNAKAVEQFKSGNEKALNAIVGQVMKASKGKANPAQVQELIKAKLA 476


>gi|115372371|ref|ZP_01459680.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Stigmatella aurantiaca DW4/3-1]
 gi|115370584|gb|EAU69510.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Stigmatella aurantiaca DW4/3-1]
          Length = 530

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 234/482 (48%), Positives = 319/482 (66%), Gaps = 11/482 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           D++ VIG+EVHAQL   SKLF G S  FGAEPN        AMPG+LP+ N R  + A+ 
Sbjct: 54  DFQPVIGLEVHAQLLTKSKLFCGCSTEFGAEPNQNTCPVCLAMPGVLPVFNQRVAEFAIR 113

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
           TGL L   I K SV++RKNYFYPDLP+GYQI+Q+D+PI   G +++   P+     R   
Sbjct: 114 TGLALGCTIKKTSVWSRKNYFYPDLPKGYQITQYDQPICEWGALTIDT-PEGEKTVR--- 169

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
             I RIH+E+DAGK++HD     S +DLNR+GV L+EIV++PD+RS+ EA  +L  LR +
Sbjct: 170 --IRRIHMEEDAGKNVHDAAVGESLVDLNRAGVPLLEIVSEPDLRSADEAVEYLKALRDV 227

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           L YLG  DGNMEEGS R DVNVSV R GE  +G RCE+KN+NS RF+  A EYE  R + 
Sbjct: 228 LVYLGVNDGNMEEGSFRCDVNVSVMRKGETQYGQRCELKNINSFRFIKQAAEYEISRHVE 287

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           +LE GG I QETRL+D  + ETRS+R+KEDA DYRYF EPDL PL + +  I  + + +P
Sbjct: 288 VLESGGKIDQETRLWDTQRGETRSMRSKEDAHDYRYFPEPDLPPLHLADALIDEVAQGLP 347

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVLN 378
           ELP  K +RF+ ++GI  YDA +L +++ +A++FE    + +D K ++NW   +L  +LN
Sbjct: 348 ELPRTKFKRFMSQYGIPAYDAKLLCAERPLAEFFEACTQHYKDYKKLSNWFQGELARLLN 407

Query: 379 RSGK--SIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
            SG   SI     +P Q GEL+  +  GT+S   AKD+F  ++ +G +P+ I+ E GL Q
Sbjct: 408 ESGGTVSISTLKFTPAQFGELLSAVEKGTLSNNAAKDVFAEMFREGKSPEAIIAEKGLAQ 467

Query: 437 VTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D  A+E VVD+V+  N     +  A K  +  +FVGQVMK   GK NP++V ++LK+K
Sbjct: 468 VSDAGAVEAVVDDVLAKNAGEAEKYRAGKKQIFGFFVGQVMKAMKGKGNPALVNELLKKK 527

Query: 496 LG 497
           LG
Sbjct: 528 LG 529


>gi|218768375|ref|YP_002342887.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Neisseria
           meningitidis Z2491]
 gi|24418438|sp|Q9JTZ3|GATB_NEIMA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|121052383|emb|CAM08715.1| Glu-tRNAGln amidotransferase subunit A [Neisseria meningitidis
           Z2491]
 gi|319410621|emb|CBY90990.1| aspartyl-tRNA(Asn) amidotransferase subunit B (Asp-ADT subunit B)
           [Neisseria meningitidis WUE 2594]
          Length = 476

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 235/480 (48%), Positives = 324/480 (67%), Gaps = 10/480 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+H QL+  SK+FSGAS  FGAEPN      + A+PG+LP++N   V++A+  
Sbjct: 3   WETVIGLEIHVQLNTKSKIFSGASTAFGAEPNAHAGVVECALPGVLPVMNREVVEKAIKL 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL L+A IN+ +VF RKNYFYPDLP+GYQISQ D PIV  GK+ + +G D     +TI V
Sbjct: 63  GLALDAKINRKNVFDRKNYFYPDLPKGYQISQLDLPIVEHGKLEIVVGDD----VKTINV 118

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
              R H+E+DAGKS+H+  +  + IDLNR+G  L+E+V++P+MRS+ EA A+   L S++
Sbjct: 119 --TRAHMEEDAGKSVHEGLNGATGIDLNRAGTPLLEVVSEPEMRSAAEAVAYAKALHSLV 176

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            +L  CDGNM EGS R D NVSV   G+A +GTR E+KN+NS RFL  AI YEA  QI I
Sbjct: 177 TWLNICDGNMAEGSFRVDANVSVRPKGQAEFGTRREIKNLNSFRFLEQAINYEAEAQIEI 236

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LEDGG ++Q T LFDP K ETR +R KEDA DYRYF +PDLLP+ I +D ++  K ++PE
Sbjct: 237 LEDGGKVQQATMLFDPEKGETRVMRLKEDAHDYRYFPDPDLLPVIISDDRLQKAKAEMPE 296

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-