BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780979|ref|YP_003065392.1| aspartyl/glutamyl-tRNA
amidotransferase subunit B [Candidatus Liberibacter asiaticus str.
psy62]
         (500 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|239831778|ref|ZP_04680107.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Ochrobactrum intermedium LMG 3301]
 gi|239824045|gb|EEQ95613.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Ochrobactrum intermedium LMG 3301]
          Length = 511

 Score =  615 bits (1587), Expect = e-174,   Method: Composition-based stats.
 Identities = 341/500 (68%), Positives = 413/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS +FGAEPN+ VS  D
Sbjct: 12  MTLIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTSFGAEPNSNVSLVD 71

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 72  AAMPGMLPVINLECVKQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 131

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 132 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 191

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 192 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 251

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 252 NSIRFVGQAIEYEARRQIAILEDGGSIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 311

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 312 LLPLEFDQAFVDALAAELPELPDVKKQRLVETQGISVYDASILVTEKAIADYYEAVAAGR 371

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LNR+GK IE++PI+P+QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 372 DGKAAANWVINDLLGALNRAGKDIEESPITPDQLGAIIDLIKEGTISGKIAKDLFEIVWN 431

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP  V +   KP L  WFVGQVMK TG
Sbjct: 432 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPEKVEQAKAKPTLAGWFVGQVMKATG 491

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 492 GKANPQSVNELVKAKLGIEE 511


>gi|256369327|ref|YP_003106835.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella microti
           CCM 4915]
 gi|255999487|gb|ACU47886.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella microti
           CCM 4915]
          Length = 500

 Score =  615 bits (1585), Expect = e-174,   Method: Composition-based stats.
 Identities = 340/500 (68%), Positives = 412/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   G+S+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAKLPELPDVKKQRLVETLGVSVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|254719004|ref|ZP_05180815.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella sp.
           83/13]
 gi|265983994|ref|ZP_06096729.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella sp. 83/13]
 gi|306840109|ref|ZP_07472895.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella sp. NF 2653]
 gi|264662586|gb|EEZ32847.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella sp. 83/13]
 gi|306404837|gb|EFM61130.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella sp. NF 2653]
          Length = 500

 Score =  615 bits (1585), Expect = e-174,   Method: Composition-based stats.
 Identities = 341/500 (68%), Positives = 410/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K+ R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAELPELPDVKKRRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK +VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKTLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|17987351|ref|NP_539985.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           melitensis bv. 1 str. 16M]
 gi|23501785|ref|NP_697912.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella suis
           1330]
 gi|62289844|ref|YP_221637.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           bv. 1 str. 9-941]
 gi|82699769|ref|YP_414343.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           melitensis biovar Abortus 2308]
 gi|161618859|ref|YP_001592746.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella canis
           ATCC 23365]
 gi|189024085|ref|YP_001934853.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           S19]
 gi|225627389|ref|ZP_03785426.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Brucella ceti str.
           Cudo]
 gi|225852412|ref|YP_002732645.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           melitensis ATCC 23457]
 gi|237815331|ref|ZP_04594329.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella abortus str. 2308 A]
 gi|254689150|ref|ZP_05152404.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           bv. 6 str. 870]
 gi|254693633|ref|ZP_05155461.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           bv. 3 str. Tulya]
 gi|254697284|ref|ZP_05159112.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254704208|ref|ZP_05166036.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella suis
           bv. 3 str. 686]
 gi|254706891|ref|ZP_05168719.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           pinnipedialis M163/99/10]
 gi|254710002|ref|ZP_05171813.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           pinnipedialis B2/94]
 gi|254730183|ref|ZP_05188761.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           bv. 4 str. 292]
 gi|256031496|ref|ZP_05445110.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           pinnipedialis M292/94/1]
 gi|256113447|ref|ZP_05454288.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           melitensis bv. 3 str. Ether]
 gi|256159622|ref|ZP_05457384.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella ceti
           M490/95/1]
 gi|256254902|ref|ZP_05460438.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella ceti
           B1/94]
 gi|256257400|ref|ZP_05462936.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           bv. 9 str. C68]
 gi|256264090|ref|ZP_05466622.1| glutamyl-tRNA(Gln) amidotransferase B subunit [Brucella melitensis
           bv. 2 str. 63/9]
 gi|260168630|ref|ZP_05755441.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella sp.
           F5/99]
 gi|260545409|ref|ZP_05821150.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           NCTC 8038]
 gi|260563925|ref|ZP_05834411.1| aspartyl/glutamyl tRNA amidotransferase subunit B [Brucella
           melitensis bv. 1 str. 16M]
 gi|260566544|ref|ZP_05837014.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella suis
           bv. 4 str. 40]
 gi|260754649|ref|ZP_05866997.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 6 str. 870]
 gi|260757872|ref|ZP_05870220.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 4 str. 292]
 gi|260761695|ref|ZP_05874038.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883675|ref|ZP_05895289.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 9 str. C68]
 gi|261213899|ref|ZP_05928180.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 3 str. Tulya]
 gi|261222084|ref|ZP_05936365.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella ceti B1/94]
 gi|261314355|ref|ZP_05953552.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella pinnipedialis M163/99/10]
 gi|261317550|ref|ZP_05956747.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella pinnipedialis B2/94]
 gi|261754876|ref|ZP_05998585.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella suis bv. 3 str. 686]
 gi|261758103|ref|ZP_06001812.1| glutamyl-tRNA(Gln) amidotransferase B subunit [Brucella sp. F5/99]
 gi|265988584|ref|ZP_06101141.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella pinnipedialis M292/94/1]
 gi|265994835|ref|ZP_06107392.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella melitensis bv. 3 str. Ether]
 gi|265998049|ref|ZP_06110606.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella ceti M490/95/1]
 gi|294852255|ref|ZP_06792928.1| aspartyl-tRNA(Asn)/glutamyl-tRNA amidotransferase subunit B
           [Brucella sp. NVSL 07-0026]
 gi|297248249|ref|ZP_06931967.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Brucella abortus bv. 5 str. B3196]
 gi|54037154|sp|P64198|GATB_BRUSU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|54041286|sp|P64197|GATB_BRUME RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|75496904|sp|Q57DK8|GATB_BRUAB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|109892008|sp|Q2YNL2|GATB_BRUA2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|189045270|sp|A9MAS2|GATB_BRUC2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|229486045|sp|B2S5D2|GATB_BRUA1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|254790945|sp|C0RIN3|GATB_BRUMB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|17983035|gb|AAL52249.1| glutamyl-tRNA(gln) amidotransferase subunit b [Brucella melitensis
           bv. 1 str. 16M]
 gi|23347716|gb|AAN29827.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Brucella suis 1330]
 gi|62195976|gb|AAX74276.1| GatB, glutamyl-tRNA(Gln) amidotransferase, B subunit [Brucella
           abortus bv. 1 str. 9-941]
 gi|82615870|emb|CAJ10874.1| GatB/Yqey:Glutamyl-tRNA(Gln) amidotransferase B subunit:GatB
           N-terminal region:GatB central domain [Brucella
           melitensis biovar Abortus 2308]
 gi|161335670|gb|ABX61975.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella canis ATCC 23365]
 gi|189019657|gb|ACD72379.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Brucella abortus
           S19]
 gi|225617394|gb|EEH14439.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Brucella ceti str.
           Cudo]
 gi|225640777|gb|ACO00691.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Brucella melitensis
           ATCC 23457]
 gi|237790168|gb|EEP64378.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella abortus str. 2308 A]
 gi|260096816|gb|EEW80691.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella abortus
           NCTC 8038]
 gi|260153941|gb|EEW89033.1| aspartyl/glutamyl tRNA amidotransferase subunit B [Brucella
           melitensis bv. 1 str. 16M]
 gi|260156062|gb|EEW91142.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella suis
           bv. 4 str. 40]
 gi|260668190|gb|EEX55130.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 4 str. 292]
 gi|260672127|gb|EEX58948.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674757|gb|EEX61578.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 6 str. 870]
 gi|260873203|gb|EEX80272.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 9 str. C68]
 gi|260915506|gb|EEX82367.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella abortus bv. 3 str. Tulya]
 gi|260920668|gb|EEX87321.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella ceti B1/94]
 gi|261296773|gb|EEY00270.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella pinnipedialis B2/94]
 gi|261303381|gb|EEY06878.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella pinnipedialis M163/99/10]
 gi|261738087|gb|EEY26083.1| glutamyl-tRNA(Gln) amidotransferase B subunit [Brucella sp. F5/99]
 gi|261744629|gb|EEY32555.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella suis bv. 3 str. 686]
 gi|262552517|gb|EEZ08507.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella ceti M490/95/1]
 gi|262765948|gb|EEZ11737.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella melitensis bv. 3 str. Ether]
 gi|263094293|gb|EEZ18154.1| glutamyl-tRNA(Gln) amidotransferase B subunit [Brucella melitensis
           bv. 2 str. 63/9]
 gi|264660781|gb|EEZ31042.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella pinnipedialis M292/94/1]
 gi|294820844|gb|EFG37843.1| aspartyl-tRNA(Asn)/glutamyl-tRNA amidotransferase subunit B
           [Brucella sp. NVSL 07-0026]
 gi|297175418|gb|EFH34765.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Brucella abortus bv. 5 str. B3196]
 gi|326408920|gb|ADZ65985.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Brucella melitensis
           M28]
 gi|326538637|gb|ADZ86852.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Brucella melitensis
           M5-90]
          Length = 500

 Score =  615 bits (1585), Expect = e-174,   Method: Composition-based stats.
 Identities = 341/500 (68%), Positives = 412/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAKLPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|306843798|ref|ZP_07476396.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella sp. BO1]
 gi|306275876|gb|EFM57592.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella sp. BO1]
          Length = 500

 Score =  614 bits (1584), Expect = e-174,   Method: Composition-based stats.
 Identities = 341/500 (68%), Positives = 412/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAELPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|256044574|ref|ZP_05447478.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265990998|ref|ZP_06103555.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|263001782|gb|EEZ14357.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella melitensis bv. 1 str. Rev.1]
          Length = 500

 Score =  614 bits (1584), Expect = e-173,   Method: Composition-based stats.
 Identities = 340/500 (68%), Positives = 411/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+L KLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLIKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAKLPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|306840394|ref|ZP_07473159.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella sp. BO2]
 gi|306289632|gb|EFM60836.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella sp. BO2]
          Length = 500

 Score =  614 bits (1583), Expect = e-173,   Method: Composition-based stats.
 Identities = 341/500 (68%), Positives = 412/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGMIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAELPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|254701664|ref|ZP_05163492.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella suis
           bv. 5 str. 513]
 gi|261752217|ref|ZP_05995926.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella suis bv. 5 str. 513]
 gi|261741970|gb|EEY29896.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella suis bv. 5 str. 513]
          Length = 500

 Score =  613 bits (1582), Expect = e-173,   Method: Composition-based stats.
 Identities = 341/500 (68%), Positives = 412/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAKLPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDRVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|227821669|ref|YP_002825639.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sinorhizobium
           fredii NGR234]
 gi|254790962|sp|C3MAA7|GATB_RHISN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|227340668|gb|ACP24886.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Sinorhizobium fredii NGR234]
          Length = 500

 Score =  612 bits (1579), Expect = e-173,   Method: Composition-based stats.
 Identities = 346/500 (69%), Positives = 411/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV+IG+EVHAQ+   SKLFSGAS  FG  PN  VS  D
Sbjct: 1   MSIVDVRTPDPKRFIPGATGDWEVIIGLEVHAQVLSNSKLFSGASTEFGNAPNANVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN+ S+F RKNYFYPDLPQGYQISQ+  PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAKINRRSIFDRKNYFYPDLPQGYQISQYKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +SIGPD+ GQF  +E+GIER+HLEQDAGKS+HDQ+ ++S +DLNRSGVALMEIV+
Sbjct: 121 EGKIIISIGPDRQGQFEDVEIGIERLHLEQDAGKSMHDQHPSMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EAKA+LTKLRSILRYLGTCDGNM+EGSMRADVNVSV RPG A+GTRCE+KNV
Sbjct: 181 KPDLRSSDEAKAYLTKLRSILRYLGTCDGNMDEGSMRADVNVSVRRPGAAFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIGILEDGGTIDQETRLFDPNKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+K  +PELPD K++RF+ + G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 301 LLPLEFDDAFVEALKTDLPELPDDKKDRFVRDLGLSVYDASVLVSEKAIADYFEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D KI ANWVINDLLG LN++GK+IE+TP+SP QLG +IDLI  GTISGK+AKD+F ILW 
Sbjct: 361 DGKIAANWVINDLLGALNKAGKTIEETPVSPAQLGGVIDLIKAGTISGKLAKDLFEILWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VDE+I +NP+ V +   KP+L  WFVGQVMK TG
Sbjct: 421 EGGDPAEIVESRGMKQVTDTGAIEKAVDEIIAANPDQVEKAKAKPSLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 481 GKANPQAVQALVKSKLGIEE 500


>gi|254714003|ref|ZP_05175814.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella ceti
           M644/93/1]
 gi|254716938|ref|ZP_05178749.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella ceti
           M13/05/1]
 gi|261218744|ref|ZP_05933025.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella ceti M13/05/1]
 gi|261321757|ref|ZP_05960954.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella ceti M644/93/1]
 gi|260923833|gb|EEX90401.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella ceti M13/05/1]
 gi|261294447|gb|EEX97943.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella ceti M644/93/1]
          Length = 500

 Score =  612 bits (1578), Expect = e-173,   Method: Composition-based stats.
 Identities = 340/500 (68%), Positives = 412/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  C++QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECMRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAKLPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|150396169|ref|YP_001326636.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sinorhizobium
           medicae WSM419]
 gi|166198818|sp|A6U821|GATB_SINMW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|150027684|gb|ABR59801.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sinorhizobium
           medicae WSM419]
          Length = 500

 Score =  612 bits (1577), Expect = e-173,   Method: Composition-based stats.
 Identities = 346/500 (69%), Positives = 409/500 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV+IG+EVHAQ+   SKLFSGAS  FG+EPN  VS  D
Sbjct: 1   MSIVDVRTPDPKRFIPGATGDWEVIIGMEVHAQVLSNSKLFSGASTEFGSEPNANVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S+F RKNYFYPDLPQGYQISQ+  PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAKINNRSIFDRKNYFYPDLPQGYQISQYKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ G F  +E+GIER+HLEQDAGKS+HDQ+ A+S +DLNRSGVALMEIV+
Sbjct: 121 EGKIIISVGPDRQGHFEDVEIGIERLHLEQDAGKSMHDQHPAMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EAKA+LTKLRSILRYLGTCDGNM+EGSMRADVNVSV RPGEA+GTRCE+KNV
Sbjct: 181 KPDLRSSDEAKAYLTKLRSILRYLGTCDGNMDEGSMRADVNVSVRRPGEAFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGAIDQETRLFDPGKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+K  +PELPD K+ERF+ + G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 301 LLPLEFDDAFVEALKAHLPELPDDKKERFVRDLGLSVYDASVLVSEKAIADYFEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE TP+SP QLG +IDLI DGTISGK+AKD+F I+W 
Sbjct: 361 DGKTAANWVINDLLGALNKAGKPIEGTPVSPAQLGGIIDLIKDGTISGKLAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE  G++QVTD  AIEK VDE+I +NP+ V +   KP+L  WFVGQVMK TG
Sbjct: 421 EGGDPAQIVESRGMKQVTDTGAIEKAVDEIIAANPDQVEKAKAKPSLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLG +E
Sbjct: 481 GKANPQAVQALVKSKLGFEE 500


>gi|153009609|ref|YP_001370824.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ochrobactrum
           anthropi ATCC 49188]
 gi|166198798|sp|A6X191|GATB_OCHA4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|151561497|gb|ABS14995.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Ochrobactrum
           anthropi ATCC 49188]
          Length = 500

 Score =  612 bits (1577), Expect = e-173,   Method: Composition-based stats.
 Identities = 340/500 (68%), Positives = 413/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT +   +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS +FGAEPN+ VS  D
Sbjct: 1   MSLIDTRIPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTSFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVKQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGSIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+   +PELPD K++R + + GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAVDLPELPDVKKQRLVEKQGISIYDASILVTEKAIADYYESVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++P+SP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPVSPEQLGAVIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP  V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPEKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQSVNELVKAKLGIEE 500


>gi|163843171|ref|YP_001627575.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella suis
           ATCC 23445]
 gi|189045271|sp|B0CLM5|GATB_BRUSI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|163673894|gb|ABY38005.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Brucella suis ATCC 23445]
          Length = 502

 Score =  611 bits (1575), Expect = e-173,   Method: Composition-based stats.
 Identities = 340/502 (67%), Positives = 411/502 (81%), Gaps = 2/502 (0%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAKLPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPN--LVSWFVGQVMKN 478
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   K    L  WFVGQVMK 
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKAKPTLAGWFVGQVMKA 480

Query: 479 TGGKANPSIVQKMLKEKLGIKE 500
           TGGKANP  V +++K KLGI+E
Sbjct: 481 TGGKANPQAVNELVKSKLGIEE 502


>gi|256061006|ref|ZP_05451163.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella
           neotomae 5K33]
 gi|261325006|ref|ZP_05964203.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella neotomae 5K33]
 gi|261300986|gb|EEY04483.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brucella neotomae 5K33]
          Length = 500

 Score =  611 bits (1575), Expect = e-172,   Method: Composition-based stats.
 Identities = 340/500 (68%), Positives = 411/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PEL D K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAFVDALAAKLPELLDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|110634072|ref|YP_674280.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mesorhizobium
           sp. BNC1]
 gi|123162278|sp|Q11HL0|GATB_MESSB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|110285056|gb|ABG63115.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Chelativorans sp. BNC1]
          Length = 499

 Score =  611 bits (1575), Expect = e-172,   Method: Composition-based stats.
 Identities = 342/499 (68%), Positives = 403/499 (80%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     + L  G TGDWEV+IG+E+HAQ++  +KLFSGAS  FGAEPN  VS  D
Sbjct: 1   MTIIDTRTPDPKRLIPGATGDWEVIIGMEIHAQVTSRAKLFSGASTEFGAEPNANVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+ +PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAIRTGLGLKAQINHRSVFDRKNYFYPDLPQGYQISQYKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG V VS+GP K G F  I+VGIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGIVIVSVGPAKDGSFEEIQVGIERLHLEQDAGKSLHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRS+ EAKAFLTKLRSILRYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSADEAKAFLTKLRSILRYLGTCDGNMDEGSMRADVNVSVRRPGEPFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIE EARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIESEARRQIAILEDGGAIDQETRLFDPGKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           L+PL  D+ ++ A+  ++PELPD K+ RF+  FG+S YDASVLV++++ A YFEK+A  R
Sbjct: 301 LVPLVFDQAYVDALAAELPELPDEKKARFMASFGLSEYDASVLVAERATAAYFEKVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LNR+GK IEDTP+SP+ LG +IDLI DGTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNRTGKDIEDTPVSPDHLGTIIDLIKDGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P  IVEE GL+QVTD  AIEK VDEVI +NP+ V +   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPVRIVEERGLKQVTDTGAIEKAVDEVIAANPDKVEQAKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  ++ +KLGI+
Sbjct: 481 GKANPQAVNALVNQKLGIE 499


>gi|148560303|ref|YP_001258878.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brucella ovis
           ATCC 25840]
 gi|166217737|sp|A5VQ81|GATB_BRUO2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|148371560|gb|ABQ61539.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Brucella ovis ATCC
           25840]
          Length = 500

 Score =  610 bits (1574), Expect = e-172,   Method: Composition-based stats.
 Identities = 339/500 (67%), Positives = 411/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +   SG TGDWEVVIG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MSIIDTRTPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TG+GLNA IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINLECVRQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD  GQF  +E+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EA+A+LTKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVHRPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE ++ F+ A+  ++PELPD K++R +   GIS+YDAS+LV++K+IADY+E +A  R
Sbjct: 301 LLPLEFNQAFVDALAAKLPELPDVKKQRLVETLGISVYDASILVTEKAIADYYEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK IE++PISP QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKDIEESPISPAQLGAIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK++VEE G++QVTD  AIEK VD+VI +NP+ V +   KP L  WFVGQVMK  G
Sbjct: 421 EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPDKVEQAKAKPTLAGWFVGQVMKAMG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  V +++K KLGI+E
Sbjct: 481 GKANPQAVNELVKSKLGIEE 500


>gi|307301138|ref|ZP_07580907.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sinorhizobium
           meliloti BL225C]
 gi|307317871|ref|ZP_07597309.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sinorhizobium
           meliloti AK83]
 gi|24418418|sp|Q92QK5|GATB_RHIME RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|306896633|gb|EFN27381.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sinorhizobium
           meliloti AK83]
 gi|306904093|gb|EFN34679.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sinorhizobium
           meliloti BL225C]
          Length = 500

 Score =  610 bits (1573), Expect = e-172,   Method: Composition-based stats.
 Identities = 346/500 (69%), Positives = 412/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV+IG+EVHAQ+   SKLFS AS  FG+EPN  VS  D
Sbjct: 1   MSIVDVRTPDPKRFIPGATGDWEVIIGMEVHAQVLSNSKLFSSASTEFGSEPNANVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S+F RKNYFYPDLPQGYQISQ+  PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAKINNRSIFDRKNYFYPDLPQGYQISQYKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ GQF  +E+GIER+HLEQDAGKS+HDQ+ A+S +DLNRSGVALMEIV+
Sbjct: 121 EGKIIISVGPDRQGQFEDVEIGIERLHLEQDAGKSMHDQHPAMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EAKA+LTKLRSILRYLGTCDGNM+EGSMRADVNVSV RPGEA+GTRCE+KNV
Sbjct: 181 KPDLRSSDEAKAYLTKLRSILRYLGTCDGNMDEGSMRADVNVSVRRPGEAFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G +IEYEARRQIAILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQSIEYEARRQIAILEDGGAIDQETRLFDANKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+K  +PELPD K+ERF+ + G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 301 LLPLEFDDAFVEALKADLPELPDDKKERFVRDLGLSVYDASVLVSEKAIADYFEAVAEGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK+IE+TP+SP QLG +IDLI DGTISGK+AKD+F ILW 
Sbjct: 361 DGKAAANWVINDLLGALNKAGKTIEETPVSPAQLGGIIDLIKDGTISGKLAKDVFEILWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VDE+I +NP+ V +   KP+L  WFVGQVMK TG
Sbjct: 421 EGGDPAEIVESRGMKQVTDTGAIEKAVDEIIAANPDQVEKAKAKPSLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 481 GKANPQAVQALVKSKLGIEE 500


>gi|260460725|ref|ZP_05808975.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Mesorhizobium
           opportunistum WSM2075]
 gi|259033302|gb|EEW34563.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Mesorhizobium
           opportunistum WSM2075]
          Length = 499

 Score =  609 bits (1571), Expect = e-172,   Method: Composition-based stats.
 Identities = 336/499 (67%), Positives = 408/499 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT    ++ L  G TGDWE++IG+EVHAQ++  +KLFSGAS  FGA PN  VS  D
Sbjct: 1   MTLIDTRTPDAKRLIPGATGDWEIIIGLEVHAQVTSEAKLFSGASTTFGAAPNANVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAIRTGLGLKAQINHKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG V VS+GPD+ G+F  IEVGIER+HLEQDAGKS+HDQ++ +S +DLNRSGVALMEIV+
Sbjct: 121 EGTVIVSVGPDRQGEFEDIEVGIERLHLEQDAGKSMHDQHATMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRS+ EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVNVSV +PG  +GTRCE+KNV
Sbjct: 181 KPDMRSADEAKAYVTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRKPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AI+YEARRQIAILEDGG I QETRLFD  K ETRS+RTKE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIDYEARRQIAILEDGGKIDQETRLFDAVKGETRSMRTKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ ++ A+ K++PELPDAK+ R I   G+S YDAS+LVS+K IADYFEK+A  R
Sbjct: 301 LLPLEFDQAYVDALAKELPELPDAKKARLIASLGLSTYDASILVSEKPIADYFEKVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVINDLLG LN++G+ IE+ P+SP+QLG +IDLI DGTISGKIAKD+F I+W 
Sbjct: 361 DGKLAANWVINDLLGQLNKAGQGIENAPVSPDQLGAVIDLIKDGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P+++VE  G++QVTD  AIEK VDEVI +NP+ V +   KP +  WFVGQVMK TG
Sbjct: 421 EGGDPRQLVESRGMKQVTDTGAIEKAVDEVIAANPDKVEQARAKPTMAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  ++K KLGI+
Sbjct: 481 GKANPQAVNDLVKAKLGIE 499


>gi|15965067|ref|NP_385420.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sinorhizobium
           meliloti 1021]
 gi|15074246|emb|CAC45893.1| Putative glutamyl-tRNA amidotransferase subunit B [Sinorhizobium
           meliloti 1021]
          Length = 516

 Score =  609 bits (1570), Expect = e-172,   Method: Composition-based stats.
 Identities = 346/500 (69%), Positives = 412/500 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV+IG+EVHAQ+   SKLFS AS  FG+EPN  VS  D
Sbjct: 17  MSIVDVRTPDPKRFIPGATGDWEVIIGMEVHAQVLSNSKLFSSASTEFGSEPNANVSLVD 76

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S+F RKNYFYPDLPQGYQISQ+  PIVG
Sbjct: 77  AAMPGMLPVINEECVKQAVRTGLGLKAKINNRSIFDRKNYFYPDLPQGYQISQYKDPIVG 136

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ GQF  +E+GIER+HLEQDAGKS+HDQ+ A+S +DLNRSGVALMEIV+
Sbjct: 137 EGKIIISVGPDRQGQFEDVEIGIERLHLEQDAGKSMHDQHPAMSYVDLNRSGVALMEIVS 196

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EAKA+LTKLRSILRYLGTCDGNM+EGSMRADVNVSV RPGEA+GTRCE+KNV
Sbjct: 197 KPDLRSSDEAKAYLTKLRSILRYLGTCDGNMDEGSMRADVNVSVRRPGEAFGTRCEIKNV 256

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G +IEYEARRQIAILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PD
Sbjct: 257 NSIRFVGQSIEYEARRQIAILEDGGAIDQETRLFDANKGETRSMRSKEEAHDYRYFPDPD 316

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+K  +PELPD K+ERF+ + G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 317 LLPLEFDDAFVEALKADLPELPDDKKERFVRDLGLSVYDASVLVSEKAIADYFEAVAEGR 376

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK+IE+TP+SP QLG +IDLI DGTISGK+AKD+F ILW 
Sbjct: 377 DGKAAANWVINDLLGALNKAGKTIEETPVSPAQLGGIIDLIKDGTISGKLAKDVFEILWN 436

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VDE+I +NP+ V +   KP+L  WFVGQVMK TG
Sbjct: 437 EGGDPAEIVESRGMKQVTDTGAIEKAVDEIIAANPDQVEKAKAKPSLAGWFVGQVMKATG 496

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 497 GKANPQAVQALVKSKLGIEE 516


>gi|325292683|ref|YP_004278547.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Agrobacterium
           sp. H13-3]
 gi|325060536|gb|ADY64227.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Agrobacterium
           sp. H13-3]
          Length = 501

 Score =  608 bits (1569), Expect = e-172,   Method: Composition-based stats.
 Identities = 341/500 (68%), Positives = 404/500 (80%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWE+VIG+EVHAQ+   SKLFSGAS  FG  PN+ VS  D
Sbjct: 1   MTLVDVRTPDPKRFIPGATGDWEIVIGLEVHAQVLSNSKLFSGASTTFGNAPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S+F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAKINNRSIFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG +++S+GPD+ G F  IE+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGIITISLGPDRQGNFEDIEIGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA+LTKLRSI+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYLTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEGFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQIAILEDGGVIDQETRLFDPGKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+K  +PELPD K+ RF+ + G+S+YDAS+LVS+K+IADY+E +A  R
Sbjct: 301 LLPLEFDDAFVDALKVDLPELPDDKKARFVADLGLSVYDASILVSEKAIADYYESVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN+SGK IE TP+SP+QLG +IDLI   TISGKIAKD+F I+W 
Sbjct: 361 DPKAAANWVINDLLGALNKSGKDIETTPVSPDQLGGIIDLIKSETISGKIAKDVFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VDE+I +NP+ V ++  KP L  WFVGQVMK TG
Sbjct: 421 EGGNPAEIVETRGMKQVTDTGAIEKAVDEIIAANPDQVEKVKAKPALAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI++
Sbjct: 481 GKANPQAVQALVKAKLGIED 500


>gi|13470473|ref|NP_102042.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mesorhizobium
           loti MAFF303099]
 gi|24418429|sp|Q98ND3|GATB_RHILO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|14021215|dbj|BAB47828.1| Glu-tRNA(Gln) amidotransferase subunit [Mesorhizobium loti
           MAFF303099]
          Length = 499

 Score =  608 bits (1569), Expect = e-172,   Method: Composition-based stats.
 Identities = 332/499 (66%), Positives = 403/499 (80%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT    ++ L  G TGDWE++IG+EVHAQ+   +KLFSGAS  FGA PN  VS  D
Sbjct: 1   MTIIDTRTPDAKRLIPGATGDWEIIIGLEVHAQVISEAKLFSGASTAFGAAPNANVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAIRTGLGLKAQINHKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG V VS+GPD+ G+F  IEVGIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGTVIVSVGPDRQGEFEDIEVGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RS  EAKA++TKLR+I+RYLGTCDGNM+EGS+RADVNVSV RPG  +GTRCE+KN+
Sbjct: 181 KPDLRSGDEAKAYVTKLRTIMRYLGTCDGNMDEGSLRADVNVSVRRPGGEFGTRCEIKNM 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AI+YEARRQIAILEDGG I QETRL+D  K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIDYEARRQIAILEDGGKIDQETRLYDAVKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ ++ A+ K++PELPD K+ R I   G+S YDAS+LVS+KS+ADYFEK+A  R
Sbjct: 301 LLPLEFDQAYVDALAKELPELPDDKKARLITSLGLSTYDASILVSEKSVADYFEKVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVINDLLG LN+ GK IE+ P+SP+QLG +IDLI DGTISGKIAKD+F I+W 
Sbjct: 361 DGKLAANWVINDLLGQLNKVGKDIENAPVSPDQLGAIIDLIKDGTISGKIAKDLFEIVWS 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P+ +VE  G++QVTD  AIEK VDEVI +NP+ V +   KP +  WFVGQVMK TG
Sbjct: 421 EGGDPRALVESRGMKQVTDTGAIEKAVDEVIAANPDKVEQARAKPTMAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  ++K KLGI+
Sbjct: 481 GKANPQAVNDLVKAKLGIE 499


>gi|319783241|ref|YP_004142717.1| glutamyl-tRNA(Gln) amidotransferase, subunit beta [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317169129|gb|ADV12667.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 499

 Score =  605 bits (1560), Expect = e-171,   Method: Composition-based stats.
 Identities = 336/499 (67%), Positives = 411/499 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT    ++ L SG TGDWE++IG+EVHAQ++  +KLFSGAS  FGA PN  VS  D
Sbjct: 1   MSLIDTRTPDAKRLVSGATGDWEIIIGLEVHAQITSEAKLFSGASTAFGAAPNANVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAIRTGLGLKAQINHKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG V VS+GPD+ G+F  IEVGIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGTVIVSVGPDRQGEFEDIEVGIERLHLEQDAGKSMHDQHVTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRS+ EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVNVSV +PG  +GTRCE+KNV
Sbjct: 181 KPDMRSADEAKAYVTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRKPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AI+YEARRQIAILEDGG I QETRLFD +K+ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIDYEARRQIAILEDGGKIEQETRLFDAAKSETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ ++ A+ K++PELPD K+ R I   G+S+YDAS+LVS+K IADYFEK+A  R
Sbjct: 301 LLPLEFDQAYVDALAKELPELPDDKKARLIASLGLSVYDASILVSEKPIADYFEKVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVINDLLG LN++GK IE+ P+SP+QLG +IDLI DGTISGKIAKD+F I+W 
Sbjct: 361 DGKLAANWVINDLLGQLNKAGKDIENAPVSPDQLGAVIDLIKDGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P+++VE  G++QVTD  AIEK VDEVI +NP+ V +   KP++  WFVGQVMK TG
Sbjct: 421 EGGDPRQLVESRGMKQVTDTGAIEKAVDEVIAANPDKVEQARAKPSMAGWFVGQVMKVTG 480

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  ++K KLGI+
Sbjct: 481 GKANPQAVNDLVKTKLGIE 499


>gi|163759356|ref|ZP_02166442.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Hoeflea
           phototrophica DFL-43]
 gi|162283760|gb|EDQ34045.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Hoeflea
           phototrophica DFL-43]
          Length = 501

 Score =  605 bits (1559), Expect = e-171,   Method: Composition-based stats.
 Identities = 342/498 (68%), Positives = 413/498 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     + L SG TGDWE++IG+EVHAQ++  SKLFSGAS +FG   N+ VS  D
Sbjct: 1   MSLVDTRTPDPKRLISGATGDWEIIIGLEVHAQVTSNSKLFSGASTHFGNAANSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINQECVAQAVRTGLGLKAQINNRSVFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ GQF  IE+GIER+HLEQDAGKS+HDQ+ ++S +DLNRSGVALMEIV+
Sbjct: 121 EGKIIISVGPDRQGQFEDIEIGIERLHLEQDAGKSMHDQHPSMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRS+ EAKA++TKLRSILRYLGTCDGNM+EGSMRADVNVSV +PG  +GTRCE+KNV
Sbjct: 181 KPDMRSADEAKAYVTKLRSILRYLGTCDGNMDEGSMRADVNVSVRKPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIE EARRQIAI+EDGG I QETRLFDP+K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFVGQAIESEARRQIAIIEDGGTIDQETRLFDPAKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ ++K  +PELPD K+ RF+ + G+S+YDAS+LVS+K+IADYFE++A  R
Sbjct: 301 LLPLEFDDAFVESLKADLPELPDDKKARFVADMGLSVYDASILVSEKAIADYFEEVARGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVINDLLG LN+SGK+IE+TP+SP QLG +ID+I DGTISGKIAKD+F I+WE
Sbjct: 361 DGKMAANWVINDLLGALNKSGKAIEETPVSPAQLGAIIDMIKDGTISGKIAKDLFEIIWE 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P ++VE+ G++QVTD  AIEK VDEVI +NP+ VA+   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPADVVEKRGMKQVTDTGAIEKAVDEVIAANPDQVAKAQAKPALAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  VQ ++K KLGI
Sbjct: 481 GKANPKAVQDLVKAKLGI 498


>gi|159184713|ref|NP_354330.2| aspartyl/glutamyl-tRNA amidotransferase subunit B [Agrobacterium
           tumefaciens str. C58]
 gi|24418412|sp|Q8UFS3|GATB_AGRT5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|159140001|gb|AAK87115.2| glutamyl-tRNA amidotransferase subunit B [Agrobacterium tumefaciens
           str. C58]
          Length = 501

 Score =  604 bits (1558), Expect = e-171,   Method: Composition-based stats.
 Identities = 337/500 (67%), Positives = 402/500 (80%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWE+VIG+EVHAQ+   SKLFSGAS  FG  PN+ VS  D
Sbjct: 1   MTLVDVRTPDPKRFIPGATGDWEIVIGLEVHAQVLSNSKLFSGASTTFGNAPNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S+F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAKINNRSIFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG +++S+GPD+ G F  IE+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGTITISLGPDRQGNFEDIEIGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAK +LTKLRSI+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKGYLTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEGFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQ+AILEDGG I QETRLFDP K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFVGQAIEYEARRQVAILEDGGVIDQETRLFDPGKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+K  +PELPD K+ RF+ + G+S+YDAS+LVS+K+IADY+E +A  R
Sbjct: 301 LLPLEFDDAFVEALKVDLPELPDDKKARFVADLGLSVYDASILVSEKAIADYYEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN+ GK IE TP+SP+QLG +IDLI   TISGKIAKD+F I+W 
Sbjct: 361 DAKTAANWVINDLLGALNKFGKDIETTPVSPDQLGGIIDLIKAETISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VD++I +NP+ V ++  KP L  WFVGQVMK TG
Sbjct: 421 EGGNPAEIVEARGMKQVTDTGAIEKAVDDIIAANPDQVEKVKAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI++
Sbjct: 481 GKANPQAVQALVKAKLGIED 500


>gi|254780979|ref|YP_003065392.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040656|gb|ACT57452.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 500

 Score =  604 bits (1557), Expect = e-170,   Method: Composition-based stats.
 Identities = 500/500 (100%), Positives = 500/500 (100%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD
Sbjct: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG
Sbjct: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT
Sbjct: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV
Sbjct: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD
Sbjct: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR
Sbjct: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE
Sbjct: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG
Sbjct: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANPSIVQKMLKEKLGIKE
Sbjct: 481 GKANPSIVQKMLKEKLGIKE 500


>gi|222148326|ref|YP_002549283.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Agrobacterium
           vitis S4]
 gi|254790413|sp|B9JVJ7|GATB_AGRVS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|221735314|gb|ACM36277.1| glutamyl-tRNA amidotransferase subunit B [Agrobacterium vitis S4]
          Length = 500

 Score =  603 bits (1554), Expect = e-170,   Method: Composition-based stats.
 Identities = 343/500 (68%), Positives = 408/500 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     + L  G TGDWE+VIG+EVHAQ+   SKLFSGAS  FG  PN  VS  D
Sbjct: 1   MTLVDTRTPDPKRLIPGATGDWEIVIGMEVHAQVLSQSKLFSGASTTFGNAPNDNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A INK S+F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVRQAVRTGLGLKAKINKRSIFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ G F  IE+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIIISLGPDRQGNFEDIEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLRSI+RYLGTCDGNM+EGSMRADVNVSV +PG  +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRKPGGEFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFDP K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEDGGSIDQETRLFDPGKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F++A+KK +PELPD K+ RF+   G+S+YDASVLVS+K+IADY+E +A  R
Sbjct: 301 LLPLEFDDAFVQALKKDLPELPDDKKARFVASLGLSVYDASVLVSEKAIADYYEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D KI ANWVINDLLG LN++GK IE+TP+SP QLG +IDLI   TISGKIAKD+F I++ 
Sbjct: 361 DGKIAANWVINDLLGALNKAGKGIEETPVSPAQLGGIIDLIKAETISGKIAKDLFEIVFN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE  G++QVTD  AIEK VDE+I +NP+ VA++  KP L  WFVGQVMK TG
Sbjct: 421 EGGDPADIVESRGMKQVTDTGAIEKAVDEIIAANPDQVAKVLAKPTLAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLG++E
Sbjct: 481 GKANPQAVQALVKAKLGLEE 500


>gi|209549127|ref|YP_002281044.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|229486433|sp|B5ZMJ6|GATB_RHILW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|209534883|gb|ACI54818.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 500

 Score =  600 bits (1548), Expect = e-169,   Method: Composition-based stats.
 Identities = 343/500 (68%), Positives = 406/500 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV++G+EVHAQ+   SKLFSGAS  FG   N+ VS  D
Sbjct: 1   MTLVDVRTPDPKRFIPGATGDWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A INK S+F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVRQAVRTGLGLKAQINKRSLFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ GQF  IE+GIER+HLEQDAGKS+HDQ++ +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIVISLGPDRQGQFEDIEIGIERLHLEQDAGKSLHDQHATMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLRSI+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEGFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIGILEDGGTIEQETRLFDPNKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+   +PELPD K+ERF+ E G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 301 LLPLEFDDAFVSALAVDLPELPDDKKERFVRELGLSIYDASVLVSEKAIADYFEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LNR+GK IE TP+SP QLG +IDLI  GTISGKIAKD+F I+  
Sbjct: 361 DGKTAANWVINDLLGALNRTGKDIEQTPVSPAQLGAIIDLIKAGTISGKIAKDLFEIVLT 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIV+  G++QVTD  AIEK VDE+I +NP+ V ++  KP L +WFVGQVMK TG
Sbjct: 421 EGGDPAEIVDARGMKQVTDTGAIEKAVDEIIAANPDQVEKVKAKPTLAAWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 481 GKANPQAVQALVKAKLGIEE 500


>gi|86357488|ref|YP_469380.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhizobium etli
           CFN 42]
 gi|109892054|sp|Q2K933|GATB_RHIEC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|86281590|gb|ABC90653.1| glutamyl-tRNA amidotransferase subunit B protein [Rhizobium etli
           CFN 42]
          Length = 500

 Score =  600 bits (1546), Expect = e-169,   Method: Composition-based stats.
 Identities = 343/500 (68%), Positives = 407/500 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV++G+EVHAQ+   SKLFSGAS  FG   N+ VS  D
Sbjct: 1   MTLVDVRTPDPKRFIPGATGDWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A INK SVF RKNYFYPDLPQGYQISQ+  PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAEINKRSVFDRKNYFYPDLPQGYQISQYKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG++ +S+GPD+ GQF  IE+GIER+HLEQDAGKS+HDQ++ +S +DLNRSGVALMEIV+
Sbjct: 121 EGRIVISLGPDRQGQFEDIEIGIERLHLEQDAGKSMHDQHATMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLRSI+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEPFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIGILEDGGEIEQETRLFDPNKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ FI+ ++  +PELPD K+ERF+ E G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 301 LLPLEFDDAFIKTLEADLPELPDDKKERFVRELGLSVYDASVLVSEKAIADYFEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LNR+GK IE TP+SP QLG +IDLI  GTISGKIAKD+F I+  
Sbjct: 361 DGKTAANWVINDLLGALNRTGKDIEQTPVSPAQLGAIIDLIKAGTISGKIAKDLFEIVLT 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VDE+I +NP  V ++  KP + +WFVGQVMK TG
Sbjct: 421 EGGDPAEIVELRGMKQVTDTGAIEKAVDEIIAANPEQVEKVKAKPTMAAWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 481 GKANPQAVQALVKAKLGIEE 500


>gi|190891550|ref|YP_001978092.1| aspartyl/glutamyl-tRNA amidotransferase, B subunit [Rhizobium etli
           CIAT 652]
 gi|229486432|sp|B3PXX8|GATB_RHIE6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|190696829|gb|ACE90914.1| aspartyl/glutamyl-tRNA amidotransferase protein, B subunit
           [Rhizobium etli CIAT 652]
          Length = 500

 Score =  600 bits (1546), Expect = e-169,   Method: Composition-based stats.
 Identities = 344/500 (68%), Positives = 407/500 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV++G+EVHAQ+   SKLFSGAS  FG   N+ VS  D
Sbjct: 1   MTLVDVRTPDPKRFIPGATGDWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A INK S+F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAQINKRSLFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ GQF  IE+GIER+HLEQDAGKS+HDQ++ +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIVISLGPDRQGQFEDIEIGIERLHLEQDAGKSMHDQHATMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLRSI+RYLGTCDGNM+EGSMRADVNVSV RPGEA+GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEAFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIGILEDGGTIEQETRLFDPNKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+   +PELPD K+ERF+ E G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 301 LLPLEFDDAFVTALAADLPELPDDKKERFVRELGLSVYDASVLVSEKAIADYFEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LNR+GK IE TP+SP QLG +IDLI  GTISGKIAKD+F I+  
Sbjct: 361 DGKTAANWVINDLLGALNRTGKDIEQTPVSPAQLGAIIDLIKAGTISGKIAKDLFEIVLT 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VDE+I +NP+ V ++  KP + +WFVGQVMK TG
Sbjct: 421 EGGDPAEIVESRGMKQVTDTGAIEKAVDEIIAANPDQVEKVKAKPTMAAWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 481 GKANPQAVQALVKAKLGIEE 500


>gi|327193635|gb|EGE60518.1| aspartyl/glutamyl-tRNA amidotransferase protein, B subunit
           [Rhizobium etli CNPAF512]
          Length = 500

 Score =  599 bits (1544), Expect = e-169,   Method: Composition-based stats.
 Identities = 343/500 (68%), Positives = 406/500 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV++G+EVHAQ+   SKLFSGAS  FG   N+ VS  D
Sbjct: 1   MTLVDVRTPDPKRFIPGATGDWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A INK S+F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAQINKRSLFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ GQF  IE+GIER+HLEQDAGKS+HDQ++ +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIVISLGPDRQGQFEDIEIGIERLHLEQDAGKSMHDQHATMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLRSI+RYLGTCDGNM+EGSMRADVNVSV RPGEA+GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEAFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIGILEDGGTIEQETRLFDPNKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+   +PELPD K+ERF+ E G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 301 LLPLEFDDAFVTALAADLPELPDDKKERFVRELGLSVYDASVLVSEKAIADYFEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LNR+GK IE TP+SP QLG +IDLI  GTISGKIAKD+F I+  
Sbjct: 361 DGKTAANWVINDLLGALNRTGKDIEQTPVSPAQLGAIIDLIKAGTISGKIAKDLFEIVLT 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P  IVE  G++QVTD  AIEK VDE+I +NP+ V ++  KP + +WFVGQVMK TG
Sbjct: 421 EGGDPAAIVESRGMKQVTDTGAIEKAVDEIIAANPDQVEKVKAKPTMAAWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 481 GKANPQAVQALVKAKLGIEE 500


>gi|116251842|ref|YP_767680.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|166198811|sp|Q1MHI9|GATB_RHIL3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|115256490|emb|CAK07574.1| putative aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit B
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 500

 Score =  597 bits (1539), Expect = e-168,   Method: Composition-based stats.
 Identities = 344/500 (68%), Positives = 408/500 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV++G+EVHAQ+   SKLFSGAS  FG   N+ VS  D
Sbjct: 1   MTLVDVRTPDPKRFIPGATGDWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSMVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A INK S+F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVKQAVRTGLGLKAQINKRSLFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ GQF  IE+GIER+HLEQDAGKS+HDQ++ +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIVISLGPDRQGQFEDIEIGIERLHLEQDAGKSMHDQHATMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLRSI+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEDFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIGILEDGGKIDQETRLFDPNKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ FI+A++  +PELPD K+ERF+ E G+S+YDASVLVS+K+IADYFE +A  R
Sbjct: 301 LLPLEFDDAFIKALEADLPELPDDKKERFVRELGLSIYDASVLVSEKAIADYFEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LNR+GK IE TP+SP QLG +IDLI  GTISGKIAKD+F I+  
Sbjct: 361 DGKTAANWVINDLLGALNRTGKDIEQTPVSPAQLGAIIDLIKAGTISGKIAKDLFEIVLA 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VDE+I +NP+ V ++  KP + +WFVGQVMK TG
Sbjct: 421 EGGDPAEIVEARGMKQVTDTGAIEKAVDEIIAANPDQVEKVKAKPTMAAWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 481 GKANPQAVQALVKAKLGIEE 500


>gi|241204451|ref|YP_002975547.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240858341|gb|ACS56008.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 500

 Score =  594 bits (1532), Expect = e-168,   Method: Composition-based stats.
 Identities = 342/500 (68%), Positives = 408/500 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWEV++G+EVHAQ+   SKLFSGAS  FG   N+ VS  D
Sbjct: 1   MTLVDVRTPDPKRFIPGATGDWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A INK S+F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVRQAVRTGLGLKAQINKRSLFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD+ GQF  IE+GIER+HLEQDAGKS+HDQ++ +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIVISLGPDRQGQFEDIEIGIERLHLEQDAGKSMHDQHATMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLRSI+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEDFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILE+GG I QETRLFDP K ETRS+R+KEDA DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIGILEEGGKIDQETRLFDPGKGETRSMRSKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ FI+A++  +PELPD K+ERF+ E G+S+YDASVLVS+K+IADY+E +A  R
Sbjct: 301 LLPLEFDDAFIKALEVHLPELPDDKKERFVRELGLSIYDASVLVSEKAIADYYEAVAAGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVINDLLG LNR+GK IE TP+SP QLG +IDLI   TISGKIAKD+F I+  
Sbjct: 361 DGKMAANWVINDLLGALNRTGKDIEQTPVSPAQLGAIIDLIKAETISGKIAKDLFEIVLT 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P EIVE  G++QVTD  AIEK VDE+I +NP+ V ++ TKP + +WFVGQVMK TG
Sbjct: 421 EGGDPAEIVEARGMKQVTDTGAIEKAVDEIIAANPDQVEKVKTKPTMAAWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIKE 500
           GKANP  VQ ++K KLGI+E
Sbjct: 481 GKANPQAVQALVKAKLGIEE 500


>gi|254505081|ref|ZP_05117232.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Labrenzia alexandrii DFL-11]
 gi|222441152|gb|EEE47831.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Labrenzia alexandrii DFL-11]
          Length = 493

 Score =  593 bits (1528), Expect = e-167,   Method: Composition-based stats.
 Identities = 311/499 (62%), Positives = 395/499 (79%), Gaps = 6/499 (1%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWE+VIG+EVHAQ++  +KLFSGAS  FG +PN  VS  D
Sbjct: 1   MTIVDARTPDPKKFIKGATGDWEIVIGMEVHAQVTSDAKLFSGASTEFGQDPNNNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINEECVRQAIRTGLGLKAEINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG++ + +  ++      +E+G+ER+HLEQDAGKS+HDQ+ ++S +DLNRSGVALMEIV+
Sbjct: 121 EGEILLDMPDEQ------VEIGVERLHLEQDAGKSLHDQHPSMSFVDLNRSGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RS+ EAKA+LTKLR+ILRYLGTCDGNM++GSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 175 KPDLRSADEAKAYLTKLRTILRYLGTCDGNMDQGSMRADVNVSVRRPGGEFGTRCEIKNV 234

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQ+AILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PD
Sbjct: 235 NSIRFVGQAIEYEARRQMAILEDGGSIDQETRLFDSVKGETRSMRSKEEAHDYRYFPDPD 294

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE  + F+  +   +PELPD K+ RF+ +FG++ YDA VLV++K+ AD+FE++A  R
Sbjct: 295 LLPLEFTQSFVDELAADLPELPDDKKARFVKDFGLTAYDADVLVAEKASADFFEEVAKGR 354

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANW+IN+L G LN+ GK +E +P+S  QLG +IDLI  GTISGKIAKD+F I+W 
Sbjct: 355 DAKLAANWLINELFGRLNKEGKDLETSPVSAAQLGGIIDLIKAGTISGKIAKDVFEIVWT 414

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE+ G++QVTDL AIE +VDE+I +NP+ V +   KPNLV WFVGQVMK + 
Sbjct: 415 EGGDPAQIVEDRGMKQVTDLGAIEAIVDEIITANPDKVEQAKDKPNLVGWFVGQVMKASK 474

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  +LK+K+G++
Sbjct: 475 GKANPQAVNDLLKQKIGLE 493


>gi|114704674|ref|ZP_01437582.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Fulvimarina
           pelagi HTCC2506]
 gi|114539459|gb|EAU42579.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Fulvimarina
           pelagi HTCC2506]
          Length = 499

 Score =  593 bits (1528), Expect = e-167,   Method: Composition-based stats.
 Identities = 334/499 (66%), Positives = 408/499 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +S   G TGDWE++IG+EVHAQ+   SKLFSGAS +FGAE N+ VS  D
Sbjct: 1   MTIVDTRDPNPKSFIPGATGDWEIIIGMEVHAQVLSDSKLFSGASTDFGAEANSHVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A INK SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVRQAVRTGLGLKAQINKRSVFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG V+VS+GP+  G+F  IEVGIER+HLEQDAGKS+HDQ+ ++S +DLNRSGVALMEIV+
Sbjct: 121 EGTVTVSVGPNNQGEFEDIEVGIERLHLEQDAGKSMHDQHPSMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRS+ EAKA+LTKLR+ILRYLGTC+GNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDMRSADEAKAYLTKLRTILRYLGTCNGNMDEGSMRADVNVSVRRPGGPFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIE EARRQIA++EDGG + QETRLFDPSK ETR++R KEDA DYRYF +PD
Sbjct: 241 NSIRFVGQAIESEARRQIALIEDGGMVEQETRLFDPSKGETRAMRNKEDAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ +I A+  ++PELPD K+ RFI E G+S YDAS+LVS+K+IAD++E++A  R
Sbjct: 301 LLPLEFDQAYIDALLSELPELPDDKKNRFIEEGGLSTYDASILVSEKAIADFYEEVAKGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN+ GKSIE+TP+S  QLG ++DLI +GTISGKIAKD+F I+W 
Sbjct: 361 DAKQAANWVINDLLGALNKDGKSIEETPVSAAQLGAILDLIREGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG PK IVE+ G++QVTD  AIEK VD+V+ +N + V +   KP++  WFVGQVMK TG
Sbjct: 421 EGGDPKRIVEDRGMKQVTDTGAIEKAVDDVMAANSDKVEQAKAKPSMAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  ++K+KLG++
Sbjct: 481 GKANPQAVNALVKDKLGVE 499


>gi|170742458|ref|YP_001771113.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           sp. 4-46]
 gi|229486441|sp|B0UHC4|GATB_METS4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|168196732|gb|ACA18679.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           sp. 4-46]
          Length = 490

 Score =  591 bits (1524), Expect = e-167,   Method: Composition-based stats.
 Identities = 324/490 (66%), Positives = 395/490 (80%), Gaps = 5/490 (1%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
             + L  G  GDWEVVIG+E+HAQ++  SKLFSGAS  FGAEPN  VS  DAAMPGMLP+
Sbjct: 6   TPKKLIKGALGDWEVVIGMEIHAQVTSRSKLFSGASTAFGAEPNAHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V + 
Sbjct: 66  INRECVAQAVRTGLGLKAQINHRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGEVLVDLP 125

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
             +     TI VGIER+HLEQDAGKS+HDQ+ ++S +DLNRSGVALMEIV+KPD+RSS E
Sbjct: 126 DGE-----TIRVGIERLHLEQDAGKSLHDQHPSLSFVDLNRSGVALMEIVSKPDLRSSEE 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA++TKLR+ILRYLGTCDG+ME+G++RADVNVSV RPGE +GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRRPGEPFGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IE EARRQIAILEDGG I QETRL+DP++NETRS+R+KE+A DYRYF +PDLLPLEI++ 
Sbjct: 241 IETEARRQIAILEDGGWIEQETRLYDPNRNETRSMRSKEEAHDYRYFPDPDLLPLEIEQA 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWV 369
           FI  ++ ++PELPDAK+ RF+ E+G+S YDA+VLV++++ ADYFE +A  RD K  ANWV
Sbjct: 301 FIDGLRTELPELPDAKKARFVAEYGLSAYDATVLVAERASADYFEAVAKGRDGKAAANWV 360

Query: 370 INDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIV 429
           IN+L G LN+ G  IE +P+S  QLG +IDLI DGTISGKIAKD+F I+W +GG P+ IV
Sbjct: 361 INELFGRLNKEGHGIEGSPVSAAQLGAIIDLIADGTISGKIAKDLFEIVWGEGGDPRAIV 420

Query: 430 EELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
           E  GL+QVTD  AIE  VD++I +NP+ VA+   KP L+ WFVGQ MK TGGKANP+ V 
Sbjct: 421 ESRGLKQVTDTGAIEAAVDQIIAANPDKVAQAKAKPTLLGWFVGQTMKATGGKANPAAVN 480

Query: 490 KMLKEKLGIK 499
            +LK KLGI+
Sbjct: 481 ALLKTKLGIE 490


>gi|328544225|ref|YP_004304334.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [polymorphum gilvum SL003B-26A1]
 gi|326413967|gb|ADZ71030.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Polymorphum gilvum SL003B-26A1]
          Length = 493

 Score =  591 bits (1524), Expect = e-167,   Method: Composition-based stats.
 Identities = 313/499 (62%), Positives = 387/499 (77%), Gaps = 6/499 (1%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  ++      +    G TGDWEVVIG+EVHAQ++  +KLFSGAS  FG +PN  VSF D
Sbjct: 1   MTIVEARKPDPKKFIKGATGDWEVVIGMEVHAQVTSEAKLFSGASTEFGKDPNANVSFVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINEECVRQAIRTGLGLKARINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG + + +          +E+G+ER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGTIVLDMPD------ERVEIGVERLHLEQDAGKSLHDQHPTMSFVDLNRSGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EAKA+LTKLR+ILRYLGTCDGNM++GSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 175 KPDLRSSDEAKAYLTKLRTILRYLGTCDGNMDQGSMRADVNVSVRRPGEPFGTRCEIKNV 234

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PD
Sbjct: 235 NSIRFVGQAIEYEARRQIGILEDGGTIDQETRLFDAVKGETRSMRSKEEAHDYRYFPDPD 294

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE  + ++  +   +PELPD K+ RF+ ++G++ YDA VLV++K  AD+FE++A  R
Sbjct: 295 LLPLEFTQAYVDDLAAHLPELPDDKKGRFVADYGLTAYDADVLVAEKVSADFFEQVAQGR 354

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVIN+L G LN+ G  +  +P+S  QLG +IDLI  GTISGKIAKD+F I+W 
Sbjct: 355 DAKVAANWVINELFGRLNKEGLDVSTSPVSAAQLGAIIDLIRAGTISGKIAKDLFEIVWS 414

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P  IVE  G++QVTDL AIEKVVDE+I +NP+ VA+   KP L+ WFVGQVMK + 
Sbjct: 415 EGGDPAAIVEARGMKQVTDLGAIEKVVDEIIAANPDKVAQAKEKPTLLGWFVGQVMKASQ 474

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  +LK K+GI+
Sbjct: 475 GKANPQAVNDLLKAKIGIE 493


>gi|148266333|ref|YP_001233039.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Geobacter
           uraniireducens Rf4]
 gi|189045142|sp|A5G9J8|GATB_GEOUR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|146399833|gb|ABQ28466.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Geobacter uraniireducens Rf4]
          Length = 479

 Score =  591 bits (1523), Expect = e-167,   Method: Composition-based stats.
 Identities = 239/484 (49%), Positives = 316/484 (65%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             ++VVIG+EVH QL   SK+F G S  FGAEPN+Q       MPG LP+LN + V+ A+
Sbjct: 1   MKYQVVIGLEVHVQLLTNSKIFCGCSTRFGAEPNSQTCPVCLGMPGALPVLNKKVVEYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL  N  I   SVFARKNYFYPDLP+GYQISQ + PI  +G + + +      +    
Sbjct: 61  RAGLATNCRIAPRSVFARKNYFYPDLPKGYQISQFELPICIDGHLDIEV------EGGMK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSA---VSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            +GI RIH+E+DAGK +H         SC+DLNR+   L+EIV++PDMRS+ EA A+L K
Sbjct: 115 RIGITRIHMEEDAGKLVHADVPGVGDDSCVDLNRACTPLLEIVSEPDMRSADEAVAYLKK 174

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L  I+ YLG  DGNMEEGS R D NVSV     + +GTR E KNVNS +F+  AIEYE  
Sbjct: 175 LHQIVVYLGISDGNMEEGSFRCDANVSVMPAGSDKFGTRTETKNVNSFKFVKQAIEYEIE 234

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++E+GG I QETRLFDP+   TRS+R KE+A DYRYF +PDL+PL I  D++   +
Sbjct: 235 RQIEVIEEGGKIVQETRLFDPNTGSTRSMRGKEEAHDYRYFPDPDLVPLVIGNDWVEDAR 294

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLL 374
             +PELPDAKR+R+  E G+ +YDA VL + + +A YFE     +   K VANWV+ ++ 
Sbjct: 295 LSLPELPDAKRQRYTDELGLPVYDAEVLTATRELAGYFEACLALSPQPKPVANWVMGEVT 354

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
             LN   +SI D P++P  L +L+ LI  GTISGKIAK +F+ +W  G  P++IVEE GL
Sbjct: 355 RALNEENRSIADCPVTPPLLADLLRLIEKGTISGKIAKTVFDEMWRSGKAPEKIVEEKGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            QV+D  AIE ++DEV+      V      K  L  +FVGQVM+ + GKANP++V ++L 
Sbjct: 415 VQVSDTGAIEAIIDEVLAKEAGQVEEYRSGKDKLFGFFVGQVMRASKGKANPALVNEILL 474

Query: 494 EKLG 497
           +KL 
Sbjct: 475 KKLN 478


>gi|163868077|ref|YP_001609281.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bartonella
           tribocorum CIP 105476]
 gi|189045269|sp|A9ISC3|GATB_BART1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|161017728|emb|CAK01286.1| glutamyl-tRNA amidotransferase subunit B [Bartonella tribocorum CIP
           105476]
          Length = 499

 Score =  591 bits (1523), Expect = e-166,   Method: Composition-based stats.
 Identities = 341/498 (68%), Positives = 410/498 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT    S+   SG TGDWEV+IG+EVHAQ+   SKLFSGAS  FGAEPN  VS  D
Sbjct: 1   MSIIDTRTPDSKHFISGVTGDWEVIIGMEVHAQIISNSKLFSGASAKFGAEPNNHVSLID 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP+LN  CV+QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVLNEECVRQAVRTGLGLKARINLKSVFDRKNYFYPDLPQGYQISQFHYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +S+GPD +GQF  IEVGIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIIISVGPDSNGQFEDIEVGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGEDFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEDGGVIEQETRLFDATKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ ++   +PELPDA + RF+ E G+++YDAS+LV++K+IADYFE++A  R
Sbjct: 301 LLPLEFDQAFVDSLAADLPELPDAIKARFVKEMGLTVYDASILVTEKAIADYFEEVAYGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D KIVANWVINDLLG LN+  + IE++P+SPNQLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKIVANWVINDLLGALNKDNREIEESPVSPNQLGSIIDLIKEGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P++IVEE  ++QVTD  AIE+ VDE++ +N + VA+   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPRQIVEERSMKQVTDTKAIERAVDEIVANNADKVAQAKQKPALAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V +++K KLGI
Sbjct: 481 GKANPQTVNELVKMKLGI 498


>gi|319407119|emb|CBI80756.1| glutamyl-tRNA amidotransferase subunit B [Bartonella sp. 1-1C]
          Length = 499

 Score =  591 bits (1523), Expect = e-166,   Method: Composition-based stats.
 Identities = 340/498 (68%), Positives = 408/498 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT +   +   SGTTGDWEV+IG+EVHAQ+   SKLFSGAS  FGAEPN  VS  D
Sbjct: 1   MEIVDTRLPDPKRFISGTTGDWEVIIGMEVHAQVISNSKLFSGASTKFGAEPNNHVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  C++QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINQACIRQAVRTGLGLKAKINLKSVFDRKNYFYPDLPQGYQISQFQYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGKV VS GPD +GQF  IE+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKVVVSTGPDSNGQFEDIEIGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVN+SV RPG  +GTRCEVKNV
Sbjct: 181 KPDMRSSEEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNISVRRPGGPFGTRCEVKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEDGGVIDQETRLFDATKGETRSMRSKEEAYDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE+D+ F+  +  ++PELPD  + RFI E G++ YDAS+LV++K+IADYFE++A  R
Sbjct: 301 LLPLELDQVFVDTLASELPELPDDIKARFINEMGLTAYDASILVTEKAIADYFEEVAHGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+VANWVINDLLG LN+  + IEDTPI+ NQLG +IDLI DGTISGKIAKD+F I+W 
Sbjct: 361 DGKMVANWVINDLLGALNKDNRDIEDTPITANQLGAIIDLIKDGTISGKIAKDLFEIIWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE+ G++QVTD   IE+VVDE+I +NP+ V++   KP L+ WFVGQVMK T 
Sbjct: 421 EGGDPHQIVEKRGMKQVTDAGVIERVVDEIIINNPDKVSQAREKPALIGWFVGQVMKATE 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V K++K KLG+
Sbjct: 481 GKANPQTVNKLVKSKLGV 498


>gi|121997793|ref|YP_001002580.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Halorhodospira
           halophila SL1]
 gi|166217763|sp|A1WVR6|GATB_HALHL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|121589198|gb|ABM61778.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Halorhodospira halophila SL1]
          Length = 479

 Score =  591 bits (1523), Expect = e-166,   Method: Composition-based stats.
 Identities = 240/482 (49%), Positives = 330/482 (68%), Gaps = 9/482 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+E+HAQL+  +K+FSGA   +GAEPNTQ    D  +PG+LP+LN   V+ A+
Sbjct: 1   MKWETVIGLEIHAQLATRTKIFSGAPTAYGAEPNTQACPVDLGLPGVLPVLNREVVRMAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL ++A I   SVFARKNYFYPDLP+GYQISQ+D PIV  G + + +         + 
Sbjct: 61  KFGLAVDARIAPRSVFARKNYFYPDLPKGYQISQYDLPIVEGGHLDIELED-----GASK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +  ++ +DLNR+G  LMEIV++PD+RS  EA A++ KL +
Sbjct: 116 RIGITRAHLEEDAGKSLHEDFHGMTGVDLNRAGTPLMEIVSEPDLRSPAEAAAYMKKLHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYL  CDGNM+EGS R D NVSV   G+  +GTR E+KN+NS RF+  A+EYE  RQI
Sbjct: 176 LVRYLEICDGNMQEGSFRCDANVSVRPVGQEAFGTRAELKNLNSFRFVERALEYEVERQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE GG + QETRL+D  K  TRS+RTKE+A DYRYF EPDLLP+E+D   +  +++ +
Sbjct: 236 DLLESGGEVVQETRLYDVDKGVTRSMRTKEEANDYRYFPEPDLLPVEVDAALVDEVRETL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK--LAVNRDKKIVANWVINDLLGV 376
           PELPD KR RF  E+G+  YDA VL + + +AD+FE          K  AN ++++LL  
Sbjct: 296 PELPDEKRRRFEEEYGLPAYDAGVLTATRDMADFFEHAVSESGGFAKRTANLLMSELLAY 355

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN+ G  I ++P++P  LG+L+  + D T+S + AKD+F  +W   G P E++E+ GL+Q
Sbjct: 356 LNKDGLEIAESPVTPEMLGKLVARVEDETLSSRGAKDVFEAMWAGEGEPDEVIEKKGLKQ 415

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           VTD SAIE +VDE I +NP  + +    K  L  +FVGQVMK +GGKANP  V ++LK+K
Sbjct: 416 VTDTSAIEALVDEAIANNPQQLEQYRAGKEKLFGFFVGQVMKASGGKANPQQVNELLKKK 475

Query: 496 LG 497
           L 
Sbjct: 476 LD 477


>gi|304320045|ref|YP_003853688.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Parvularcula
           bermudensis HTCC2503]
 gi|303298948|gb|ADM08547.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Parvularcula
           bermudensis HTCC2503]
          Length = 488

 Score =  590 bits (1522), Expect = e-166,   Method: Composition-based stats.
 Identities = 306/490 (62%), Positives = 371/490 (75%), Gaps = 5/490 (1%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           R      G TG+WEVVIG+EVHAQ++  +KLFSGAS  +GA PN  VS  DAA PGMLP+
Sbjct: 4   RPLKYLQGETGEWEVVIGLEVHAQVASNAKLFSGASAQYGAGPNENVSLVDAAFPGMLPV 63

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QAV TGLGLNA IN +S F RKNYFYPDLPQGYQISQ+  PIVGEG + V + 
Sbjct: 64  INRYCVEQAVRTGLGLNAKINLWSRFDRKNYFYPDLPQGYQISQYKDPIVGEGMIEVELD 123

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
             +     T+E+GIER+HLEQDAGKSIHD     S +DLNRSGVALMEIV+KPDMRS+ E
Sbjct: 124 DGE-----TVEIGIERLHLEQDAGKSIHDLSPKESYVDLNRSGVALMEIVSKPDMRSAEE 178

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
             A+ +KLR+ILRYLGTCDGNME+GSMRADVNVSV RPG+A GTR E KNVNSIRF+   
Sbjct: 179 GAAYFSKLRTILRYLGTCDGNMEQGSMRADVNVSVRRPGDALGTRTETKNVNSIRFVRQV 238

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           I+YEARRQI +LE GG I QETRLFD    ETR++RTKEDA DYRYF +PDLLPLE++E 
Sbjct: 239 IDYEARRQIEVLEAGGTIDQETRLFDVKTGETRTMRTKEDAHDYRYFPDPDLLPLELEEA 298

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWV 369
            I  I+ ++PELPD K+ RF+  +G+S+YDASVL +D+  ADYFE +A  RD K+ ANWV
Sbjct: 299 MIERIRAELPELPDQKKRRFVDAYGLSVYDASVLAADREKADYFETVADGRDGKLAANWV 358

Query: 370 INDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIV 429
             +L  VLN+   +I ++P+    LGELIDLI DGTISGKIAK +F I+ ++GG P+ IV
Sbjct: 359 TTELFAVLNKRDLTIAESPVPAAHLGELIDLIQDGTISGKIAKQVFEIMLDEGGAPRAIV 418

Query: 430 EELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
           +E GL+QVTD  AIE  VD+VI  NP  V ++  KP  + WFVGQVMK TGGKANP  V 
Sbjct: 419 DERGLKQVTDTGAIEAAVDKVIAENPAQVEKVKEKPKTLGWFVGQVMKETGGKANPQAVN 478

Query: 490 KMLKEKLGIK 499
            +LKEKLG++
Sbjct: 479 AILKEKLGVE 488


>gi|240850280|ref|YP_002971673.1| glutamyl-tRNA amidotransferase subunit B [Bartonella grahamii
           as4aup]
 gi|240267403|gb|ACS50991.1| glutamyl-tRNA amidotransferase subunit B [Bartonella grahamii
           as4aup]
          Length = 499

 Score =  590 bits (1521), Expect = e-166,   Method: Composition-based stats.
 Identities = 341/498 (68%), Positives = 410/498 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT    S+   SG TGDWEV+IG+EVHAQ+   SKLFSGAS  FGAEPN  VS  D
Sbjct: 1   MSIIDTRTPDSKRFISGVTGDWEVIIGMEVHAQIISNSKLFSGASTKFGAEPNNHVSLID 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP+LN  CV+QAV TGLGL AHIN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVLNQECVRQAVRTGLGLKAHINLKSVFDRKNYFYPDLPQGYQISQFRYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+++S+GPD +GQF  IEVGIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKITISVGPDSNGQFEDIEVGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGENFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILE+GG I QETRLFD +K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEEGGVIDQETRLFDAAKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+   +PELPDA + RF+ E G+++YDAS+LV++K+IADYFE++A  R
Sbjct: 301 LLPLEFDQAFVDALAADLPELPDAIKARFVKEMGLTVYDASILVTEKAIADYFEEVARGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D KIVANWVINDLLG LN+  + IE++P+SPNQLG +IDLI +G ISGKIAKD+F I+W 
Sbjct: 361 DGKIVANWVINDLLGALNKDNREIEESPVSPNQLGSIIDLIKEGVISGKIAKDLFEIIWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG  ++IVEE  ++QVTD  AIE+ VDE+I +N + VA+   KP L  WFVGQVMK TG
Sbjct: 421 EGGDARQIVEERNMKQVTDTKAIERAVDEIIANNSDKVAQAKQKPALSGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V +++K KLGI
Sbjct: 481 GKANPQTVNELVKIKLGI 498


>gi|90417717|ref|ZP_01225629.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337389|gb|EAS51040.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 499

 Score =  590 bits (1521), Expect = e-166,   Method: Composition-based stats.
 Identities = 324/499 (64%), Positives = 400/499 (80%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     ++  SG TGDWE+V+G+EVHAQ++  +KLFSGAS +FG  PN  VS  D
Sbjct: 1   MTLVDTRTPDPKNFISGATGDWEIVVGMEVHAQVTSEAKLFSGASTDFGGAPNDHVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A I   SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEECVRQAVRTGLGLKAEIKHRSVFDRKNYFYPDLPQGYQISQFKDPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG VSVS+GPD  G+F  I VG+ER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGIVSVSVGPDSKGEFEEIAVGVERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRS+ EAKA+LTKLR+ILRYLGTCDGNM+EGSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 181 KPDMRSADEAKAYLTKLRTILRYLGTCDGNMDEGSMRADVNVSVRRPGGDFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G  IE EARRQ+AILEDGG I QETRL+DP+K ETR++R+KE+A DYRYF +PD
Sbjct: 241 NSIRFVGQCIEAEARRQVAILEDGGAIDQETRLYDPAKGETRAMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ ++ A+ + +PELPDAK+ R I + G+S YDAS+LVS+K+IADY+E +A  R
Sbjct: 301 LLPLEFDQAYVDALLEGLPELPDAKKNRLIRDAGLSAYDASILVSEKAIADYYEAVAKGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  ANWVINDLLG LN++GK I +TP++  QLG ++D+I   TISGKIAKD+F I+W 
Sbjct: 361 DAKQAANWVINDLLGALNKAGKDIGETPVAAEQLGAILDMIRAETISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P++IV+E G++QVTD  AIE  VDEVI +NP+ V +   KP +  WFVGQVMK TG
Sbjct: 421 EGGDPEKIVDERGMKQVTDTGAIETAVDEVIAANPDKVEQARAKPTMAGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  ++K+KLG++
Sbjct: 481 GKANPQAVNALVKQKLGLE 499


>gi|77919763|ref|YP_357578.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pelobacter
           carbinolicus DSM 2380]
 gi|109892043|sp|Q3A2J9|GATB_PELCD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|77545846|gb|ABA89408.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Pelobacter carbinolicus DSM 2380]
          Length = 478

 Score =  589 bits (1519), Expect = e-166,   Method: Composition-based stats.
 Identities = 235/481 (48%), Positives = 327/481 (67%), Gaps = 10/481 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  +EVVIG+EVH QL+  +K+F   S+ FG +PN+Q       +PG LP+LN + V+ A
Sbjct: 2   TSRYEVVIGLEVHVQLTTQTKIFCNCSIAFGNQPNSQTCPVCLGLPGALPVLNRKVVEYA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           + TGL  N  I   S+FARKNYFYPDLP+GYQISQ + PI   G++ + +         +
Sbjct: 62  IKTGLATNCSIAPRSIFARKNYFYPDLPKGYQISQFELPICEHGRLDIDVDGT------S 115

Query: 139 IEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
             +GI RIH+E+DAGK +HD     S +DLNR+   LMEIV++PDMRSS EA A+L KL 
Sbjct: 116 KSIGITRIHMEEDAGKLLHDDG-DTSRVDLNRACTPLMEIVSEPDMRSSDEAIAYLKKLH 174

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
            I+ YLG CDGN+EEGS R D NVS+     + +GTR E+KN+NS RF+  AI+YE  RQ
Sbjct: 175 QIVVYLGVCDGNLEEGSFRCDANVSIRPWGQKEFGTRAELKNINSFRFIKQAIDYEIERQ 234

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
             IL+DGG + QETRLFD +   TRS+R+KE+A DYRYF +PDL+PL + +D++  I+++
Sbjct: 235 ADILDDGGTVVQETRLFDTASGTTRSMRSKEEAHDYRYFPDPDLVPLIVSDDWVEQIRRE 294

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGV 376
           +PELP+AK  RF+GE GI  YDA VL +D+++A+Y++  +  + + K+ ANWV+ +L   
Sbjct: 295 LPELPEAKIARFVGELGIPQYDAEVLAADRAMAEYYDSLVKAHGNAKLCANWVMGELQRA 354

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN SG  I + P++P  L  ++  I D TIS KIAK +F+ +W+ G     I+EE GL+Q
Sbjct: 355 LNDSGAGIAECPVTPPMLAGILQRIDDNTISNKIAKTVFDAMWQSGKDADTIIEEQGLKQ 414

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           VTD  AIE V+DEV+ +NP+ V      K  L+ +FVGQVM+ T GKANP  + ++LK+K
Sbjct: 415 VTDTGAIEAVIDEVLAANPSQVEEYRGGKDKLMGFFVGQVMRATKGKANPKTLNELLKKK 474

Query: 496 L 496
           L
Sbjct: 475 L 475


>gi|49474319|ref|YP_032361.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bartonella
           quintana str. Toulouse]
 gi|81647008|sp|Q6FZK7|GATB_BARQU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|49239823|emb|CAF26214.1| Glutamyl-tRNA amidotransferase subunit b [Bartonella quintana str.
           Toulouse]
          Length = 499

 Score =  589 bits (1518), Expect = e-166,   Method: Composition-based stats.
 Identities = 336/498 (67%), Positives = 414/498 (83%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT +  S+   SG TGDWEV+IG+EVHAQ+   SKLFSGAS  FGAEPN  VS  D
Sbjct: 1   MGIIDTRIPDSKRFISGVTGDWEVIIGMEVHAQIISNSKLFSGASTKFGAEPNNHVSLID 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL AHIN  SVF RKNYFYPDLPQGYQISQ   P+VG
Sbjct: 61  AAMPGMLPVINQECVRQAVRTGLGLKAHINLKSVFDRKNYFYPDLPQGYQISQFRYPVVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+++SIGPD +GQF  IE+GIER+HLEQDAGKSIHDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKITISIGPDPNGQFEDIEIGIERLHLEQDAGKSIHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGENFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEDGGVIDQETRLFDAAKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD  + RFI + G++ YDAS+LV++++IADYFE++A  R
Sbjct: 301 LLPLEFDQAFVDALAVELPELPDDIKARFINKMGLTPYDASILVAERAIADYFEEVACGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVINDLLG LN+   +IE+TP++P+QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKMAANWVINDLLGALNKDNCAIEETPVAPSQLGAIIDLIKEGTISGKIAKDLFEIIWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P+++VEE  ++QVTD+ AIE+ VDE++++N + VA+   KP L+ WFVGQVMK TG
Sbjct: 421 EGGDPRQVVEERNMKQVTDIKAIERAVDEIVSNNSDKVAQAKQKPTLIGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V +++K KLGI
Sbjct: 481 GKANPQTVNELVKVKLGI 498


>gi|49475386|ref|YP_033427.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bartonella
           henselae str. Houston-1]
 gi|81648033|sp|Q6G3Y7|GATB_BARHE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|49238192|emb|CAF27402.1| Glutamyl-tRNA amidotransferase subunit b [Bartonella henselae str.
           Houston-1]
          Length = 499

 Score =  588 bits (1517), Expect = e-166,   Method: Composition-based stats.
 Identities = 341/498 (68%), Positives = 409/498 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT    S+   SG TGDWEV+IG+EVHAQ+   SKLFSGAS  FGAEPN  VS  D
Sbjct: 1   MEIVDTRTPNSKRFISGVTGDWEVIIGMEVHAQIISNSKLFSGASTKFGAEPNNHVSLID 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP+LN  CV+QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVLNQECVRQAVRTGLGLKARINLRSVFDRKNYFYPDLPQGYQISQFRYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ +SIGPD +GQF  IEVGIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKIIISIGPDSNGQFEDIEVGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRS+ EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPGE++GTRCE+KNV
Sbjct: 181 KPDMRSADEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGESFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEDGGVIDQETRLFDAAKGETRSMRSKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD  + RFI E G++ YDAS+LV++K+IA+YFEK+A  R
Sbjct: 301 LLPLEFDQAFVDALAAELPELPDDIKIRFINEMGLTAYDASILVTEKAIANYFEKVAHGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K VANWVINDLLG LN+  + IE+TP+SP+QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKTVANWVINDLLGALNKDNREIEETPVSPDQLGSIIDLIKEGTISGKIAKDLFEIIWH 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P++IVEE  ++QVTD  AIE+ VDE++ +N + VA+   KP L  WFVGQVMK TG
Sbjct: 421 EGGDPRQIVEERNMKQVTDTKAIERAVDEIMANNSDKVAQAKQKPALAGWFVGQVMKTTG 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V +++K KLGI
Sbjct: 481 GKANPQTVNELVKLKLGI 498


>gi|222053490|ref|YP_002535852.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacter sp.
           FRC-32]
 gi|254790950|sp|B9LZ19|GATB_GEOSF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|221562779|gb|ACM18751.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacter sp.
           FRC-32]
          Length = 479

 Score =  588 bits (1517), Expect = e-166,   Method: Composition-based stats.
 Identities = 237/483 (49%), Positives = 316/483 (65%), Gaps = 12/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++  VIG+EVH QL+  +K+F G S  FGAEPN+Q       MPG LP+LN + V+ A+
Sbjct: 1   MEYRAVIGLEVHVQLNTNTKIFCGCSTKFGAEPNSQTCPVCLGMPGALPVLNRKVVEYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL  N  I   S+FARKNYFYPDLP+GYQISQ++ PI   G + + +           
Sbjct: 61  KAGLATNCEIAPRSIFARKNYFYPDLPKGYQISQYELPICSAGHLDIQVEGT------AK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSA---VSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            +GI RIH+E+DAGK +H         SC+DLNR+   L+EIV++PD+RS+ EA A+L K
Sbjct: 115 RIGITRIHMEEDAGKLVHADVPGVGDDSCVDLNRACTPLLEIVSEPDLRSADEAVAYLKK 174

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSV-CRPGEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L  I+ YLG  DGNMEEGS R D NVSV     + +GTR E KNVNS +F+  AIEYE  
Sbjct: 175 LHQIVVYLGISDGNMEEGSFRCDANVSVMRVGADKFGTRTETKNVNSFKFVKQAIEYEIE 234

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++EDGG I QETRLFDP+   TRS+R KE+A DYRYF +PDL+PL I  D++  ++
Sbjct: 235 RQIEVIEDGGKIVQETRLFDPNTGVTRSMRGKEEAHDYRYFPDPDLVPLVISNDWVEDVR 294

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLL 374
             +PELP+AKR R++ E G+  YDA VL + + +ADYFE     +   K VANWV+ ++ 
Sbjct: 295 LGLPELPEAKRLRYMDELGLPAYDAEVLTASRELADYFEACLEFHSQPKPVANWVMGEVT 354

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
             LN   +SI D P++P  L EL+ LI  GTISGKIAK +F+ +W  G  P ++VEE GL
Sbjct: 355 RALNEENRSITDAPVTPQLLAELLQLIDKGTISGKIAKTVFDEMWRTGKAPAKVVEEKGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            QV+D   IEK++DEV+      VA     K  L  +FVGQVM+ + GKANP++V ++L 
Sbjct: 415 VQVSDTGEIEKIIDEVLAREAGQVAEYRSGKDKLFGFFVGQVMRASKGKANPAVVNELLL 474

Query: 494 EKL 496
           +KL
Sbjct: 475 KKL 477


>gi|319404105|emb|CBI77695.1| glutamyl-tRNA amidotransferase subunit B [Bartonella rochalimae
           ATCC BAA-1498]
          Length = 499

 Score =  587 bits (1513), Expect = e-165,   Method: Composition-based stats.
 Identities = 338/498 (67%), Positives = 405/498 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D  +   +   SG TGDWEV+IG+EVHAQ+   SKLFSGAS  FGAEPN  VS  D
Sbjct: 1   MKIVDARLPDPKRFISGATGDWEVIIGMEVHAQVISNSKLFSGASTKFGAEPNNHVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  C++QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINQACIRQAVRTGLGLKAKINLKSVFDRKNYFYPDLPQGYQISQFQYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGKV VSIGPD +GQF  IE+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKVVVSIGPDSNGQFEDIEIGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVN+SV RPG  +GTRCEVKNV
Sbjct: 181 KPDMRSSEEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNISVRRPGGPFGTRCEVKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEDGGVIDQETRLFDATKGETRSMRSKEEAYDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE+D+ F+  +  ++PELPD  + RFI E G++ YDAS+LV++K+IADYFE++A  R
Sbjct: 301 LLPLELDQVFVDTLASELPELPDDIKARFINEMGLTAYDASILVTEKAIADYFEEVAHGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+VANWVINDLLG LN+  + IEDTPI+ NQLG +IDLI  GTISGKIAKD+F I+W 
Sbjct: 361 DGKMVANWVINDLLGALNKDNRDIEDTPITANQLGAIIDLIKVGTISGKIAKDLFEIIWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE+ G++QVTD   IE+ VDE+I +NP+ V++   KP L+ WFVGQVMK T 
Sbjct: 421 EGGDPHQIVEKRGMKQVTDAGVIERAVDEIIINNPDKVSQAREKPALIGWFVGQVMKATE 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V K++K KLGI
Sbjct: 481 GKANPQTVNKLVKSKLGI 498


>gi|319408370|emb|CBI82023.1| glutamyl-tRNA amidotransferase subunit B [Bartonella
           schoenbuchensis R1]
          Length = 499

 Score =  587 bits (1512), Expect = e-165,   Method: Composition-based stats.
 Identities = 338/498 (67%), Positives = 406/498 (81%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT         SG TGDWEV+IG+EVHAQ++  SKLFSGAS  FGAEPN  VSF D
Sbjct: 1   MEIVDTRTPDPRCFISGATGDWEVIIGMEVHAQITSDSKLFSGASTKFGAEPNNHVSFID 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINQECVRQAIRTGLGLKAKINLRSVFDRKNYFYPDLPQGYQISQFQYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGKV VS+GPD +GQF  IE+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKVVVSVGPDSNGQFEDIEIGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 181 KPDMRSSDEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGEVFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFD +K ETRS+R KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEDGGVIDQETRLFDAAKGETRSMRLKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PE PD  + RFI E G++ YDAS+LV++K+IADYFE++A  R
Sbjct: 301 LLPLEFDQAFVDALAAELPEFPDDIKLRFINEMGLTAYDASILVTEKAIADYFEEVARGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D KIVANWVINDLLG LN+  + IEDTP++P+QLG +IDLI +G ISGKIAKD+F I+W 
Sbjct: 361 DGKIVANWVINDLLGALNKDNREIEDTPVTPDQLGAIIDLIKEGVISGKIAKDLFEIIWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P+++VEE G++QVTD   I+ VVDE+I +N + VA+   KP L+ WFVGQVMK TG
Sbjct: 421 EGGDPRQVVEERGMKQVTDTEVIKGVVDEIIANNSDKVAQAREKPALIGWFVGQVMKATG 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V +++K KL I
Sbjct: 481 GKANPQAVNELVKTKLKI 498


>gi|114319328|ref|YP_741011.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|122312679|sp|Q0ACB6|GATB_ALHEH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|114225722|gb|ABI55521.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 478

 Score =  587 bits (1512), Expect = e-165,   Method: Composition-based stats.
 Identities = 243/482 (50%), Positives = 334/482 (69%), Gaps = 9/482 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +WE VIG+E+HAQL+  SK+FSGA+  +GAEPN Q    D  MPG+LP+LN   V+ A 
Sbjct: 1   MEWETVIGLEIHAQLATKSKIFSGAATAYGAEPNRQACAVDLGMPGVLPVLNKGAVRMAT 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I   SVFARKNYFYPDLP+GYQISQ++ PIV  G++ + +   +       
Sbjct: 61  KFGLAIGAKIAPRSVFARKNYFYPDLPKGYQISQYELPIVEGGELWIELEDGE-----RK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +G+ R HLE+DAGKS+H+ +  ++ +DLNR+G  L+EIV++PD+RS+ EA A++ KL +
Sbjct: 116 RIGVTRAHLEEDAGKSLHEDFHGMTGVDLNRAGTPLLEIVSEPDLRSAAEAAAYMKKLHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYL  CDGNM+EGS R D NVSV     E +GTR E+KN+NS RF+  AI YE  RQI
Sbjct: 176 LVRYLEICDGNMQEGSFRCDANVSVRPKGEEKFGTRAELKNLNSFRFVERAINYEVERQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
           A++E GG + QETRL+D  K ETRS+RTKE+A DYRYF +PDLLP+E+D  FI  +++ +
Sbjct: 236 ALIESGGTVVQETRLYDADKGETRSMRTKEEANDYRYFPDPDLLPVELDPTFIEEVRETL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK--LAVNRDKKIVANWVINDLLGV 376
           PELPD KR RF+ E+G+S YDA VL + + +A+++E          K  ANWV  D LG 
Sbjct: 296 PELPDEKRARFVEEYGLSDYDAGVLTATRELAEFYESVVTESGGFAKRSANWVQGDFLGA 355

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++G  + D+P++P  LG L+  I D TISG++AK++F  +W   G P +I+E  GL+Q
Sbjct: 356 LNKAGLELADSPVTPEMLGRLVARIEDETISGRVAKEVFEAMWNGEGEPDQIIEAKGLKQ 415

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           VTD  AIE ++DEV+ +NP  V +    K  L+ +FVGQVMK + GKANP  V ++LKEK
Sbjct: 416 VTDTGAIEAMIDEVLAANPKQVEQYKGGKDKLLGFFVGQVMKASRGKANPGQVNELLKEK 475

Query: 496 LG 497
           L 
Sbjct: 476 LD 477


>gi|260892976|ref|YP_003239073.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Ammonifex degensii
           KC4]
 gi|260865117|gb|ACX52223.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Ammonifex degensii
           KC4]
          Length = 479

 Score =  586 bits (1511), Expect = e-165,   Method: Composition-based stats.
 Identities = 233/485 (48%), Positives = 304/485 (62%), Gaps = 11/485 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+E+H +L   SK+F G    FGAEPNT V      +PG LP+LN R V+ A+
Sbjct: 1   MNYEAVIGLEIHVELKTESKIFCGCRAAFGAEPNTHVCPVCLGLPGTLPVLNRRAVEYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           M  L LN  I  Y  F RKNYFYPDLP+ YQISQ D P+   G + +             
Sbjct: 61  MAALALNCEITPYCKFDRKNYFYPDLPKNYQISQFDLPLARNGYLEIDTPSG------PK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSC--IDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
            VGI R+HLE+DAGK +H QY   S   +D NR+GV L+EIV+ PD+RS  EA+A+  KL
Sbjct: 115 RVGIVRLHLEEDAGKLVHVQYGDSSYALVDYNRAGVPLIEIVSAPDLRSPEEARAYAEKL 174

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARR 256
           R I+ YLG  D  MEEGS+R D NVSV   G    G + E+KNVNS R L  A+ YE  R
Sbjct: 175 RQIMLYLGISDCKMEEGSLRVDANVSVRPAGSDILGVKTEIKNVNSFRSLARALTYEIER 234

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
            IA LE G  I QETR +D  +  T S+R+KE+A DYRYF EPDL PL ID +++ +++K
Sbjct: 235 HIACLERGEEIVQETRAWDEERGITFSMRSKEEAHDYRYFPEPDLPPLVIDAEWVESLRK 294

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLG 375
            +PELPDAKR RFI E+G+    A+VL +   +ADYFE+        + VANWV+ +L  
Sbjct: 295 ALPELPDAKRRRFIEEYGLPENAATVLTATPEVADYFEETLKFYPQPRQVANWVMGELAR 354

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            LN +G  I  +P+ P  L +L+ LI  GTISGKIAKD+F  ++  G   + IV+E GL 
Sbjct: 355 CLNAAGIPITASPVKPQALAQLLKLIDAGTISGKIAKDVFEEMFATGKDAESIVKEKGLT 414

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q+TD   I +VV EVI +NP  VA     K   +S+ VGQVMK T G+ANP +V ++LKE
Sbjct: 415 QITDEEVIRQVVREVIAANPKVVADYKGGKEKALSFLVGQVMKATRGRANPGLVNQLLKE 474

Query: 495 KLGIK 499
           +L  +
Sbjct: 475 ELSRE 479


>gi|220923244|ref|YP_002498546.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Methylobacterium
           nodulans ORS 2060]
 gi|254790957|sp|B8IL55|GATB_METNO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|219947851|gb|ACL58243.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           nodulans ORS 2060]
          Length = 490

 Score =  586 bits (1510), Expect = e-165,   Method: Composition-based stats.
 Identities = 326/490 (66%), Positives = 392/490 (80%), Gaps = 5/490 (1%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
             + L  G  GDWEVVIG+E+HAQ++  SKLFSGAS  FGAEPN  VS  DAAMPGMLP+
Sbjct: 6   NPKKLIKGALGDWEVVIGMEIHAQVTSRSKLFSGASTAFGAEPNDNVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V + 
Sbjct: 66  INRECVAQAVRTGLGLKAQINHRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGEVLVDLP 125

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
                +  TI VGIER+HLEQDAGKS+HDQ+ ++S +DLNRSGVALMEIV+KPD+RS+ E
Sbjct: 126 -----EGETIRVGIERLHLEQDAGKSLHDQHPSLSFVDLNRSGVALMEIVSKPDLRSAEE 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA++TKLR+ILRYLGTCDG+ME+G++RADVNVSV RPGE  GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRRPGEFLGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IE EARRQIAILEDGG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLPLEID+ 
Sbjct: 241 IEAEARRQIAILEDGGVIEQETRLFDPNKGETRSMRSKEEAHDYRYFPDPDLLPLEIDDA 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWV 369
           FI  +K ++PELPD K+ RF+ E+G+S YDA+VLV++++ ADYFE +A  RD K  ANWV
Sbjct: 301 FIDELKTELPELPDTKKARFVAEYGLSAYDATVLVAERASADYFEAVARGRDGKAAANWV 360

Query: 370 INDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIV 429
           IN+L G LN+ G  IED+P+S  QLG +IDLI DGTISGKIAKD+F I+W +GG P+ IV
Sbjct: 361 INELFGRLNKEGHGIEDSPVSAEQLGAIIDLIADGTISGKIAKDLFEIVWSEGGDPRAIV 420

Query: 430 EELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
           E  GLRQVTD  AIE  VD++I +NP+ V +   KP L+ WFVGQ MK TGGKANP+ V 
Sbjct: 421 ESRGLRQVTDTGAIEAAVDQIIAANPDKVVQAQAKPTLLGWFVGQTMKATGGKANPAAVN 480

Query: 490 KMLKEKLGIK 499
            +LK KLGI+
Sbjct: 481 ALLKAKLGIE 490


>gi|298507413|gb|ADI86136.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Geobacter sulfurreducens KN400]
          Length = 479

 Score =  585 bits (1509), Expect = e-165,   Method: Composition-based stats.
 Identities = 234/483 (48%), Positives = 318/483 (65%), Gaps = 12/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +++ VIG+EVH QL   +K+F G S  FGA PN+Q       MPG+LP+LN + V+ A+
Sbjct: 1   MNYQAVIGLEVHVQLKTDTKIFCGCSTTFGAAPNSQTCPVCLGMPGVLPVLNKKVVEFAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL  N  I   SVFARKNYFYPDLP+GYQISQ++ PI   G + + +      +  T 
Sbjct: 61  RAGLATNCRIAPRSVFARKNYFYPDLPKGYQISQYELPICQNGHLDIEV------EGETK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSA---VSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            +GI RIH+E+DAGK +H         S +DLNR+   L+EIV++PD+RS+ EA A+L K
Sbjct: 115 RIGITRIHMEEDAGKLVHADVPGLGSGSGVDLNRACTPLLEIVSEPDIRSADEAVAYLRK 174

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L  I+ YLG CDGNMEEGS R D NVSV       +GTR E KNVNS RF+  AIE+E  
Sbjct: 175 LHQIVVYLGICDGNMEEGSFRCDANVSVMPVGSTTFGTRTETKNVNSFRFVKQAIEHEIE 234

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++E+GG + QETRLFDP+  ETRS+R KE+A DYRYF +PDL+PL I  D++   +
Sbjct: 235 RQIELIEEGGKVVQETRLFDPNTGETRSMRGKEEAHDYRYFPDPDLVPLVISNDWVEDAR 294

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLL 374
             +PELPDA+R R+  E G+S YDA VL + + +A+YFE   A     K  ANWV+ ++ 
Sbjct: 295 LSLPELPDARRSRYRSELGLSDYDAEVLTATREMAEYFEACLAAGAPAKGAANWVMGEVT 354

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
             LN +G  I +  ++P +L  L+ LI  GTISGKIAK +F+ +W+   TP+ IVEE GL
Sbjct: 355 RALNEAGTGIAECLVTPARLTALLQLIEKGTISGKIAKTVFDEMWQSDKTPEAIVEEKGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            QV+D  AIEK++DE++ +N   V      K  +  +FVGQVM+ + GKANP++V ++L 
Sbjct: 415 VQVSDTGAIEKIIDEIMAANMGQVEEFRGGKEKVFGFFVGQVMRASKGKANPAVVNELLM 474

Query: 494 EKL 496
           +KL
Sbjct: 475 KKL 477


>gi|295697350|ref|YP_003590588.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Bacillus tusciae
           DSM 2912]
 gi|295412952|gb|ADG07444.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Bacillus tusciae
           DSM 2912]
          Length = 475

 Score =  585 bits (1508), Expect = e-165,   Method: Composition-based stats.
 Identities = 223/481 (46%), Positives = 312/481 (64%), Gaps = 9/481 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVH +L+  +K+F G S  FGA PNT V       PG+LP+LN R ++ A+
Sbjct: 1   MEFETVIGLEVHVELATKTKIFCGCSTEFGAPPNTHVCPVCLGHPGVLPVLNRRALELAM 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              L LN  I + S F RKNYFYPDLP+ YQISQ+DKPI   G V +             
Sbjct: 61  KAALALNCEIARESKFDRKNYFYPDLPKAYQISQYDKPIGEHGWVEIETADG------PK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R+HLE+DAGK +H      S +D NR GV L+EIV++PDMRS  EA+A+L KL++
Sbjct: 115 RIGIIRVHLEEDAGKLMHGADGLHSLVDFNRVGVPLIEIVSEPDMRSPEEARAYLEKLKA 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I++Y    D  MEEGS+R D N+S+       +GT+ E+KN+NS R +   +E+E  RQ 
Sbjct: 175 IMQYCEISDVRMEEGSLRCDANISLRPAGTSEFGTKTEIKNMNSFRNVQRGLEHEQERQR 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            IL  GG + QETR +D +   T  +R+KE+A DYRYF EPDL+ L IDE+++R +++ I
Sbjct: 235 EILASGGQVVQETRRWDEAAGRTLPMRSKEEAHDYRYFPEPDLVTLSIDEEWVRRVRESI 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR-DKKIVANWVINDLLGVL 377
           PELPDA+R RF+ ++G+  YDA VL + + +AD+FE+ A +  D K V+NW++ +LLG +
Sbjct: 295 PELPDARRRRFVEQYGLPAYDAGVLTASRGVADFFEEAARHAGDAKAVSNWMMGELLGHM 354

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+SG  I D  ++P  L  LI+LI DGTIS KI K +F  ++  G  P  ++EE GL Q+
Sbjct: 355 NQSGLEIRDVKVTPRGLARLIELIADGTISTKIGKTVFAEMFATGKEPDVVIEEQGLVQI 414

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D  A+  +VD VI +NP +VA     K   +   VGQVMK T GKANP +V K+L+E+L
Sbjct: 415 SDEGALAALVDRVIEANPKSVADYRGGKGKALGALVGQVMKETKGKANPQVVNKLLRERL 474

Query: 497 G 497
           G
Sbjct: 475 G 475


>gi|307946463|ref|ZP_07661798.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Roseibium sp. TrichSKD4]
 gi|307770127|gb|EFO29353.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Roseibium sp. TrichSKD4]
          Length = 505

 Score =  585 bits (1508), Expect = e-165,   Method: Composition-based stats.
 Identities = 307/499 (61%), Positives = 393/499 (78%), Gaps = 6/499 (1%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  ++      +    G TGDWE+VIG+EVHAQ++  +KLFSGAS  FG +PN  VS  D
Sbjct: 13  MTLVEARTPDPKKFIKGATGDWEIVIGMEVHAQVTSEAKLFSGASTEFGKDPNDNVSLVD 72

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLG+ A IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 73  AAMPGMLPVINEECVRQAIRTGLGMKAEINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 132

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG + + +      +   +E+G+ER+HLEQDAGKS+HDQ+ ++S +DLNRSGVALMEIV+
Sbjct: 133 EGIILLDM------EEGRVEIGVERLHLEQDAGKSLHDQHPSMSFVDLNRSGVALMEIVS 186

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EAKA+LTKLR+ILRYLGTCDGNM++GSMRADVNVSV RPGE +GTRCE+KNV
Sbjct: 187 KPDLRSSDEAKAYLTKLRTILRYLGTCDGNMDQGSMRADVNVSVRRPGEGFGTRCEIKNV 246

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQ++ILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PD
Sbjct: 247 NSIRFVGQAIEYEARRQVSILEDGGSIDQETRLFDAVKGETRSMRSKEEAHDYRYFPDPD 306

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE  + ++  + + +PELPD K+ RF+ ++G++ YDA VL+ +K  AD+FE++A  R
Sbjct: 307 LLPLEFSQAYVDELAQHLPELPDDKKARFVKDYGLTEYDADVLIIEKVSADFFEEVAKGR 366

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVIN+L G LN+ GK +E +P+S  QLG +IDLI  GTISGKIAKD+F I+W 
Sbjct: 367 DAKLAANWVINELFGRLNKEGKDVETSPMSAAQLGAIIDLIKAGTISGKIAKDLFEIVWT 426

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE+ G++QVTDL AIE +VDE++ +NP+ V +   KPNLV WFVGQVMK + 
Sbjct: 427 EGGDPAQIVEDRGMKQVTDLGAIEAIVDEIMAANPDKVQQAKEKPNLVGWFVGQVMKASK 486

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  +LK+K+G++
Sbjct: 487 GKANPQAVNDLLKQKIGVE 505


>gi|39998469|ref|NP_954420.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Geobacter
           sulfurreducens PCA]
 gi|47115631|sp|P61343|GATB_GEOSL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|39985416|gb|AAR36770.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacter
           sulfurreducens PCA]
          Length = 479

 Score =  584 bits (1506), Expect = e-164,   Method: Composition-based stats.
 Identities = 234/483 (48%), Positives = 317/483 (65%), Gaps = 12/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +++ VIG+EVH QL   +K+F G S  FGA PN+Q       MPG+LP+LN + V+ A+
Sbjct: 1   MNYQAVIGLEVHVQLKTDTKIFCGCSTTFGASPNSQTCPVCLGMPGVLPVLNKKVVEFAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL  N  I   SVFARKNYFYPDLP+GYQISQ++ PI   G + + +           
Sbjct: 61  RAGLATNCRIAPRSVFARKNYFYPDLPKGYQISQYELPICQNGHLDIEVDGQ------VK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSA---VSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            +GI RIH+E+DAGK +H         S +DLNR+   L+EIV++PD+RS+ EA A+L K
Sbjct: 115 RIGITRIHMEEDAGKLVHADVPGLGSGSGVDLNRACTPLLEIVSEPDIRSADEAVAYLRK 174

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L  I+ YLG CDGNMEEGS R D NVSV       +GTR E KNVNS RF+  AIE+E  
Sbjct: 175 LHQIVVYLGICDGNMEEGSFRCDANVSVMPVGSTTFGTRTETKNVNSFRFVKQAIEHEIE 234

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++E+GG + QETRLFDP+  ETRS+R KE+A DYRYF +PDL+PL I  D++   +
Sbjct: 235 RQIELIEEGGKVVQETRLFDPNTGETRSMRGKEEAHDYRYFPDPDLVPLVISNDWVEDTR 294

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLL 374
             +PELPDA+R R+  E G+S YDA VL + + +A+YFE   A     K  ANWV+ ++ 
Sbjct: 295 LSLPELPDARRSRYRSELGLSDYDAEVLTATREMAEYFENCLAAGAPAKGAANWVMGEVT 354

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
             LN +GK I + P++P +L  L+ LI  GTISGKIAK +F+ +W+    P+ IVEE GL
Sbjct: 355 RALNEAGKDIAECPVAPARLTALLQLIEKGTISGKIAKTVFDEMWQSDKAPEAIVEEKGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            QV+D  AIEK++DE++ +N   V      K  +  +FVGQVM+ + GKANP++V ++L 
Sbjct: 415 VQVSDTGAIEKIIDEIMAANMGQVEEFRGGKEKVFGFFVGQVMRASKGKANPAVVNELLM 474

Query: 494 EKL 496
           +KL
Sbjct: 475 KKL 477


>gi|146341396|ref|YP_001206444.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bradyrhizobium
           sp. ORS278]
 gi|146194202|emb|CAL78224.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Bradyrhizobium sp. ORS278]
          Length = 505

 Score =  584 bits (1506), Expect = e-164,   Method: Composition-based stats.
 Identities = 306/496 (61%), Positives = 378/496 (76%), Gaps = 10/496 (2%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
            A    L  G TGDWE VIG+E+HAQ++  SKLFSGAS  FG +PNT VS  DAAMPGML
Sbjct: 15  PATPHKLIKGATGDWETVIGMEIHAQVTSKSKLFSGASTAFGGDPNTHVSLVDAAMPGML 74

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P++N  CV+QAV TGLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V+V 
Sbjct: 75  PVINEECVRQAVRTGLGLNAKINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEVTVE 134

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
           +        +T  +GIER+HLEQD GK +HDQ  ++S ID NR GVALMEIV+KPD+R +
Sbjct: 135 LDG-----GKTATIGIERLHLEQDPGKMLHDQSPSLSYIDFNRCGVALMEIVSKPDIRDA 189

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLG 247
            +AKA++TKLRSI+RYLGTCDG+ME+GS+RADVNVSV +PG   GTRCE+KN+NSI F+G
Sbjct: 190 EQAKAYVTKLRSIMRYLGTCDGDMEKGSLRADVNVSVRKPGGPLGTRCEIKNINSISFIG 249

Query: 248 LAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEID 307
            A+E EARRQI ILEDGG I QETR FDP K ETRS+R+KE+A DYRYF +PDLLPLE D
Sbjct: 250 QAVEAEARRQIEILEDGGVIEQETRRFDPDKGETRSMRSKEEAHDYRYFPDPDLLPLEFD 309

Query: 308 EDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-----LAVNRDK 362
           + F+  +K  +PELPD K+ RFI +FG+S YDASVLV+++  A ++E          RD 
Sbjct: 310 QAFVDELKAALPELPDQKKARFIADFGLSPYDASVLVAERESAAFYEAVLDALSERVRDG 369

Query: 363 KIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG 422
           K+ ANWVIN+L G LN+ G+ I  +P+S  QL  ++ LI +G ISGKIAKD+F I+W +G
Sbjct: 370 KLAANWVINELFGRLNKEGRDIAFSPVSAAQLASIVALIGEGIISGKIAKDLFEIVWSEG 429

Query: 423 GTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGK 482
           G P+E+VE  G++QVTDL AIEKVVDE+I +NP+ VA+   KP L  WFVGQVMK++GGK
Sbjct: 430 GDPRELVESRGMKQVTDLGAIEKVVDEIIAANPDKVAQAKAKPQLAGWFVGQVMKSSGGK 489

Query: 483 ANPSIVQKMLKEKLGI 498
           ANP  V  +LK KLGI
Sbjct: 490 ANPQAVNDLLKSKLGI 505


>gi|89067967|ref|ZP_01155411.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Oceanicola
           granulosus HTCC2516]
 gi|89046565|gb|EAR52621.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Oceanicola
           granulosus HTCC2516]
          Length = 503

 Score =  584 bits (1506), Expect = e-164,   Method: Composition-based stats.
 Identities = 301/509 (59%), Positives = 372/509 (73%), Gaps = 17/509 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+      + +G TGDWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDL-TYEPPKPKVIAGATGDWELVIGLEVHAQVASKAKLFSGASTRFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           A MPGMLP++N  CV  AV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AGMPGMLPVINEGCVALAVKTGLGLKAEINLRSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V + P  +       V IERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV+
Sbjct: 120 EGEVLVDMAPGIA-----RRVRIERIHLEQDAGKSIHDMDPTMSFVDLNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GE 229
           +PD+R   EA A++ KLR ILRYLGTCDGNM+ G++RADVNVSVCRP             
Sbjct: 175 RPDIRGPEEAAAYVGKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGDYERYQESQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AI+YEARRQIA+LEDG  + QETRLFDP K+ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQAAIDYEARRQIALLEDGKEVIQETRLFDPDKSETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I+  +PELPD KR RF+ EFG+  YDASVL ++   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIRASLPELPDEKRARFVTEFGLKEYDASVLTAEVEN 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE +A  RD K+ ANWVIN+L G L +  K+I D+P++P QLG ++DLI  G ISGK
Sbjct: 355 ATYFEAVAHGRDGKLAANWVINELFGRLKKDDKAIADSPVTPAQLGAIVDLIAKGDISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F I++ +GG P  IVEE G++QVTD  AIE  VDEVI +NP  V +    P L  
Sbjct: 415 IAKDLFEIVYTEGGDPAAIVEERGMKQVTDTGAIETAVDEVIAANPAQVEKAKANPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
           WFVGQVMK TGGKANP  V  ++ +KLG+
Sbjct: 475 WFVGQVMKATGGKANPKAVNDLVTQKLGL 503


>gi|319405548|emb|CBI79167.1| glutamyl-tRNA amidotransferase subunit B [Bartonella sp. AR 15-3]
          Length = 499

 Score =  584 bits (1506), Expect = e-164,   Method: Composition-based stats.
 Identities = 338/498 (67%), Positives = 410/498 (82%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D+ +   +   SG TG+WEV+IG+EVHAQ+   SKLFSGAS  FGAEPN+ VS  D
Sbjct: 1   MKIVDSRLPDPKRFISGVTGEWEVIIGMEVHAQVISNSKLFSGASTKFGAEPNSHVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  C++QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINQACIRQAVRTGLGLKAKINLKSVFDRKNYFYPDLPQGYQISQFQYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGKV +SIGPD +GQF  IE+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKVVISIGPDSNGQFEDIEIGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVN+SV RPGE +GTRCEVKNV
Sbjct: 181 KPDMRSSEEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNISVRRPGEPFGTRCEVKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEDGGIIDQETRLFDAIKGETRSMRSKEEAYDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE+D++F+  +  ++PELPD  R RFI E G++ YDAS+LV++K+IADYFE++A  R
Sbjct: 301 LLPLELDQEFVDTLALELPELPDDIRARFINEMGLTAYDASILVTEKAIADYFEEVAHGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+VANWVINDLLG LN+  + IEDTPI+ NQLG +IDLI DGTISGKIAKD+F I+W 
Sbjct: 361 DGKMVANWVINDLLGALNKDNRVIEDTPITANQLGAIIDLIKDGTISGKIAKDLFEIVWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE+ G++QVTD   IE+ V+E++ +NP+ V+++  KP LV WFVGQVMK T 
Sbjct: 421 EGGDPYQIVEKRGMKQVTDAGVIERAVNEIVINNPDKVSQVREKPALVGWFVGQVMKATE 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V K++K KLGI
Sbjct: 481 GKANPQTVNKLVKIKLGI 498


>gi|218531237|ref|YP_002422053.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Methylobacterium
           chloromethanicum CM4]
 gi|254790956|sp|B7KTR5|GATB_METC4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|218523540|gb|ACK84125.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           chloromethanicum CM4]
          Length = 490

 Score =  584 bits (1506), Expect = e-164,   Method: Composition-based stats.
 Identities = 320/494 (64%), Positives = 386/494 (78%), Gaps = 5/494 (1%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T     + L  G   DWEVVIG+E+HAQ++  SKLFSGAS  FG EPN  VS  DAAMPG
Sbjct: 2   TERVDPKKLIKGGLHDWEVVIGMEIHAQVTSRSKLFSGASTEFGGEPNDHVSLVDAAMPG 61

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V 
Sbjct: 62  MLPVINEECVAQAVRTGLGLKAQINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEVL 121

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V +      +  +I VGIER+HLEQDAGKS+HDQ    S +DLNRSGVALMEIV++PD+R
Sbjct: 122 VDLP-----EGESITVGIERLHLEQDAGKSLHDQDPTKSFVDLNRSGVALMEIVSRPDLR 176

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRF 245
           SS EA+A++TKLR+ILRYLGTCDG+ME+GS+RADVNVSV RPGE  GTRCE+KNVNSIRF
Sbjct: 177 SSEEARAYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRF 236

Query: 246 LGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLE 305
           +G AIE EARRQIAILEDGG I QETRL+DP K ETRS+R+KE+A DYRYF +PDLLPLE
Sbjct: 237 IGQAIETEARRQIAILEDGGKIDQETRLYDPGKGETRSMRSKEEAHDYRYFPDPDLLPLE 296

Query: 306 IDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIV 365
            D+ ++ A+   +PELPDAK+ RFI +FG+S YDA VLV++++ ADYFE +A  RD K  
Sbjct: 297 FDQAYVDALASGLPELPDAKKARFIKDFGLSAYDAGVLVAERASADYFEAVARGRDGKAA 356

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ANWVIN+L G LN+ G+SIEDTP+S  QLG ++DLI DG ISGKIAKD+F I+W +GG P
Sbjct: 357 ANWVINELFGRLNKEGRSIEDTPVSAEQLGTIVDLIGDGVISGKIAKDLFEIVWSEGGDP 416

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANP 485
           + IVE  G++QVTD  AIE  VD +I +NP+ V +   KP L+ WFVGQ MK TGGKANP
Sbjct: 417 RAIVEARGMKQVTDTGAIEAAVDAIIAANPDKVEQAKAKPTLLGWFVGQTMKATGGKANP 476

Query: 486 SIVQKMLKEKLGIK 499
           + V  +LK+KLGI+
Sbjct: 477 AAVNALLKDKLGIE 490


>gi|118587807|ref|ZP_01545217.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Stappia
           aggregata IAM 12614]
 gi|118439429|gb|EAV46060.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Stappia
           aggregata IAM 12614]
          Length = 493

 Score =  583 bits (1504), Expect = e-164,   Method: Composition-based stats.
 Identities = 309/499 (61%), Positives = 394/499 (78%), Gaps = 6/499 (1%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D      +    G TGDWE+VIG+EVHAQ++  +KLFSGAS  FG +PN  VS  D
Sbjct: 1   MTIVDVRTPDPKKFIKGATGDWEIVIGMEVHAQVTSEAKLFSGASTEFGKDPNDNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINEECVRQAIRTGLGLKAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGK+ + +  ++      +E+G+ER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKILLDMPDEQ------VEIGVERLHLEQDAGKSLHDQHPTMSFVDLNRSGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RSS EAKA+LTKLR+ILRYLGTCDGNM++GSMRADVNVSV RPG  +GTRCE+KNV
Sbjct: 175 KPDLRSSDEAKAYLTKLRTILRYLGTCDGNMDQGSMRADVNVSVRRPGGEFGTRCEIKNV 234

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQ+AILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PD
Sbjct: 235 NSIRFVGQAIEYEARRQVAILEDGGSIDQETRLFDAVKGETRSMRSKEEAHDYRYFPDPD 294

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE  ++F+  + + +PELPD K+ RF+ ++G++ YDA +L+++K  AD+FE++A  R
Sbjct: 295 LLPLEFTQEFVDELAQHLPELPDDKKNRFMSDYGLTAYDAEILIAEKVSADFFEEVAKGR 354

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVIN+L G LN+ GK + ++P+S  QLG ++DLI DG ISGKIAKD+F I+W 
Sbjct: 355 DAKLAANWVINELFGRLNKEGKDLSNSPVSAAQLGGIVDLIKDGVISGKIAKDLFEIVWT 414

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVEE G++QVTDL AIE +VDE+I +NP+ V +   KP L+ WFVGQVMK + 
Sbjct: 415 EGGDPAQIVEERGMKQVTDLGAIEAIVDEIIAANPDKVQQAIAKPGLLGWFVGQVMKQSQ 474

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  MLK+K+G++
Sbjct: 475 GKANPQAVSDMLKQKIGLE 493


>gi|254474153|ref|ZP_05087544.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Pseudovibrio sp. JE062]
 gi|211956683|gb|EEA91892.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Pseudovibrio sp. JE062]
          Length = 494

 Score =  583 bits (1504), Expect = e-164,   Method: Composition-based stats.
 Identities = 303/499 (60%), Positives = 385/499 (77%), Gaps = 5/499 (1%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT     +    G TGDWE+VIG+EVHAQ++  +KLFSGAS +FG++PN  VS  D
Sbjct: 1   MTLVDTRTPDPKKFIKGATGDWEIVIGMEVHAQVTSEAKLFSGASTSFGSDPNNNVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 61  AAMPGMLPVINEECVRQAIRTGLGLKAEINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG + + +   +  +     VG+ER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGTIHLDMKDGEQVE-----VGVERLHLEQDAGKSLHDQHPTMSFVDLNRSGVALMEIVS 175

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPD+RS+ EAKA+LTKLR+ILRYLGTCDGNM++GSMRADVNVSV +PG  +GTRCE+KNV
Sbjct: 176 KPDIRSADEAKAYLTKLRTILRYLGTCDGNMDQGSMRADVNVSVRKPGGEFGTRCEIKNV 235

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQI ILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PD
Sbjct: 236 NSIRFVGQAIEYEARRQIGILEDGGEIDQETRLFDSVKGETRSMRSKEEAHDYRYFPDPD 295

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE  ++ +  +   +PELPD K+ R+I EFG++ YDA +LV+++   D+FE++A  R
Sbjct: 296 LLPLEFSQELVDEMAANLPELPDEKKARYINEFGLTPYDADILVAERVSCDFFEEVAKGR 355

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVIND  G LN+ G  +  +PIS  QLG++IDLI  GTISGKIAKD+F I+W 
Sbjct: 356 DAKLAANWVINDTFGRLNKEGLDVTSSPISSEQLGKIIDLIKAGTISGKIAKDLFEIVWT 415

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE+ G++QVTDL AIE +VDE++ +N +   +   KP ++ WFVGQVMK + 
Sbjct: 416 EGGDPAQIVEDRGMKQVTDLGAIEGIVDEILAANTDKAEQAKEKPGMLGWFVGQVMKASK 475

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP  V  MLK K+G++
Sbjct: 476 GKANPQAVSDMLKVKIGLE 494


>gi|300022174|ref|YP_003754785.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299523995|gb|ADJ22464.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 493

 Score =  583 bits (1503), Expect = e-164,   Method: Composition-based stats.
 Identities = 311/490 (63%), Positives = 389/490 (79%), Gaps = 6/490 (1%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           ++  +L +G TGDWEV+IG+EVHAQ++  +KLFSGAS  FGAEPN+ VS  DAAMPGMLP
Sbjct: 10  SKPNNLIAGATGDWEVIIGMEVHAQVASNAKLFSGASTAFGAEPNSHVSLVDAAMPGMLP 69

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           ++N  CV QA+ TGLG+ A IN  SVF RKNYFYPDLPQGYQISQ+ +P+VGEG+V +  
Sbjct: 70  VINKECVAQAIRTGLGIKAEINLKSVFDRKNYFYPDLPQGYQISQYKQPVVGEGEVEIDA 129

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
                    T+++GIER+HLEQDAGKS+HDQ+   S +DLNRSGVALMEIV+KPD+RSS 
Sbjct: 130 DG------ETLKIGIERLHLEQDAGKSLHDQHPDYSYVDLNRSGVALMEIVSKPDLRSSK 183

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           +A+A++TKLR+ILRYLGTCDG+ME+G++RADVNVSV +PG+  GTRCE+KNVNSIRF+G 
Sbjct: 184 QAQAYVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRKPGDELGTRCEIKNVNSIRFIGQ 243

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AIE EARRQI I+EDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PDLLPLE+ +
Sbjct: 244 AIEVEARRQIDIIEDGGKIDQETRLFDSVKGETRSMRSKEEAHDYRYFPDPDLLPLELTQ 303

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANW 368
           D++  +K ++PELPD KR RFI  FG+S YDA VLV+++S ADYFE +A  RD K+ ANW
Sbjct: 304 DYVDDLKSKLPELPDEKRARFIKSFGLSAYDADVLVAERSSADYFESVANGRDGKLAANW 363

Query: 369 VINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEI 428
           VIN+L G LN+ GK IE  P+S  QLG ++DLI    ISGKIAKD+F I+W +GG P EI
Sbjct: 364 VINELFGRLNKEGKDIETCPVSAQQLGAIVDLIASNAISGKIAKDLFEIVWTEGGDPAEI 423

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIV 488
           VE+ G++QVTD  AIEK VD +I SNP+ V +   KP+++ WFVGQVMK TGGKANP+ V
Sbjct: 424 VEKRGMKQVTDTGAIEKAVDAIIASNPDKVEQAKAKPSMLGWFVGQVMKATGGKANPAAV 483

Query: 489 QKMLKEKLGI 498
             +LK KLGI
Sbjct: 484 NDILKAKLGI 493


>gi|315122519|ref|YP_004063008.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495921|gb|ADR52520.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 499

 Score =  583 bits (1503), Expect = e-164,   Method: Composition-based stats.
 Identities = 438/499 (87%), Positives = 471/499 (94%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           MVS+D HV+ S S  SG TGDWEVVIG+EVHAQLSV SKLFSGASV+FGA PNTQVSFFD
Sbjct: 1   MVSVDNHVSPSGSFISGATGDWEVVIGMEVHAQLSVRSKLFSGASVDFGAAPNTQVSFFD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLPILN  CV+QAVMTGL  NAHIN+YSVFARKNYFYPDLPQGYQISQH++PIVG
Sbjct: 61  AAMPGMLPILNSDCVRQAVMTGLSFNAHINQYSVFARKNYFYPDLPQGYQISQHNEPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGKVSVS+GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQY++VSCIDLNRSG+ALMEIVT
Sbjct: 121 EGKVSVSLGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYASVSCIDLNRSGIALMEIVT 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
            PDMRSSLEAKAFLTKLR+ILRYLGTCDGNMEEGSMRADVN+SVCRPG+++GTRCEVKNV
Sbjct: 181 NPDMRSSLEAKAFLTKLRTILRYLGTCDGNMEEGSMRADVNISVCRPGDSFGTRCEVKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRFLG AIEYEARRQIAILEDGGHI QETRLFD SKNETRSLRTKEDA DYRYF++PD
Sbjct: 241 NSIRFLGQAIEYEARRQIAILEDGGHIIQETRLFDHSKNETRSLRTKEDAHDYRYFADPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLEIDEDFIR IKKQ+PELPDAKRERFI EFGISLYDASVLVSDKSIADYFEKLAVNR
Sbjct: 301 LLPLEIDEDFIREIKKQLPELPDAKRERFITEFGISLYDASVLVSDKSIADYFEKLAVNR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           DKKI ANWVINDLLG LN+S K+IEDTPISP+QLGELIDLIIDGTISGKIAKDIFNILWE
Sbjct: 361 DKKIAANWVINDLLGGLNKSAKNIEDTPISPDQLGELIDLIIDGTISGKIAKDIFNILWE 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           KGG PK+IV++LGLRQVT++SAIE  VDEVINSNP+NVAR+A KPNLV WFVGQVMKNTG
Sbjct: 421 KGGHPKQIVDDLGLRQVTNISAIELAVDEVINSNPSNVARVAIKPNLVGWFVGQVMKNTG 480

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP IVQK++K+KLGIK
Sbjct: 481 GKANPGIVQKIVKDKLGIK 499


>gi|254562233|ref|YP_003069328.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Methylobacterium extorquens DM4]
 gi|254269511|emb|CAX25477.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Methylobacterium extorquens
           DM4]
          Length = 490

 Score =  583 bits (1503), Expect = e-164,   Method: Composition-based stats.
 Identities = 320/494 (64%), Positives = 386/494 (78%), Gaps = 5/494 (1%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T     + L  G   DWEVVIG+E+HAQ++  SKLFSGAS  FG EPN  VS  DAAMPG
Sbjct: 2   TERVDPKKLIKGGLHDWEVVIGMEIHAQVTSRSKLFSGASTEFGGEPNDHVSLVDAAMPG 61

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V 
Sbjct: 62  MLPVINEECVAQAVRTGLGLKAQINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEVL 121

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V +      +  +I VGIER+HLEQDAGKS+HDQ    S +DLNRSGVALMEIV++PD+R
Sbjct: 122 VDLP-----EGESITVGIERLHLEQDAGKSLHDQDPTKSFVDLNRSGVALMEIVSRPDLR 176

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRF 245
           SS EA+A++TKLR+ILRYLGTCDG+ME+GS+RADVNVSV RPGE  GTRCE+KNVNSIRF
Sbjct: 177 SSEEARAYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRF 236

Query: 246 LGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLE 305
           +G AIE EARRQIAILEDGG I QETRL+DP K ETRS+R+KE+A DYRYF +PDLLPLE
Sbjct: 237 IGQAIETEARRQIAILEDGGKIDQETRLYDPGKGETRSMRSKEEAHDYRYFPDPDLLPLE 296

Query: 306 IDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIV 365
            D+ ++ A+   +PELPDAK+ RFI +FG+S YDA VLV++++ ADYFE +A  RD K  
Sbjct: 297 FDQAYVDALASGLPELPDAKKARFIKDFGLSAYDAGVLVAERASADYFEAVARGRDGKAA 356

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ANWVIN+L G LN+ G+SIEDTP+S  QLG ++DLI DG ISGKIAKD+F I+W +GG P
Sbjct: 357 ANWVINELFGRLNKEGRSIEDTPVSAEQLGTIVDLIGDGVISGKIAKDLFEIVWSEGGDP 416

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANP 485
           + IVE  G++QVTD  AIE  VD +I +NP+ V +   KP L+ WFVGQ MK TGGKANP
Sbjct: 417 RAIVEARGMKQVTDTGAIETAVDAIIAANPDKVEQAKAKPTLLGWFVGQTMKATGGKANP 476

Query: 486 SIVQKMLKEKLGIK 499
           + V  +LK+KLGI+
Sbjct: 477 AAVNALLKDKLGIE 490


>gi|163852481|ref|YP_001640524.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           extorquens PA1]
 gi|229486436|sp|A9VWZ8|GATB_METEP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|163664086|gb|ABY31453.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           extorquens PA1]
          Length = 490

 Score =  583 bits (1503), Expect = e-164,   Method: Composition-based stats.
 Identities = 319/494 (64%), Positives = 386/494 (78%), Gaps = 5/494 (1%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T     + L  G   DWEVVIG+E+HAQ++  SKLFSGAS  FG EPN  VS  DAAMPG
Sbjct: 2   TERVDPKKLIKGGLHDWEVVIGMEIHAQVTSRSKLFSGASTEFGGEPNDHVSLVDAAMPG 61

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V 
Sbjct: 62  MLPVINEECVAQAVRTGLGLKAQINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEVL 121

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V +      +  ++ VGIER+HLEQDAGKS+HDQ    S +DLNRSGVALMEIV++PD+R
Sbjct: 122 VDLP-----EGESMTVGIERLHLEQDAGKSLHDQDPTKSFVDLNRSGVALMEIVSRPDLR 176

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRF 245
           SS EA+A++TKLR+ILRYLGTCDG+ME+GS+RADVNVSV RPGE  GTRCE+KNVNSIRF
Sbjct: 177 SSEEARAYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRF 236

Query: 246 LGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLE 305
           +G AIE EARRQIAILEDGG I QETRL+DP K ETRS+R+KE+A DYRYF +PDLLPLE
Sbjct: 237 IGQAIETEARRQIAILEDGGKIDQETRLYDPGKGETRSMRSKEEAHDYRYFPDPDLLPLE 296

Query: 306 IDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIV 365
            D+ ++ A+   +PELPDAK+ RFI +FG+S YDA VLV++++ ADYFE +A  RD K  
Sbjct: 297 FDQAYVDALASGLPELPDAKKARFIKDFGLSAYDAGVLVAERASADYFEAVARGRDGKAA 356

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ANWVIN+L G LN+ G+SIEDTP+S  QLG ++DLI DG ISGKIAKD+F I+W +GG P
Sbjct: 357 ANWVINELFGRLNKEGRSIEDTPVSAEQLGTIVDLIGDGVISGKIAKDLFEIVWSEGGDP 416

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANP 485
           + IVE  G++QVTD  AIE  VD +I +NP+ V +   KP L+ WFVGQ MK TGGKANP
Sbjct: 417 RAIVEARGMKQVTDTGAIEAAVDAIIAANPDKVEQAKAKPTLLGWFVGQTMKATGGKANP 476

Query: 486 SIVQKMLKEKLGIK 499
           + V  +LK+KLGI+
Sbjct: 477 AAVNALLKDKLGIE 490


>gi|22299937|ref|NP_683184.1| aspartyl/glutamyl-tRNA amidotransferase subunit B
           [Thermosynechococcus elongatus BP-1]
 gi|47115803|sp|Q8DGC4|GATB_THEEB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|22296122|dbj|BAC09946.1| Glu-tRNA(Gln) amidotransferase subunit B [Thermosynechococcus
           elongatus BP-1]
          Length = 500

 Score =  583 bits (1502), Expect = e-164,   Method: Composition-based stats.
 Identities = 224/498 (44%), Positives = 322/498 (64%), Gaps = 9/498 (1%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
           +A   +     +  +E VIG+E+H QLS  +K+FS +S  FGA PNT +      +PG L
Sbjct: 1   MAPEPTPVDAASLTYEAVIGLEIHCQLSTQTKIFSSSSTQFGAPPNTNIDPVCLGLPGTL 60

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P+LN + ++ AV  GL LN  I  YS F RK YFYPDLP+ YQISQ+D PI   G + + 
Sbjct: 61  PVLNEKVLEYAVKAGLALNCQIAPYSKFDRKQYFYPDLPKNYQISQYDLPIAHHGYLEIE 120

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKP 182
           +  DK G  R  ++GI R+H+E+DAGK +H        SA S +DLNR+GV L+EIV++P
Sbjct: 121 LVDDK-GTARRKKIGITRLHMEEDAGKLVHAGSDRLSGSAYSLVDLNRAGVPLVEIVSEP 179

Query: 183 DMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVN 241
           D+R+  EA  +  +LR ILRYLG CDGNM+EGS+R DVN+SV       +GT+ E+KN+N
Sbjct: 180 DLRTGQEAAEYAQELRRILRYLGVCDGNMQEGSLRCDVNISVRPVGSNTFGTKVEIKNMN 239

Query: 242 SIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDL 301
           S   +  AI+YE  RQ+A L+ G  I QETRL+D +  ETR++R KE + DYRYF EPDL
Sbjct: 240 SFSAIQRAIDYEIERQVAALKAGEPIVQETRLWDEATQETRTMRVKEGSSDYRYFPEPDL 299

Query: 302 LPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNR 360
            P+E+  + + A + ++PELP  KR R+  E+G+   DA VL  ++++A+YFE       
Sbjct: 300 GPIEVTAEQLAAWRAELPELPAQKRRRYESEWGLPPQDARVLTDERAVAEYFEATVVAGA 359

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
             K+ ANW++ D+   L     +IE  P+ P +L ELI LI  GTISGKIAK+I   L  
Sbjct: 360 PPKLAANWIMGDITAYLKEQKLAIEALPLKPAELAELIQLIEAGTISGKIAKEILPELLS 419

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNT 479
           +GG+PK +VE  GL Q++D++ +E ++DEV+ ++PN + +    K  L  +FVGQ+MK +
Sbjct: 420 QGGSPKALVERKGLSQISDVATLEAMIDEVLAAHPNELEQYRAGKTKLQGFFVGQLMKKS 479

Query: 480 GGKANPSIVQKMLKEKLG 497
           GG+A+P +  ++L +KL 
Sbjct: 480 GGRADPKLANQLLAQKLN 497


>gi|323702807|ref|ZP_08114466.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfotomaculum
           nigrificans DSM 574]
 gi|323532195|gb|EGB22075.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfotomaculum
           nigrificans DSM 574]
          Length = 480

 Score =  583 bits (1502), Expect = e-164,   Method: Composition-based stats.
 Identities = 214/484 (44%), Positives = 314/484 (64%), Gaps = 12/484 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  +E VIG+E+H +L   +K+F  ++  FG +PNT V      +PG LP+LN + V+ A
Sbjct: 2   TQQYEAVIGLEIHVELKTNTKIFCNSTTEFGGDPNTHVCPVCLGLPGTLPVLNKKVVEYA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           V   L LN  +  +S F RKNY+YPDLP+ YQISQ+D PI   G + + +         T
Sbjct: 62  VRAALALNCSVANFSKFDRKNYYYPDLPKNYQISQYDLPIAEHGYLDIEVDGQ------T 115

Query: 139 IEVGIERIHLEQDAGKSIHDQY---SAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
             +GI R+H+E+DAGK +H      +  S +D NR+GV L+EIV++PDMRS  EA+A+  
Sbjct: 116 KRIGITRLHMEEDAGKLVHQGNIVSTPYSLVDYNRTGVPLIEIVSEPDMRSPEEARAYAE 175

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEA 254
           KLR+I++Y G  D  MEEGS+R D NVSV     + +GT+ E+KN+NS R L  A+ YE 
Sbjct: 176 KLRAIIQYTGVSDCRMEEGSLRCDANVSVRPVGQKEFGTKTEIKNLNSFRALQRALAYEI 235

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
            RQIA+LE G  + QETR +D ++  T S+R+KE A DYRYF +PDL+PL +D  +I  I
Sbjct: 236 ERQIAVLEAGDRVVQETRTWDETRGITLSMRSKEQAHDYRYFPDPDLVPLVLDNQYIDFI 295

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR-DKKIVANWVINDL 373
           ++ +PELPD +R R++ ++G+  YDA++L   K ++DYFE++  +  + K V+NW++ ++
Sbjct: 296 RQSLPELPDQRRARYMDDYGLPAYDANILTLTKEMSDYFEEVLKDYDNPKTVSNWMMGEM 355

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
             +LN +G  I +  I P QL ++++L+  GTIS KIAK +F  ++  G   + IV+E G
Sbjct: 356 TRLLNANGIDITECKIRPGQLADMLNLVDKGTISIKIAKTVFEEMFNTGKDAEAIVKEKG 415

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           L Q++D  AI  VVDEVI +NP +V      K   + + VGQVM+ T GKANP +V K+L
Sbjct: 416 LVQISDAGAIAAVVDEVIAANPKSVEDFRAGKEKAIGFLVGQVMRATKGKANPELVNKLL 475

Query: 493 KEKL 496
           +EKL
Sbjct: 476 REKL 479


>gi|255022181|ref|ZP_05294183.1| Aspartyl-tRNA(Asn)/Glutamyl-tRNA(Gln) amidotransferase subunit B
           [Acidithiobacillus caldus ATCC 51756]
 gi|254968363|gb|EET25923.1| Aspartyl-tRNA(Asn)/Glutamyl-tRNA(Gln) amidotransferase subunit B
           [Acidithiobacillus caldus ATCC 51756]
          Length = 477

 Score =  583 bits (1502), Expect = e-164,   Method: Composition-based stats.
 Identities = 249/479 (51%), Positives = 332/479 (69%), Gaps = 6/479 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+EVH QL+  SK+F      +GAEPN        A+PG LP+LN   V +A+
Sbjct: 1   MSWEVVIGLEVHVQLNTQSKIFCNCPTRYGAEPNRHTCPVCLALPGALPVLNAAAVDKAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I++ SVFARKNYFYPDLP+GYQISQ++ PIVG G++++++           
Sbjct: 61  AFGLAVGAEIHQRSVFARKNYFYPDLPKGYQISQYEIPIVGRGQLALTLAD-----GTEK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            VGI R HLE+DAGKS+H+ +SA + IDLNR+G  L+EIV++PDMRS  EA A+L KL +
Sbjct: 116 IVGITRAHLEEDAGKSLHEAFSAETGIDLNRAGTPLLEIVSEPDMRSPAEAVAYLKKLHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           ++RYL   DGNM+EGS R D NVS+ RPGE +GTR E+KN+NS RFL  AIEYE  RQ  
Sbjct: 176 LVRYLDISDGNMQEGSFRCDANVSLRRPGEPFGTRAEIKNLNSFRFLEKAIEYEMERQQD 235

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           +LE G  + QETRLFD +K ETRS+R+KE+A DYRYF +PDLLPL ++   I A++  +P
Sbjct: 236 LLESGAEVVQETRLFDANKGETRSMRSKEEANDYRYFPDPDLLPLVLEPAQIEAVRASLP 295

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNR 379
           ELPDA++ RF+ ++ +  YDA VL S +++ADY+E +A   D K+ ANW++ DLLG LNR
Sbjct: 296 ELPDARKRRFMEQYALPAYDAGVLTSSRALADYYEVVAEGVDAKLAANWIMGDLLGALNR 355

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           S   IE  P+   Q+  L+  I D TISGKIAKD+F +L+EKG     I+E  GLRQ+TD
Sbjct: 356 SNGEIESCPVPAEQMRRLLQRIEDQTISGKIAKDVFEVLFEKGEDVDTIIERKGLRQITD 415

Query: 440 LSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           + AI K++D V+  NP  VA     K  L  +FVGQVMK + GKANP  + ++L+E+L 
Sbjct: 416 VEAITKLIDAVLAKNPGQVADYRSGKEKLFGFFVGQVMKASQGKANPEQLNRLLRERLD 474


>gi|121602274|ref|YP_988867.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bartonella
           bacilliformis KC583]
 gi|166217735|sp|A1USB4|GATB_BARBK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|120614451|gb|ABM45052.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Bartonella bacilliformis KC583]
          Length = 499

 Score =  583 bits (1502), Expect = e-164,   Method: Composition-based stats.
 Identities = 333/498 (66%), Positives = 402/498 (80%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +D          SG+TGDWEVVIG+EVHAQ+   SKLFSGAS  FGAEPN  VS  D
Sbjct: 1   MQMIDIRPPDPRHFISGSTGDWEVVIGMEVHAQIVSDSKLFSGASTKFGAEPNNHVSLID 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  C++QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVVNQECIRQAIRTGLGLKAQINLKSVFDRKNYFYPDLPQGYQISQFHYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGKV++SIGPD +GQF  +E+GIER+HLEQDAGKSIHDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKVTISIGPDSNGQFEDVEIGIERLHLEQDAGKSIHDQHPTMSFVDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLR ILRYLGTCDGNM+EGS+RADVNVSV RPGE  GTRCE+KNV
Sbjct: 181 KPDMRSSEEAKAYITKLRMILRYLGTCDGNMDEGSIRADVNVSVRRPGEPLGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIA+LEDGG I  ETRLFD +K ETRS+R KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAVLEDGGVIDPETRLFDAAKCETRSIRLKEEAHDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+ A+  ++PELPD  + RFI + G+++YDAS+L+++K IADYF+K+A  R
Sbjct: 301 LLPLEFDQAFVDALASELPELPDDIKARFINDMGLTVYDASILITEKEIADYFQKVARGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+VANWVINDLLG LN++   IEDTP+ P+QLG +IDLI +G ISGKIAKD+F I+W 
Sbjct: 361 DGKMVANWVINDLLGALNKNNCKIEDTPVKPDQLGAIIDLIEEGIISGKIAKDLFEIIWH 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG  ++IVEE G++QVTD  AI+  VDE++ +NP+ V++   KP LV WFVGQVMK TG
Sbjct: 421 EGGDLRQIVEERGMKQVTDTGAIQSAVDEIMANNPDKVSQAKEKPALVGWFVGQVMKETG 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V K++K KL I
Sbjct: 481 GKANPQTVNKLVKMKLEI 498


>gi|188582503|ref|YP_001925948.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           populi BJ001]
 gi|229486439|sp|B1ZIK6|GATB_METPB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|179346001|gb|ACB81413.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           populi BJ001]
          Length = 490

 Score =  583 bits (1502), Expect = e-164,   Method: Composition-based stats.
 Identities = 320/494 (64%), Positives = 385/494 (77%), Gaps = 5/494 (1%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T     + L  G   DWEVVIG+E+HAQ++  SKLFSGAS  FG EPN  VS  DAAMPG
Sbjct: 2   TERVDPKKLIKGGLHDWEVVIGMEIHAQVTSRSKLFSGASTAFGGEPNDHVSLVDAAMPG 61

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  C+ QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V 
Sbjct: 62  MLPVINEECIAQAVRTGLGLKAQINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEVL 121

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V +   +S     I VGIER+HLEQDAGKS+HDQ    S +DLNRSGVALMEIV++PD+R
Sbjct: 122 VDLPDGES-----ITVGIERLHLEQDAGKSLHDQDPTKSFVDLNRSGVALMEIVSRPDLR 176

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRF 245
           SS EAKA++TKLR+ILRYLGTCDG+ME+GS+RADVNVSV RPGE  GTRCE+KNVNSIRF
Sbjct: 177 SSEEAKAYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRF 236

Query: 246 LGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLE 305
           +G AIE EARRQIAILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PDLLPLE
Sbjct: 237 IGQAIETEARRQIAILEDGGKIDQETRLFDPGKGETRSMRSKEEAHDYRYFPDPDLLPLE 296

Query: 306 IDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIV 365
            D+ ++  +   +PELPDAK+ RFI +FG+S YDA VLV++++ ADYFE +A  RD K  
Sbjct: 297 FDQAYVDGLASGLPELPDAKKARFIKDFGLSAYDAGVLVAERASADYFEAVARGRDGKAA 356

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ANWVIN+L G LN+ G+SIEDTP+S  QLG ++DLI +G ISGKIAKD+F I+W +GG P
Sbjct: 357 ANWVINELFGRLNKEGRSIEDTPVSAEQLGTIVDLIGEGVISGKIAKDLFEIVWSEGGDP 416

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANP 485
           + IVE  G++QVTD  AIE  VD +I +NP+ V +   KP L+ WFVGQ MK TGGKANP
Sbjct: 417 RAIVESRGMKQVTDTGAIEAAVDAIIAANPDKVEQAKAKPTLLGWFVGQTMKATGGKANP 476

Query: 486 SIVQKMLKEKLGIK 499
           + V  +LK+KLGI+
Sbjct: 477 AAVNALLKDKLGIE 490


>gi|240139817|ref|YP_002964294.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Methylobacterium extorquens
           AM1]
 gi|240009791|gb|ACS41017.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Methylobacterium extorquens
           AM1]
          Length = 490

 Score =  583 bits (1502), Expect = e-164,   Method: Composition-based stats.
 Identities = 320/494 (64%), Positives = 386/494 (78%), Gaps = 5/494 (1%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T     + L  G   DWEVVIG+E+HAQ++  SKLFSGAS  FG EPN  VS  DAAMPG
Sbjct: 2   TERVDPKKLIKGGLYDWEVVIGMEIHAQVTSRSKLFSGASTEFGGEPNDHVSLVDAAMPG 61

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP++N  CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V 
Sbjct: 62  MLPVINEECVAQAVRTGLGLKAQINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEVL 121

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V +      +  +I VGIER+HLEQDAGKS+HDQ    S +DLNRSGVALMEIV++PD+R
Sbjct: 122 VDLP-----EGESITVGIERLHLEQDAGKSLHDQDPTKSFVDLNRSGVALMEIVSRPDLR 176

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRF 245
           SS EA+A++TKLR+ILRYLGTCDG+ME+GS+RADVNVSV RPGE  GTRCE+KNVNSIRF
Sbjct: 177 SSEEARAYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRF 236

Query: 246 LGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLE 305
           +G AIE EARRQIAILEDGG I QETRL+DP K ETRS+R+KE+A DYRYF +PDLLPLE
Sbjct: 237 IGQAIETEARRQIAILEDGGKIDQETRLYDPGKGETRSMRSKEEAHDYRYFPDPDLLPLE 296

Query: 306 IDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIV 365
            D+ ++ A+   +PELPDAK+ RFI +FG+S YDA VLV++++ ADYFE +A  RD K  
Sbjct: 297 FDQAYVDALASGLPELPDAKKARFIKDFGLSAYDAGVLVAERASADYFEAVARGRDGKAA 356

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ANWVIN+L G LN+ G+SIEDTP+S  QLG ++DLI DG ISGKIAKD+F I+W +GG P
Sbjct: 357 ANWVINELFGRLNKEGRSIEDTPVSAEQLGSIVDLIGDGVISGKIAKDLFEIVWSEGGDP 416

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANP 485
           + IVE  G++QVTD  AIE  VD +I +NP+ V +   KP L+ WFVGQ MK TGGKANP
Sbjct: 417 RAIVEARGMKQVTDTGAIEAAVDAIIAANPDKVEQAKAKPTLLGWFVGQTMKATGGKANP 476

Query: 486 SIVQKMLKEKLGIK 499
           + V  +LK+KLGI+
Sbjct: 477 AAVNALLKDKLGIE 490


>gi|148256057|ref|YP_001240642.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bradyrhizobium
           sp. BTAi1]
 gi|166217736|sp|A5EKP2|GATB_BRASB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|146408230|gb|ABQ36736.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Bradyrhizobium sp. BTAi1]
          Length = 492

 Score =  583 bits (1502), Expect = e-164,   Method: Composition-based stats.
 Identities = 308/496 (62%), Positives = 381/496 (76%), Gaps = 10/496 (2%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
            A S  L  G TGDWEVVIG+E+HAQ++  SKLFSGAS  FG +PN+ VS  D AMPGML
Sbjct: 2   TATSGKLMKGATGDWEVVIGMEIHAQVTSKSKLFSGASTAFGGDPNSHVSLVDVAMPGML 61

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P++N  CV+QAV TGLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V+V 
Sbjct: 62  PVINEECVRQAVRTGLGLNAKINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEVTVE 121

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
           +        +T  +GIER+HLEQD GK +HDQ  ++S ID NR GVALMEIV+KPD+R +
Sbjct: 122 LDG-----GKTATIGIERLHLEQDPGKMLHDQSPSLSYIDYNRCGVALMEIVSKPDIRDA 176

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLG 247
            +AKA++TKLRSILRYLGTCDG+ME+GS+RADVNVSV +PG   GTRCE+KN+NSI F+G
Sbjct: 177 EQAKAYVTKLRSILRYLGTCDGDMEKGSLRADVNVSVRKPGGPLGTRCEIKNINSISFIG 236

Query: 248 LAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEID 307
            A+E EARRQI I+EDGG I QETR FDP K ETRS+R+KE+A DYRYF +PDLLPLE D
Sbjct: 237 QAVEAEARRQIEIIEDGGTIEQETRRFDPDKGETRSMRSKEEAHDYRYFPDPDLLPLEFD 296

Query: 308 EDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-----LAVNRDK 362
           + F+ A+K  +PELPD K+ RFI +FG+S YDASVLV+++  A ++E          RD 
Sbjct: 297 QAFVDALKAALPELPDQKKARFIADFGLSPYDASVLVAERESAAFYESVLEALSDRGRDG 356

Query: 363 KIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG 422
           K+ ANWVIN+L G LN+ G+ I  +P+S  QL  ++ LI +GTISGKIAKD+F I+W +G
Sbjct: 357 KLAANWVINELFGRLNKEGRDIASSPVSSAQLAAIVALIGEGTISGKIAKDLFEIVWSEG 416

Query: 423 GTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGK 482
           G P+E+VE  G++QVTDL AIEKVVDE+I +NP+ VA+   KP L  WFVGQVMK++GGK
Sbjct: 417 GDPRELVESRGMKQVTDLGAIEKVVDEIIAANPDKVAQAKAKPQLAGWFVGQVMKSSGGK 476

Query: 483 ANPSIVQKMLKEKLGI 498
           ANP  V  +LK KLGI
Sbjct: 477 ANPQAVNDLLKSKLGI 492


>gi|78221300|ref|YP_383047.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Geobacter
           metallireducens GS-15]
 gi|109892026|sp|Q39ZK2|GATB_GEOMG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|78192555|gb|ABB30322.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Geobacter metallireducens GS-15]
          Length = 479

 Score =  582 bits (1501), Expect = e-164,   Method: Composition-based stats.
 Identities = 233/483 (48%), Positives = 314/483 (65%), Gaps = 12/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +++ VIG+EVH QL   +K+F G S  FGA PN+Q       MPG LP+LN + V+ A+
Sbjct: 1   MNYQAVIGLEVHVQLKTDTKIFCGCSTQFGASPNSQTCPVCLGMPGALPVLNRKVVEFAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL  N  I   SVFARKNYFYPDLP+GYQISQ + PI   G + + +      +  T 
Sbjct: 61  KAGLATNCRIAPRSVFARKNYFYPDLPKGYQISQFELPICQNGHLDIEV------EGETK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSA---VSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            +GI RIH+E+DAGK +H         S +DLNR+   L+EIV++PD+RS+ EA A+L K
Sbjct: 115 RIGITRIHMEEDAGKLVHSDIPGLGSGSGVDLNRACTPLLEIVSEPDIRSADEAVAYLKK 174

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L  I+ YLG CDGNMEEGS R D NVSV       +GTR E KNVNS RF+  AIEYE  
Sbjct: 175 LHQIVVYLGICDGNMEEGSFRCDANVSVMPVGSTTFGTRTETKNVNSFRFVKQAIEYEIE 234

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++E+GG + QETRLF+P   ETRS+R KE+A DYRYF +PDL+PL I  D++  + 
Sbjct: 235 RQIELIEEGGKVVQETRLFNPDSGETRSMRGKEEAHDYRYFPDPDLVPLVISNDWVADVA 294

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLL 374
             +PELP+A+R R+  + G+S YDA VL + + +A+YFE   A     K  ANWV+ ++ 
Sbjct: 295 LSLPELPEARRNRYRSDLGLSDYDAEVLTATREMAEYFEACLAAGAPAKGAANWVMGEVT 354

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
             LN +G  I D P++P +L  L+ LI  GTISGKIAK +F+ +W     P+ IVEE GL
Sbjct: 355 RSLNEAGTGIADCPVTPERLTALLQLIEKGTISGKIAKTVFDEMWTNDKAPEAIVEEKGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            QV+D  AIEK++DE++ +N   V      K  +  +FVGQVM+ + GKANP++V ++L 
Sbjct: 415 VQVSDTGAIEKIIDEIMAANMGQVEEFRGGKEKVFGFFVGQVMRASKGKANPAVVNELLL 474

Query: 494 EKL 496
           +KL
Sbjct: 475 KKL 477


>gi|78043368|ref|YP_359949.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|109892012|sp|Q3AD35|GATB_CARHZ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|77995483|gb|ABB14382.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 481

 Score =  582 bits (1501), Expect = e-164,   Method: Composition-based stats.
 Identities = 220/482 (45%), Positives = 320/482 (66%), Gaps = 12/482 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           ++E VIG+EVH +L   +K+F   S  FG +PN+ V      +PG+LP+LN + V  A+ 
Sbjct: 3   EYEAVIGLEVHVELKTNTKIFCNCSTEFGGDPNSHVCPVCLGLPGVLPVLNKKVVDYAIK 62

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
             L LN  + +Y  F RKNY+YPDLP+ YQISQ+D P+   G + + +            
Sbjct: 63  AALALNCEVAEYCKFDRKNYYYPDLPKNYQISQYDLPLAKNGYLEIEVDGQ------VKR 116

Query: 141 VGIERIHLEQDAGKSIHDQY---SAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
           +GI RIH+E+DAGK +H      +  S +D NR+GV L+EIV+ PD+R+  EA+ +L KL
Sbjct: 117 IGITRIHMEEDAGKLVHQGNLAVTPYSLVDYNRTGVPLIEIVSAPDIRTPEEARLYLEKL 176

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           ++I++Y G  D  MEEGS+R D NVSV     + +GT+ E+KN+NS + L  A+EYE  R
Sbjct: 177 KAIIQYTGISDCRMEEGSLRCDANVSVRPKGQKEFGTKTEIKNMNSFKALQKALEYEIAR 236

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI ILE+GG I QETR++D S+  T S+R+KE+A DYRYF EPDL P+ ID +++  I+ 
Sbjct: 237 QIEILEEGGRIIQETRMWDESRQVTLSMRSKEEAHDYRYFPEPDLPPVVIDREWLEEIRA 296

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR-DKKIVANWVINDLLG 375
            +PELPDA+++RF+ ++G++ YDA VL   + +ADY+E+ A    + K VANWVIN+LL 
Sbjct: 297 TLPELPDARKKRFVEQYGLTPYDAHVLTLTRELADYYEEAAKGYSNPKAVANWVINELLR 356

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
           +LN +GK I + PI P Q+ ++++L+  GTISGKIAK +F  ++  G  P+ IV+E GL 
Sbjct: 357 LLNAAGKEITECPIKPEQITKMLELLDKGTISGKIAKTVFEEMFSSGKDPEVIVKEKGLV 416

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q+TDL  +E VVD+VI +NP  V      K   + + VGQ+MK T G+ANP  V ++L++
Sbjct: 417 QITDLGELEAVVDKVIAANPKAVEDYKNGKEKALGFLVGQIMKETRGRANPEAVNQLLRD 476

Query: 495 KL 496
           KL
Sbjct: 477 KL 478


>gi|288960012|ref|YP_003450352.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Azospirillum sp. B510]
 gi|288912320|dbj|BAI73808.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Azospirillum sp. B510]
          Length = 483

 Score =  582 bits (1501), Expect = e-164,   Method: Composition-based stats.
 Identities = 301/483 (62%), Positives = 375/483 (77%), Gaps = 6/483 (1%)

Query: 15  TSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRC 74
             G TGDWEVVIG+EVHAQ+   +KLFSG++  FGA PN+QVSF DAA PGMLP++N  C
Sbjct: 4   IQGETGDWEVVIGLEVHAQVISNAKLFSGSATEFGAAPNSQVSFVDAAFPGMLPVINEYC 63

Query: 75  VQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSG 134
           V+QAV TGLGL A IN +SVF RKNYFY DLPQGYQISQ  +PIVG+G++ + +      
Sbjct: 64  VEQAVRTGLGLKAEINLHSVFDRKNYFYADLPQGYQISQFLQPIVGKGEIVLDLPD---- 119

Query: 135 QFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFL 194
              +  VG+ R+HLEQDAGKS+HDQ+ + S IDLNRSGVALMEIV++PDMRSS EA A++
Sbjct: 120 -GTSRTVGVTRLHLEQDAGKSLHDQHPSKSYIDLNRSGVALMEIVSEPDMRSSEEAGAYV 178

Query: 195 TKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEA 254
            KLRSILRYLGTCDGNMEEGSMR DVNVSV +PG  +GTRCE+KNVNSIRF+  AIEYEA
Sbjct: 179 RKLRSILRYLGTCDGNMEEGSMRCDVNVSVRKPGAPFGTRCEIKNVNSIRFVMQAIEYEA 238

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           RRQI I+E+GG I QETRL+D +K  TRS+R+KE+A DYRYF +PDLLPLE+D +++  I
Sbjct: 239 RRQIEIIEEGGKIDQETRLWDTTKFVTRSMRSKEEAHDYRYFPDPDLLPLELDAEWVEDI 298

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLL 374
           KK +PELPD K+ RFI ++ +S+YDA VLVS+KS ADYFE +A  RD K+ +NWV  +L 
Sbjct: 299 KKTLPELPDDKKARFIEDYKLSVYDAGVLVSEKSKADYFETVAKGRDPKLASNWVTGELF 358

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
           G LN++GK IE++P+S   LG LIDLI D TISG+IAK++F  ++E GG   +IVE+ GL
Sbjct: 359 GYLNKAGKEIEESPVSAENLGGLIDLIADNTISGRIAKEVFEAMFETGGKAADIVEKKGL 418

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           RQVTD SAIE  +D V+ +NP+ VA     K  L  +FVGQVMK T GKANP++V ++L 
Sbjct: 419 RQVTDTSAIEGSIDAVLAANPDKVAEFRSGKDKLFGFFVGQVMKATQGKANPAMVNEILT 478

Query: 494 EKL 496
            KL
Sbjct: 479 SKL 481


>gi|319898783|ref|YP_004158876.1| glutamyl-tRNA amidotransferase subunit B [Bartonella clarridgeiae
           73]
 gi|319402747|emb|CBI76294.1| glutamyl-tRNA amidotransferase subunit B [Bartonella clarridgeiae
           73]
          Length = 499

 Score =  582 bits (1500), Expect = e-164,   Method: Composition-based stats.
 Identities = 333/498 (66%), Positives = 402/498 (80%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M  +DT +   +   SG TGDWEV+IG+E+HAQ+   SKLFSGAS  FGAEPN  VS  D
Sbjct: 1   MKIVDTRLPNPKRFISGVTGDWEVIIGMEIHAQVISDSKLFSGASTKFGAEPNNHVSLVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  C+ QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINQACICQAIRTGLGLKAKINLRSVFDRKNYFYPDLPQGYQISQFQYPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGKV VSIGPD +GQF  IE+GIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+
Sbjct: 121 EGKVLVSIGPDSNGQFEDIEIGIERLHLEQDAGKSMHDQHPTMSFLDLNRSGVALMEIVS 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           KPDMRSS EAKA++TKLR+I+RYLGTCDGNM+EGSMRADVN+SV RPG  +GTRCE+KNV
Sbjct: 181 KPDMRSSEEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADVNISVRRPGGPFGTRCEIKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIEYEARRQIAILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PD
Sbjct: 241 NSIRFIGQAIEYEARRQIAILEDGGVIDQETRLFDAIKGETRSMRSKEEAYDYRYFPDPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLE D+ F+  +  ++PELPD  + RFI E G++ YDAS+LV++K+IADYFE++A  R
Sbjct: 301 LLPLEFDQAFVDTLAAELPELPDDIKARFINEMGLTAYDASILVTEKAIADYFEEVAHGR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K+ ANWVINDLLG LN+  + IE+TPI+  QLG +IDLI +GTISGKIAKD+F I+W 
Sbjct: 361 DGKMAANWVINDLLGALNKDNRDIENTPITAKQLGAIIDLIKEGTISGKIAKDLFEIIWN 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P +IVE+ G++QVTD   IE+ VD++I +NP+ VA+   KP LV WF+GQVMK T 
Sbjct: 421 EGGDPHQIVEKRGMKQVTDAGVIERAVDKIIINNPDKVAQAREKPVLVGWFIGQVMKATE 480

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  V K++K KLGI
Sbjct: 481 GKANPQTVNKLVKIKLGI 498


>gi|298291520|ref|YP_003693459.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Starkeya novella
           DSM 506]
 gi|296928031|gb|ADH88840.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Starkeya novella
           DSM 506]
          Length = 492

 Score =  582 bits (1500), Expect = e-164,   Method: Composition-based stats.
 Identities = 315/498 (63%), Positives = 388/498 (77%), Gaps = 6/498 (1%)

Query: 2   VSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDA 61
           +++    A  + L  G TGDWEVVIG+E+HAQ++  SKLFSGAS  FG EPN+ VS  DA
Sbjct: 1   MNMHARPADPKKLIKGATGDWEVVIGMEIHAQVTSNSKLFSGASTAFGGEPNSHVSLVDA 60

Query: 62  AMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGE 121
           AMPGMLP++N  CV+QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGE
Sbjct: 61  AMPGMLPVINEECVKQAVRTGLGLKAQINNRSVFDRKNYFYPDLPQGYQISQYKSPIVGE 120

Query: 122 GKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTK 181
           G V V +          IEVGIER+HLEQDAGKSIHD +   S +DLNRSGVALMEIV+K
Sbjct: 121 GVVLVDM------SEGRIEVGIERLHLEQDAGKSIHDLHPTQSLVDLNRSGVALMEIVSK 174

Query: 182 PDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVN 241
           PD+RSS EAKAF+TKLR+ILRYLGTCDG+ME+G++RADVNVSV +PG+ +GTRCE+KNVN
Sbjct: 175 PDLRSSEEAKAFVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRKPGDDFGTRCEIKNVN 234

Query: 242 SIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDL 301
           SIRF+G AIE EARRQI I+EDGG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDL
Sbjct: 235 SIRFIGQAIETEARRQIGIIEDGGTIDQETRLFDPNKGETRSMRSKEEAHDYRYFPDPDL 294

Query: 302 LPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRD 361
           LPLE D+ F+  +   +PELPD K+ RF+  +G+S YDA VLV++K  ADY+E +A  RD
Sbjct: 295 LPLEFDDAFVTELAAHLPELPDEKKARFVSAYGLSAYDADVLVAEKDTADYYEAVAKGRD 354

Query: 362 KKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK 421
            K  AN+VIN+L G LN+ GK I  +P+S  Q+G ++DLI DGTISGKIAKD+F+I + +
Sbjct: 355 AKAAANFVINELFGRLNKEGKDIASSPVSAAQIGAIVDLIADGTISGKIAKDLFDICFTE 414

Query: 422 GGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGG 481
           GG P+EIVE  G++QVTD  AIE  VD +I +NP+ V ++  KP ++ WFVGQVMK TGG
Sbjct: 415 GGEPREIVEARGMKQVTDTGAIEAAVDAIIAANPDKVEQVKAKPTMLGWFVGQVMKQTGG 474

Query: 482 KANPSIVQKMLKEKLGIK 499
           KANP  V ++LK KLGI+
Sbjct: 475 KANPQAVNELLKGKLGIE 492


>gi|75676187|ref|YP_318608.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrobacter
           winogradskyi Nb-255]
 gi|109892041|sp|Q3SR35|GATB_NITWN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|74421057|gb|ABA05256.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Nitrobacter winogradskyi Nb-255]
          Length = 494

 Score =  582 bits (1500), Expect = e-164,   Method: Composition-based stats.
 Identities = 308/494 (62%), Positives = 389/494 (78%), Gaps = 10/494 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +   L  G TG+WE+VIGIEVHAQ++  +KLFSGAS  FG +PN+ VS  DAAMPGMLP+
Sbjct: 6   KPSHLIKGATGEWEMVIGIEVHAQVTSNAKLFSGASTAFGGDPNSHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QAV TGLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V + 
Sbjct: 66  INEECVRQAVRTGLGLNARINLRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGEVVVDLA 125

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
                   +  VGIER+HLEQDAGKS+HDQ++ +S IDLNRSGVALMEIV++PDMRSS +
Sbjct: 126 D-----GTSFVVGIERLHLEQDAGKSLHDQHADMSAIDLNRSGVALMEIVSRPDMRSSEQ 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           A+A++TKLR+ILRYLGTCDG+ME+G++RADVNVSV RPGE +GTRCE+KNVNSIRF+G A
Sbjct: 181 ARAYVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRRPGEPFGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IEYEARRQI ILEDGG I QETRLFDP K ETR++R+KE+A DYRYF +PDLLPLE  + 
Sbjct: 241 IEYEARRQIGILEDGGGIDQETRLFDPDKGETRAMRSKEEAHDYRYFPDPDLLPLEFSQG 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-----AVNRDKKI 364
            + A+K  +PELPD K+ RF+ + G++ YDA+VLVS+   A+++E +        RD K 
Sbjct: 301 LVDALKADLPELPDQKKARFVTDLGLTSYDAAVLVSEHESANFYESVLADLADARRDGKA 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN+ G SIE +P+S +QL  +IDLI +GTISGKIAKD+F I+W +GG 
Sbjct: 361 AANWVINELFGRLNKQGLSIEASPVSASQLAAIIDLIGEGTISGKIAKDLFEIVWSEGGD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P+ +VE  G++QVTD+ AIEKVVD+++ +NP+ VA++  KP ++ WFVGQVMK +GGK N
Sbjct: 421 PRALVEARGMKQVTDVGAIEKVVDDIVAANPDKVAQVRAKPQMIGWFVGQVMKASGGKVN 480

Query: 485 PSIVQKMLKEKLGI 498
           P  V  +LK KLG+
Sbjct: 481 PQAVNDLLKAKLGL 494


>gi|147678856|ref|YP_001213071.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pelotomaculum
           thermopropionicum SI]
 gi|189045146|sp|A5CZ96|GATB_PELTS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|146274953|dbj|BAF60702.1| asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit [Pelotomaculum
           thermopropionicum SI]
          Length = 478

 Score =  582 bits (1499), Expect = e-164,   Method: Composition-based stats.
 Identities = 215/481 (44%), Positives = 309/481 (64%), Gaps = 12/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+EVH +L   SK+F  ++  FG +PNT V      +PG+LP++N + V+ A+  
Sbjct: 4   YEAVIGLEVHVELKTRSKIFCDSTTEFGGDPNTHVCPVCLGLPGVLPVVNKKVVEYAIRA 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
            L LN  I  +S F RKNY+YPD+P+ YQISQ+D PI   G + + +        +   +
Sbjct: 64  ALALNCQIAGFSKFDRKNYYYPDMPKNYQISQYDLPIARNGYIEIDVNG------KRKRI 117

Query: 142 GIERIHLEQDAGKSIHDQ---YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
           GI R+H+E+D GK +H      +  S +D NR+GV L+EIV++PD+RS  EA+ ++ KLR
Sbjct: 118 GITRLHMEEDTGKLVHQGTITTTPFSLVDYNRAGVPLIEIVSEPDLRSPEEARQYMEKLR 177

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           ++++Y G  D  MEEGS+R D NVSV      A+GT+ E+KN+NS + L  A+ YE  RQ
Sbjct: 178 AVIQYTGVSDCKMEEGSLRCDANVSVRPAGSIAFGTKTEIKNLNSFKALQRALAYEIERQ 237

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I +LE+GG + QETR +D  K  T  +RTKE+A DYRYF +PDL+PL ID +++  I++ 
Sbjct: 238 IDVLEEGGRVVQETRTWDEGKGITLPMRTKEEAHDYRYFPDPDLVPLVIDREWVEDIRRS 297

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRD-KKIVANWVINDLLGV 376
           +PELPD KRER++ E+ +  YDA VL S + +A +FE         KIV+NW++ DLL +
Sbjct: 298 LPELPDEKRERYMREYALPAYDAGVLTSTRELAGFFEACVQGYPNPKIVSNWIMGDLLRL 357

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN     I+D P+ P QL  ++ LI  GTISGKIAK +F  ++  G   ++IV+E GL Q
Sbjct: 358 LNAGNIEIQDCPVKPGQLVSMLRLIEKGTISGKIAKTVFEEMFATGRDAEDIVKEKGLVQ 417

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           ++D  AI  +VD+VI  NP  V      K   + + VGQVMK T GKANP +V ++LKEK
Sbjct: 418 ISDEGAIAAIVDQVIAGNPRTVEDYRSGKEKALGFLVGQVMKATRGKANPELVNRLLKEK 477

Query: 496 L 496
           +
Sbjct: 478 I 478


>gi|296535593|ref|ZP_06897774.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Roseomonas
           cervicalis ATCC 49957]
 gi|296264109|gb|EFH10553.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Roseomonas
           cervicalis ATCC 49957]
          Length = 483

 Score =  582 bits (1499), Expect = e-164,   Method: Composition-based stats.
 Identities = 284/487 (58%), Positives = 357/487 (73%), Gaps = 6/487 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
                GTTG WEVVIG+EVHAQ++  +KLFSGA+  FGAEPNTQVSF DA  PGMLP++N
Sbjct: 2   SYTIEGTTGPWEVVIGLEVHAQVTSEAKLFSGAATEFGAEPNTQVSFVDAGFPGMLPVIN 61

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
           G CV QAV TGLGLNA +N +S F RKNYFY DLPQGYQISQ+  PI+G G++ + +   
Sbjct: 62  GECVAQAVRTGLGLNAQVNLWSRFDRKNYFYADLPQGYQISQYQFPIIGTGQIEIELAD- 120

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
                    +GI R+HLEQDAGKS+HDQ+   S IDLNRSGVALMEIV++PD+RS  EA 
Sbjct: 121 ----GTRKPIGITRLHLEQDAGKSLHDQHPTKSYIDLNRSGVALMEIVSEPDLRSPEEAG 176

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A+LTKLR ILRYLGTCDGNME+GS+RADVNVSV +PGE + TRCEVKNVNSIRF+  A+E
Sbjct: 177 AYLTKLRQILRYLGTCDGNMEQGSLRADVNVSVRKPGEGFRTRCEVKNVNSIRFVMQAVE 236

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
            EARRQ+ + E G  + QETRLFD S+  TRS+R+KEDA DYRYF +PDL PL I++ ++
Sbjct: 237 AEARRQVELWEAGEEVVQETRLFDTSRGVTRSMRSKEDAHDYRYFPDPDLPPLVIEQAWV 296

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
             +K  +PELPDA+R R++GEFG++ YDA VL  +K  A ++E +A  RD K+ ANWV  
Sbjct: 297 DQLKAALPELPDARRARYVGEFGLTPYDAHVLTLEKETAAFYETVARGRDPKVAANWVTG 356

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D    LNR+G  I D+P+S   LG L+DLI D T+SGK+AK++   ++E G  P EIVEE
Sbjct: 357 DFFAGLNRTGHGIGDSPVSAENLGALLDLIADNTLSGKLAKEVLEAMFETGKAPGEIVEE 416

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+QVTD  AIE V+D+V+ +N   V      K  L  +FVGQ MK   GK NP++V +
Sbjct: 417 RGLKQVTDTGAIEAVIDQVMAANAGKVEEYRSGKDKLFGFFVGQTMKAMQGKGNPALVNE 476

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 477 LLKKKLG 483


>gi|158520030|ref|YP_001527900.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfococcus
           oleovorans Hxd3]
 gi|158508856|gb|ABW65823.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfococcus
           oleovorans Hxd3]
          Length = 476

 Score =  582 bits (1499), Expect = e-164,   Method: Composition-based stats.
 Identities = 236/478 (49%), Positives = 305/478 (63%), Gaps = 8/478 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+EVHAQL   +K+F G S  FGA PNT        MPG LP+LN   V  A+  
Sbjct: 3   FESVIGLEVHAQLKTGTKIFCGCSTGFGAPPNTHTCPVCTGMPGTLPVLNRTVVDYALKM 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
            L +N  I   S FARKNYFYPDLP+GYQISQ++ PI   G+V +  G  +        V
Sbjct: 63  ALAVNCRIRSVSRFARKNYFYPDLPKGYQISQYELPIAEHGEVVIDTGNGEQ-----KRV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI RIH+E+DAGK IHD    VS +D NR+GV L+EIV++PDMRS  EA A+L +LRS+L
Sbjct: 118 GITRIHMEEDAGKLIHDASRPVSYVDYNRTGVPLIEIVSEPDMRSPREAGAYLRELRSLL 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           R+L   DGNMEEGS R D NVS+      A GTR E+KN+NS R +  A+ YE RR    
Sbjct: 178 RWLDISDGNMEEGSFRCDANVSIRPSGSTALGTRTEIKNLNSFRHVEQALAYEIRRHADR 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           + +GG + QETRL++P K  T S+R KEDA DYRYF +PDLLPL +D+ +   I+  +PE
Sbjct: 238 VSEGGAVEQETRLWNPEKMVTVSMRGKEDAHDYRYFPDPDLLPLVVDDAWKDRIQATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVLNR 379
           LP  +++RF+ ++G+S  DA VL   +++ADYFE  A   +  K  ANW++ DLLG+LN 
Sbjct: 298 LPAFRKKRFVADYGLSEEDAGVLTGSRALADYFEACAAEAKTPKPCANWIMGDLLGLLNA 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           +   IE +P+SP  LG L+ LI D  ISGKIAK +F  +   G  PK IVE   L QVTD
Sbjct: 358 TATPIEASPVSPVHLGRLVGLINDNVISGKIAKTVFEEMARTGQDPKAIVEARNLVQVTD 417

Query: 440 LSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
             AI   +D+VI   P+ V +    K  ++ + VGQVMK T GKANP  V  +L EKL
Sbjct: 418 TGAIGAAIDQVIAECPDEVEKYKSGKTKVMGFLVGQVMKKTKGKANPQAVNDLLAEKL 475


>gi|86749560|ref|YP_486056.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodopseudomonas
           palustris HaA2]
 gi|109892056|sp|Q2IXB5|GATB_RHOP2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|86572588|gb|ABD07145.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodopseudomonas palustris HaA2]
          Length = 494

 Score =  582 bits (1499), Expect = e-164,   Method: Composition-based stats.
 Identities = 309/494 (62%), Positives = 385/494 (77%), Gaps = 10/494 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +   L  G TGDWEVVIG+E+HAQ+S  +KLFSGA+  FG +PN+ VS  DAAMPGMLP+
Sbjct: 6   KPSQLIKGATGDWEVVIGLEIHAQVSSNAKLFSGAATEFGGDPNSHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QA+ +GLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V + 
Sbjct: 66  INEECVKQAIRSGLGLNAQINLRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGEVVVDLP 125

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
              S       VGIER+HLEQDAGK +HDQ    + +DLNRSGVALMEIV+KPD+RSS +
Sbjct: 126 DGDST-----TVGIERLHLEQDAGKLLHDQDPTSTFVDLNRSGVALMEIVSKPDLRSSEQ 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA+++KLR+ILRYLGTCDG+ME+GS+RADVNVSV +PGE +GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVSKLRTILRYLGTCDGDMEKGSLRADVNVSVRKPGEPYGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IEYEARRQI +LEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PDLLPLE  + 
Sbjct: 241 IEYEARRQIGVLEDGGAIVQETRLFDAGKGETRSMRSKEEAHDYRYFPDPDLLPLEFSQA 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-----KLAVNRDKKI 364
           ++  +K  +PELPD K+ RFIG FG+S  DA VLVS++  AD++E          RD K+
Sbjct: 301 YVDELKAGLPELPDQKKARFIGSFGLSPDDAGVLVSERESADFYEAVLAALADAARDGKL 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN+ G+SIE +P+S  QL  ++DLI +GTISGKIAK++F I+W +GG 
Sbjct: 361 AANWVINELFGRLNKDGQSIEVSPVSAAQLAAIVDLIGEGTISGKIAKELFEIVWTEGGD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P+ +VE  G++QVTDLSAIEKVVDE+I  NP+ VA+   KP ++ WFVGQVMK++GGKAN
Sbjct: 421 PRVLVEARGMKQVTDLSAIEKVVDEIIAGNPDKVAQAIAKPAMLGWFVGQVMKSSGGKAN 480

Query: 485 PSIVQKMLKEKLGI 498
           P  V  +LK KLG+
Sbjct: 481 PQAVNDLLKRKLGL 494


>gi|220933702|ref|YP_002512601.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thioalkalivibrio
           sp. HL-EbGR7]
 gi|254790975|sp|B8GL96|GATB_THISH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|219995012|gb|ACL71614.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thioalkalivibrio
           sp. HL-EbGR7]
          Length = 477

 Score =  581 bits (1498), Expect = e-164,   Method: Composition-based stats.
 Identities = 249/481 (51%), Positives = 336/481 (69%), Gaps = 9/481 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +WE VIG+EVHAQL+  SK+FSGAS  +GA PN+Q    D  +PG+LP+LN   V+ AV
Sbjct: 1   MEWETVIGLEVHAQLATKSKIFSGASTAYGAAPNSQACAIDLGLPGVLPVLNREAVRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I+  SVFARKNYFYPDLP+GYQISQ++ P+VG GK+ + +   +     T 
Sbjct: 61  KFGLAIGAEISPRSVFARKNYFYPDLPKGYQISQYELPVVGLGKLEIELEDGE-----TK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PDMRS+ EA A+L KL +
Sbjct: 116 VIGITRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDMRSAKEAVAYLKKLHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYL  CDGNM+EGS R D NVSV R   E +GTR E+KN+NS RF+  AI YE  RQI
Sbjct: 176 LVRYLEICDGNMQEGSFRCDANVSVRRKGTEKFGTRAEIKNINSFRFVERAINYEVERQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ILE GG + QETRL+DP K ETRS+R+KE+A DYRYF +PDLLPLEID  FI  ++  +
Sbjct: 236 DILEGGGAVVQETRLYDPDKGETRSMRSKEEANDYRYFPDPDLLPLEIDASFIEGVRGTL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV--NRDKKIVANWVINDLLGV 376
           PELPD K+ RF+  +G+S YDA VL + + + DY+E +        K+ ANWV+ +L   
Sbjct: 296 PELPDEKKHRFMTHYGLSAYDAGVLTASREMGDYYEAVVKACGGHAKLAANWVMGELSAA 355

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN+  + I ++P+S   LG++++ I D TISGKIAKD+F  +W   G+   ++E+ GL+Q
Sbjct: 356 LNKDNREITESPVSAAALGQMLERIEDNTISGKIAKDVFEAMWNGEGSADAVIEKKGLKQ 415

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           +TD  AIE ++D+V+  NP  + +    K  L  +FVGQVMK TGGKANP  V  +LK+K
Sbjct: 416 ITDTGAIEAIIDKVMADNPGQLEQYRSGKDKLFGFFVGQVMKATGGKANPGQVNDLLKKK 475

Query: 496 L 496
           L
Sbjct: 476 L 476


>gi|83590838|ref|YP_430847.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Moorella
           thermoacetica ATCC 39073]
 gi|109892034|sp|Q2RGY5|GATB_MOOTA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|83573752|gb|ABC20304.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Moorella thermoacetica ATCC 39073]
          Length = 476

 Score =  581 bits (1497), Expect = e-163,   Method: Composition-based stats.
 Identities = 221/482 (45%), Positives = 314/482 (65%), Gaps = 11/482 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVHA+L   SK F   S  FG EPNT V      +PG+LP++N + V+  +
Sbjct: 1   MEYEAVIGLEVHAELKTASKAFCSCSTAFGGEPNTHVCPVCLGLPGVLPVINRQVVEFGL 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
            T L LN  +  +  F RKNY+YPDLP+ YQISQ+D P+   G + +++   +       
Sbjct: 61  KTALALNCRVAPFCKFDRKNYYYPDLPKNYQISQYDLPLATGGYLKINVDGQE------R 114

Query: 140 EVGIERIHLEQDAGKSIHDQYS--AVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
            +GI R+H+E+DAGK +H        S +D NR+GV L+EIV++PD+RS  EA+A++ KL
Sbjct: 115 VIGITRVHMEEDAGKLVHVDGPGGGYSLVDYNRTGVPLLEIVSEPDLRSPAEARAYMEKL 174

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           R+IL+YL   D  MEEGS+R D NVSV     + +GT+ EVKN+NS R L  A+EYE  R
Sbjct: 175 RAILQYLDVSDCKMEEGSLRCDANVSVRPRGSQTFGTKTEVKNMNSFRALQRALEYEIER 234

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QIAILE GG + Q T  +D S+  T  +RTKE A DYRYF EPDL+PLEID  +I  +++
Sbjct: 235 QIAILEGGGRVEQATMAWDESRGVTTVMRTKEQAHDYRYFPEPDLVPLEIDAAWIERVRR 294

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLG 375
           ++PELPDA+  R +  FG+  YDA V+ S + +ADYF+++     D K+V+NW++ D L 
Sbjct: 295 ELPELPDARCRRLMDTFGLPAYDAGVITSSRDLADYFDRVVARYPDAKVVSNWIMGDFLR 354

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
           +LN         P+ P +L +L++L  +GTISGKIAK +   ++  G   ++IV+E GL 
Sbjct: 355 LLNARNLEPGQAPVPPEELADLLELQKEGTISGKIAKQVLEEMFASGKGARQIVQERGLV 414

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q++D +A+ K+VDEV+ +NPN V      K   + + VGQVMK TGGKANP +V K+LKE
Sbjct: 415 QISDTAALGKIVDEVLAANPNVVEDYRNGKEKALGFLVGQVMKATGGKANPGLVNKLLKE 474

Query: 495 KL 496
           +L
Sbjct: 475 RL 476


>gi|299135126|ref|ZP_07028317.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Afipia sp. 1NLS2]
 gi|298590103|gb|EFI50307.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Afipia sp. 1NLS2]
          Length = 494

 Score =  581 bits (1497), Expect = e-163,   Method: Composition-based stats.
 Identities = 313/496 (63%), Positives = 379/496 (76%), Gaps = 10/496 (2%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
               + L  G TGDWEVVIG+EVHAQ++  SKLFSGAS  FG  PN  VS  DAAMPGML
Sbjct: 4   TVDPKKLIKGVTGDWEVVIGLEVHAQVTSNSKLFSGASTEFGGAPNEHVSLVDAAMPGML 63

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P++N  CV QA+ TGLGL A IN  S F RKNYFYPDLPQGYQISQ+  PI+GEG V + 
Sbjct: 64  PVINEECVAQAIRTGLGLKAQINLKSTFDRKNYFYPDLPQGYQISQYKSPIIGEGTVLID 123

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
                     T  VGIER+HLEQDAGK +HDQ+ A+S +DLNRSGVALMEIV+KPDMRSS
Sbjct: 124 TPD-----GSTASVGIERLHLEQDAGKLLHDQHPAMSYVDLNRSGVALMEIVSKPDMRSS 178

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLG 247
            EAKA++ KLRSILRYLGTCDG+ME+G++RADVNVSV RPGE +GTRCE+KNVNSIRF+G
Sbjct: 179 EEAKAYVAKLRSILRYLGTCDGDMEKGNLRADVNVSVRRPGEPFGTRCEIKNVNSIRFIG 238

Query: 248 LAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEID 307
            AIE+EARRQI I+EDGG I QETRL+DP+K ETRS+R+KE+A DYRYF +PDLLPLE  
Sbjct: 239 QAIEFEARRQIEIIEDGGTIEQETRLYDPNKGETRSMRSKEEAHDYRYFPDPDLLPLEFT 298

Query: 308 EDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-----AVNRDK 362
             ++  +K  +PELPD KR RFI  FG++ YDA VLV+++  AD++E +        RD 
Sbjct: 299 AAYVEELKSHLPELPDEKRTRFIESFGLTPYDAGVLVAERESADFYEAVLAGLGNAGRDG 358

Query: 363 KIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG 422
           K+ ANWVIN+L G LN+ G+ I  +P+S  QL  ++DLI +GTISGKIAKD+F I+W KG
Sbjct: 359 KLAANWVINELFGRLNKEGQEIAASPVSTAQLAAIVDLIGEGTISGKIAKDLFEIVWTKG 418

Query: 423 GTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGK 482
           G PK +VE LGL+QVTDL AIEKVVDE+I +NP+ V +   KP L+ WFVGQVMK++GGK
Sbjct: 419 GDPKALVESLGLKQVTDLGAIEKVVDEIIAANPDKVEQARAKPQLIGWFVGQVMKSSGGK 478

Query: 483 ANPSIVQKMLKEKLGI 498
            NP  V  +LK KLGI
Sbjct: 479 VNPQAVNDLLKSKLGI 494


>gi|291280306|ref|YP_003497141.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Deferribacter desulfuricans SSM1]
 gi|290755008|dbj|BAI81385.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Deferribacter desulfuricans SSM1]
          Length = 478

 Score =  581 bits (1497), Expect = e-163,   Method: Composition-based stats.
 Identities = 234/483 (48%), Positives = 334/483 (69%), Gaps = 12/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             +E VIG+EVH QLS  SK+F   S  FGA+PNT V      MPG+LP+LN + V+  +
Sbjct: 1   MKYEAVIGLEVHVQLSTKSKIFCSCSTEFGADPNTHVCPVCLGMPGVLPVLNKQVVEYTI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  I + SVFARKNYFYPDLP+GYQISQ++ PI   G + + I   K       
Sbjct: 61  KAGLALNCDIQRKSVFARKNYFYPDLPKGYQISQYELPICLNGFIEIEIDGVK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQY---SAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           ++GI RIH+E+DAGKSIH +     A S +DLNR+GV L+EIV++PD+R+  EA+A+L K
Sbjct: 115 KIGITRIHMEEDAGKSIHGENLGSPAHSYVDLNRTGVPLIEIVSEPDIRTPEEARAYLQK 174

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L++IL Y+   D NMEEGS+R D N+S+       +GT+ E+KN+NS R +  AIE+E +
Sbjct: 175 LKTILEYIEVSDCNMEEGSLRCDANISLRPVGETKFGTKTEIKNMNSFRNVQRAIEFEIK 234

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQ  IL++GG I QETRL+DP+K  T S+R+KE+A DYRYF +PDL+PL ++ D+I  +K
Sbjct: 235 RQAKILDEGGTIVQETRLWDPNKGITVSMRSKEEAHDYRYFPDPDLVPLIVENDWIEKVK 294

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLL 374
             +PELPDAK+ERF+ E+G+  YDA VL+S+K  ADYFE+    + + K ++NW+++++L
Sbjct: 295 STLPELPDAKKERFMKEYGLPSYDAEVLISNKHYADYFEQSVKNHNNPKAISNWIMSEVL 354

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
             +N  G +I +  + P  + E++ LI DG ISGKI K+++ ++ E G +P +IVEE GL
Sbjct: 355 RDVNEKGCNIFELNVKPEHIAEIVKLIDDGKISGKIGKEVYQLVLESGKSPAKIVEEKGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            Q++D SAIE++V +V+ +NP  V R    +  L  +FVGQVMK T GKANP +V ++L+
Sbjct: 415 IQISDESAIEEIVKKVLEANPKEVERYKNGEKKLQGFFVGQVMKETKGKANPKLVNQLLQ 474

Query: 494 EKL 496
           + L
Sbjct: 475 KLL 477


>gi|323136216|ref|ZP_08071298.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylocystis sp.
           ATCC 49242]
 gi|322398290|gb|EFY00810.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylocystis sp.
           ATCC 49242]
          Length = 490

 Score =  581 bits (1497), Expect = e-163,   Method: Composition-based stats.
 Identities = 308/495 (62%), Positives = 378/495 (76%), Gaps = 5/495 (1%)

Query: 4   LDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAM 63
           + T       L  G TGDWEVVIG+E+HAQ++  +KLFSGAS  +G  PN  VS  DAAM
Sbjct: 1   MTTAQPAPSKLIKGATGDWEVVIGMEIHAQVTSKAKLFSGASAEYGGAPNDHVSLVDAAM 60

Query: 64  PGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGK 123
           PGMLP++N  CV+QA+ TGLGL A IN  S+F RKNYFYPDLPQGYQISQ+  PIVGEG 
Sbjct: 61  PGMLPVINEECVKQAIRTGLGLEAQINLRSIFDRKNYFYPDLPQGYQISQYKYPIVGEGA 120

Query: 124 VSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPD 183
           V V + P +      I VG+ER+HLEQDAGKS+HD  +  S +DLNRSGVALMEIV+KPD
Sbjct: 121 VIVDVSPTE-----RITVGVERLHLEQDAGKSLHDLSATESHVDLNRSGVALMEIVSKPD 175

Query: 184 MRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSI 243
           MRS+ EA+A++TKLR++LRY+G+CDGNME+GS+RADVNVSV RPGE  GTRCE+KNVNSI
Sbjct: 176 MRSAEEARAYVTKLRALLRYIGSCDGNMEQGSLRADVNVSVRRPGEPLGTRCEIKNVNSI 235

Query: 244 RFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLP 303
           RF+G AIE EARRQI ILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PDLLP
Sbjct: 236 RFIGQAIEVEARRQIGILEDGGKIDQETRLFDPGKGETRSMRSKEEAHDYRYFPDPDLLP 295

Query: 304 LEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKK 363
           LE D+ ++ A+K  +PELPDAKR RFI ++G+  YDA VLV +++ AD+FE+ A  RD K
Sbjct: 296 LEFDQAYVDALKAGLPELPDAKRARFIEQYGLPPYDAGVLVMERASADFFEETAKGRDAK 355

Query: 364 IVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG 423
           + ANWVIN+L G LN+ G  +  +P+S   LG +++LI    ISGKIAKD+F I+W +GG
Sbjct: 356 LAANWVINELFGRLNKEGLDVTRSPVSAQALGAIVELISSNVISGKIAKDLFEIVWSEGG 415

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKA 483
            PKEIVE  G++QVTD  AIE  VD VI +NP+ V +   KP ++ WFVGQVMK TGGKA
Sbjct: 416 DPKEIVEARGMKQVTDTGAIEAAVDAVIAANPDKVKQAKAKPTMLGWFVGQVMKQTGGKA 475

Query: 484 NPSIVQKMLKEKLGI 498
           NP  V  +LK KLGI
Sbjct: 476 NPQAVNDLLKSKLGI 490


>gi|209884934|ref|YP_002288791.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Oligotropha carboxidovorans
           OM5]
 gi|229486425|sp|B6JFW6|GATB_OLICO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|209873130|gb|ACI92926.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Oligotropha carboxidovorans
           OM5]
          Length = 494

 Score =  580 bits (1496), Expect = e-163,   Method: Composition-based stats.
 Identities = 313/494 (63%), Positives = 387/494 (78%), Gaps = 10/494 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
             + L  G TGDWEVVIG+E+HAQ++  +KLFSGA+  FG  PN  VS  DAAMPGMLP+
Sbjct: 6   DPKKLIKGATGDWEVVIGLEIHAQVTSNAKLFSGAATAFGGAPNEHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV QA+ TGLGL A IN  S F RKNYFYPDLPQGYQISQ+ +PIVGEG V V IG
Sbjct: 66  INAECVAQAIRTGLGLKAQINLKSTFDRKNYFYPDLPQGYQISQYKQPIVGEGVVIVDIG 125

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
             +S     IEVGIER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+KPDMRS+ E
Sbjct: 126 DGES-----IEVGIERLHLEQDAGKSLHDQHPTMSFVDLNRSGVALMEIVSKPDMRSADE 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA++TKLR+ILRYLGTCDG+ME+G++RADVNVSV  PGE +GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRHPGEPFGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           I+YEARRQI ILEDGG I QETRL+DP+K ETRS+R+KE+A DYRYF +PDLLPLE    
Sbjct: 241 IDYEARRQIGILEDGGTIDQETRLYDPNKGETRSMRSKEEAHDYRYFPDPDLLPLEFTAG 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-----RDKKI 364
           ++  +K ++PELPD KR RFI +FG++ YDA VLVS++  AD++E +        RD K 
Sbjct: 301 YVEELKAKLPELPDEKRARFIADFGLTPYDAGVLVSERESADFYEAVLAKLADGTRDGKQ 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN+ G +I+ +P+S +QL  ++DLI +GTISGKI KD+F I+W KGG 
Sbjct: 361 AANWVINELFGRLNKEGVAIDASPVSADQLAAIVDLIGEGTISGKIGKDLFEIVWTKGGD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           PK +VE LGL+QVTDL AIEK+VD+++ +NP+ VA+   KP L+ WFVGQVMK +GGK N
Sbjct: 421 PKALVESLGLKQVTDLGAIEKMVDDIVAANPDKVAQARAKPQLIGWFVGQVMKLSGGKVN 480

Query: 485 PSIVQKMLKEKLGI 498
           P  V  +LK KLGI
Sbjct: 481 PQAVNDLLKSKLGI 494


>gi|312114336|ref|YP_004011932.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219465|gb|ADP70833.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 491

 Score =  580 bits (1496), Expect = e-163,   Method: Composition-based stats.
 Identities = 310/492 (63%), Positives = 383/492 (77%), Gaps = 6/492 (1%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
            R E+L  G TG WEV++G+EVHAQ+   +KLFSGAS  FG EPN+ VS  DAAMPGMLP
Sbjct: 4   TRKENLIDGATGPWEVIVGMEVHAQVLSNAKLFSGASAAFGGEPNSHVSLVDAAMPGMLP 63

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           ++N  CV+QA+ TGLGL A IN+ SVF RKNYFYPDLPQGYQISQ   PIVGEG V+V +
Sbjct: 64  VINVECVKQAIRTGLGLKAQINRRSVFDRKNYFYPDLPQGYQISQFKFPIVGEGIVTVDL 123

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
                 +  + +VGIER+HLEQDAGKS+HDQ    S +DLNRSGVALMEIV+KPD+RSS 
Sbjct: 124 ------KEYSFDVGIERLHLEQDAGKSLHDQDPDHSYVDLNRSGVALMEIVSKPDIRSSE 177

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           EAKA++TKLR+ILRYLGTCDGNMEEGS+RADVNVSV + G   GTRCE+KNVNSIRF+G 
Sbjct: 178 EAKAYITKLRTILRYLGTCDGNMEEGSLRADVNVSVRKLGAPLGTRCEIKNVNSIRFIGQ 237

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AIEYEARRQI ++EDGG I+QETRLFD    +TR +R+KE+A DYRYF +PDLLPLE+ E
Sbjct: 238 AIEYEARRQIDVIEDGGTIKQETRLFDAKSGKTRPMRSKEEAHDYRYFPDPDLLPLEVSE 297

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANW 368
            F+  +KK +PELPD KR RF+ E+ +S YDA VL+ D++ AD++E +A  RD K+ ANW
Sbjct: 298 AFVEDLKKVLPELPDEKRARFMSEYALSAYDAGVLILDRASADFYETVARGRDPKLAANW 357

Query: 369 VINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEI 428
           ++ D    LN++GK I ++PIS  QLGELIDLI    ISG+IAK++F I+ +KGGTP  I
Sbjct: 358 MMGDFFAALNKTGKDITESPISAAQLGELIDLISSDVISGRIAKEVFEIMLDKGGTPGAI 417

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIV 488
           VEE GL+QVTD  AIEKVVDE+I +NP  V ++ TKP  +SWFVGQVM+ TGGKANP  V
Sbjct: 418 VEERGLKQVTDTGAIEKVVDEIIAANPKQVEQVQTKPKTLSWFVGQVMRATGGKANPDAV 477

Query: 489 QKMLKEKLGIKE 500
             +L++KL + E
Sbjct: 478 NALLRQKLQVPE 489


>gi|220931082|ref|YP_002507990.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Halothermothrix orenii H 168]
 gi|219992392|gb|ACL68995.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Halothermothrix orenii H 168]
          Length = 482

 Score =  579 bits (1493), Expect = e-163,   Method: Composition-based stats.
 Identities = 225/482 (46%), Positives = 316/482 (65%), Gaps = 12/482 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           ++E +IG+EVH QLS  SK+F   S  FGAEPNT        +PG LP+LN + V  A+M
Sbjct: 4   EYETIIGLEVHVQLSTNSKIFCDCSTEFGAEPNTHTCPVCLGLPGTLPVLNKKAVDYAIM 63

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL LN  I++YS F RKNYFYPDLP+ YQISQ+D P+   G + +             +
Sbjct: 64  AGLALNCDISEYSKFDRKNYFYPDLPKAYQISQYDLPLCQNGYIEIDTEDG------VKK 117

Query: 141 VGIERIHLEQDAGKSIHD---QYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
           +GI RIHLE+DAGK IH+     S  S +D NR+GV L+EIV++PDMRS  EA+ +LT+L
Sbjct: 118 IGITRIHLEEDAGKLIHEGTIDESDSSLVDYNRTGVPLIEIVSEPDMRSPSEAREYLTQL 177

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           + ++ YLG  D NMEEGS+R D NVS+     E +GT+ E+KN+NS R +  A+EYE  R
Sbjct: 178 KKVMEYLGVSDCNMEEGSLRCDANVSIRPVGQEEFGTKTELKNMNSFRAVERALEYEVER 237

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q  +L  G  + QETR +D   N+T S+R KE+A DYRYF EPDL+PLE+D+ ++  IK 
Sbjct: 238 QKKVLARGDKVVQETRTWDEKLNKTISMRGKEEAHDYRYFPEPDLVPLEVDKGWVEEIKS 297

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLG 375
           ++PELP A++ERF+ E+G+  YDA VL   +S+AD+FE+ +    D K V+NWV+ + L 
Sbjct: 298 KLPELPRARKERFVKEYGLPEYDAGVLTDSRSLADFFEEVVKAYDDPKTVSNWVMGEFLR 357

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
           ++   G  IE++ I+   L  ++ L   G IS KIAK +F  +++ G  P++IVEE GL+
Sbjct: 358 LIKEEGIVIEESKITGELLARMLKLQDKGVISSKIAKTVFEEMFKTGKDPEKIVEEKGLK 417

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q++D   +E +V++VI  NP  V  I   K   + + VGQVMK T GKANP +V K+L+E
Sbjct: 418 QISDEGQLEGIVEKVIEENPEAVEDIRGGKGKAIGYLVGQVMKETRGKANPQLVNKLLRE 477

Query: 495 KL 496
           K+
Sbjct: 478 KI 479


>gi|189426243|ref|YP_001953420.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Geobacter
           lovleyi SZ]
 gi|229486069|sp|B3EA25|GATB_GEOLS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|189422502|gb|ACD96900.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacter lovleyi
           SZ]
          Length = 475

 Score =  579 bits (1493), Expect = e-163,   Method: Composition-based stats.
 Identities = 243/478 (50%), Positives = 322/478 (67%), Gaps = 10/478 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           ++ VIG+EVH QL   SK+F G S  FGAEPN        A+PG LP+LN + V+ A+M 
Sbjct: 3   FQPVIGLEVHVQLKTDSKIFCGCSTRFGAEPNLNTCPVCLALPGALPVLNQKVVEFAIMA 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL  N  I+  ++FARKNYFYPDLP+GYQISQ D PI   G + +++G        T  +
Sbjct: 63  GLATNCSISPTNIFARKNYFYPDLPKGYQISQFDLPICLAGHLDIAVGDQ------TKRI 116

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI RIH+E+DAGK +H Q    S +DLNR+G  L+E+V++PDMR++ EA A+L KL  I+
Sbjct: 117 GITRIHMEEDAGKLVHGQGGG-SGVDLNRAGTPLLEVVSEPDMRTADEAVAYLKKLYQIV 175

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGE-AWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            YLG CDGNMEEGS R D NVSV   G   +GTR E+KNVNS +F+  AIEYE  RQ  +
Sbjct: 176 TYLGICDGNMEEGSFRCDANVSVMPVGSGTFGTRAEIKNVNSFKFVKAAIEYEIARQCEL 235

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDGG + QETRLFDP+K  TRS+R KE+A DYRYF +PDL+P+ I +D+I+ +K ++PE
Sbjct: 236 IEDGGKVVQETRLFDPNKGVTRSMRGKEEAHDYRYFPDPDLVPVVISDDWIKRVKNELPE 295

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVLNR 379
           LP+ K  RF+ E+ +  YDA VL S + +ADYFE+      + K  ANWV+ +L   LN 
Sbjct: 296 LPEVKFNRFLTEYSLPEYDADVLTSSRPLADYFEQCAQTCNNAKAAANWVMGELTRSLND 355

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           +G +IED+P+SP QL  LI LI  GTISG IAK +F  LW+ GG    IVE+ GL QV+D
Sbjct: 356 NGIAIEDSPVSPAQLAGLIKLIDGGTISGTIAKKVFEDLWKNGGEAAAIVEQQGLAQVSD 415

Query: 440 LSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
             AIE  +D+++ +N   V      K  +  +FVGQVMK   GKANP++V  +LK+KL
Sbjct: 416 TGAIETAIDQIMAANMGQVEEYRGGKDKVFGFFVGQVMKAMKGKANPAVVNDLLKQKL 473


>gi|91977482|ref|YP_570141.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodopseudomonas
           palustris BisB5]
 gi|123762648|sp|Q135J9|GATB_RHOPS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|91683938|gb|ABE40240.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodopseudomonas palustris BisB5]
          Length = 494

 Score =  579 bits (1492), Expect = e-163,   Method: Composition-based stats.
 Identities = 308/494 (62%), Positives = 391/494 (79%), Gaps = 10/494 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +   L  G TGDWEVVIG+E+HAQ+S  +KLFSGA+  FG +PN+ VS  DAAMPGMLP+
Sbjct: 6   KPSQLIKGATGDWEVVIGLEIHAQVSSNAKLFSGAATAFGGDPNSHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QA+ +GLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG V V + 
Sbjct: 66  INEECVKQAIRSGLGLNAQINLRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGIVVVDLP 125

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
              S     I VGIER+HLEQDAGK +HDQ+  ++ +DLNRSGVALMEIV+KPD+RSS +
Sbjct: 126 NGDS-----ITVGIERLHLEQDAGKLLHDQHPTMTFVDLNRSGVALMEIVSKPDLRSSEQ 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA+++KLR+ILRYLGTCDG+ME+GS+RADVNVSV +PGE +GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVSKLRTILRYLGTCDGDMEKGSLRADVNVSVRKPGEPYGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IEYEARRQI ILEDGG I QETRL+DP K ETRS+R+KE+A DYRYF +PDLLPLE  + 
Sbjct: 241 IEYEARRQIGILEDGGSIDQETRLYDPDKAETRSMRSKEEAHDYRYFPDPDLLPLEFSQA 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-----RDKKI 364
           ++  +K  +PELPD K+ RFIG FG+S  DA VLVS++  AD++E +        RD K+
Sbjct: 301 YVDELKTGLPELPDQKKSRFIGTFGLSSDDAGVLVSERESADFYEAVLAKLSDAARDGKL 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN+ G++I+ +P+S  QL  ++DLI +GTISGKIAK++F I+W +GG 
Sbjct: 361 AANWVINELFGRLNKDGQNIDTSPVSAAQLAAIVDLIGEGTISGKIAKELFEIVWREGGD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P+E+VE  G++QVTDL+AIEKVVD+++ SNP+ VA+   KP ++ WFVGQVMK++GGKAN
Sbjct: 421 PRELVEARGMKQVTDLTAIEKVVDDIVASNPDKVAQAIAKPAMLGWFVGQVMKSSGGKAN 480

Query: 485 PSIVQKMLKEKLGI 498
           P  V  +LK KLG+
Sbjct: 481 PQAVNDLLKRKLGL 494


>gi|39936167|ref|NP_948443.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodopseudomonas
           palustris CGA009]
 gi|47115635|sp|P61347|GATB_RHOPA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|39650022|emb|CAE28545.1| Glu-tRNA(Gln) amidotransferase subunit B [Rhodopseudomonas
           palustris CGA009]
          Length = 494

 Score =  579 bits (1492), Expect = e-163,   Method: Composition-based stats.
 Identities = 305/494 (61%), Positives = 393/494 (79%), Gaps = 10/494 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +   L  G TGDWEVVIG+E+HAQ+S  +KLFSGA+  FG + NT VS  DAAMPGMLP+
Sbjct: 6   KPSKLIKGATGDWEVVIGLEIHAQVSSNAKLFSGAATAFGGDQNTHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QA+ +GLGLNA I+  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V + 
Sbjct: 66  INEECVRQAIRSGLGLNAKIHLRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGEVVVDLP 125

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
              S     I VGIER+HLEQDAGK +HDQ+   + +DLNRSGVALMEIV+KPD+RSS +
Sbjct: 126 DGDS-----ITVGIERLHLEQDAGKLLHDQHPTSTFVDLNRSGVALMEIVSKPDLRSSEQ 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA+++KLR+I+RYLGTCDG+ME+GS+RADVNVSV RPGE +GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVSKLRTIMRYLGTCDGDMEKGSLRADVNVSVRRPGEPYGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IEYEARRQI ILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PDLLPLE  + 
Sbjct: 241 IEYEARRQIGILEDGGTIDQETRLFDANKGETRSMRSKEEAHDYRYFPDPDLLPLEFTQA 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-----LAVNRDKKI 364
           ++  +K  +PELPDAK+ERF+ +FG+S+ DA VLVS++  A+++E          RD K+
Sbjct: 301 YVDDLKAGLPELPDAKKERFVHDFGLSVEDAGVLVSERESAEFYEAVLAQLKDQGRDGKL 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN+ G+SI+ +P+S  QL  +++LI +GTISGKIAK++F I+W +GG 
Sbjct: 361 AANWVINELFGRLNKDGQSIDASPVSAAQLAAIVELIGEGTISGKIAKELFEIVWTEGGD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P+ +VE+ G++QVTDLSAIEKVVD+++ +NP+ VA++  KP ++ WFVGQVMK++GGKAN
Sbjct: 421 PRTLVEQRGMKQVTDLSAIEKVVDDIVAANPDKVAQVVAKPAMLGWFVGQVMKSSGGKAN 480

Query: 485 PSIVQKMLKEKLGI 498
           P  V  +LK KLG+
Sbjct: 481 PQAVNDLLKRKLGL 494


>gi|118581492|ref|YP_902742.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pelobacter
           propionicus DSM 2379]
 gi|166198800|sp|A1ATL4|GATB_PELPD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|118504202|gb|ABL00685.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Pelobacter propionicus DSM 2379]
          Length = 479

 Score =  578 bits (1491), Expect = e-163,   Method: Composition-based stats.
 Identities = 235/483 (48%), Positives = 327/483 (67%), Gaps = 12/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             ++ VIG+EVH QL   SK+F G S +FG++PN+Q       +PG LP+LN + V+ A+
Sbjct: 1   MKYQAVIGLEVHVQLKTDSKIFCGCSTSFGSDPNSQTCPVCLGLPGALPVLNKKVVEFAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL  N  I + S+FARKNYFYPDLP+GYQISQ + P+   G + + +         T 
Sbjct: 61  KAGLATNCSITQRSIFARKNYFYPDLPKGYQISQFEDPVCQWGWLDIELNG------ETK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYS---AVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            +GI RIH+E+DAGK +H         S +DLNR+   L+E+V++PD+RSS EA ++L +
Sbjct: 115 RIGITRIHMEEDAGKLVHADVPELEDGSGVDLNRACTPLLEVVSEPDLRSSDEAVSYLKQ 174

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSV-CRPGEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L  I+ +LG CDGNMEEGS R D NVSV  +  E +GTR E+KN+NS RF+  AIEYE +
Sbjct: 175 LHQIVTWLGICDGNMEEGSFRCDANVSVMEQGAEKFGTRAEIKNINSFRFVKQAIEYEIQ 234

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++EDGG + QETRLFDP    TRS+R+KE+A DYRYF +PDL+PL ID+D+I+ ++
Sbjct: 235 RQIDLIEDGGTVVQETRLFDPDNGVTRSMRSKEEAHDYRYFPDPDLVPLVIDDDWIQRVR 294

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDLL 374
           + +PELP+ K++RF+ EF I  YDA VL + + +A+Y+E+        K V+NWV+ ++ 
Sbjct: 295 QGLPELPEHKKQRFMSEFSIPAYDAEVLTASRPLAEYYEECVACHHDGKAVSNWVMGEVT 354

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
             LN SG SIE+ P++P  LG L+ L+ +GTISGKIAK +F+ +W+ G  P  IVEE GL
Sbjct: 355 RGLNDSGLSIENCPVTPRLLGGLLKLMDNGTISGKIAKTVFDEMWKSGKEPAVIVEEQGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            QV+D  AI  ++DE++  N   VA     K  L  +FVGQVMK + GKANPS+V ++L 
Sbjct: 415 VQVSDNGAILAIIDEIMAKNQGQVAEYRSGKDKLFGFFVGQVMKASKGKANPSLVNELLL 474

Query: 494 EKL 496
           EKL
Sbjct: 475 EKL 477


>gi|258514077|ref|YP_003190299.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257777782|gb|ACV61676.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 478

 Score =  578 bits (1491), Expect = e-163,   Method: Composition-based stats.
 Identities = 226/481 (46%), Positives = 320/481 (66%), Gaps = 13/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIGIE+H +L   +K+F  ++  FG +PNT V      +PG+LP+LN + V+ A+  
Sbjct: 4   YEAVIGIEIHVELKTNTKIFCHSTTEFGGDPNTHVCPVCLGLPGVLPVLNKQVVEYAIKA 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL LN  I +YS F RKNY+YPDLP+ YQISQ+D PI   G + V  G  K        +
Sbjct: 64  GLALNCEIAEYSKFDRKNYYYPDLPKNYQISQYDLPICKNGYLEVETGQGK------KRI 117

Query: 142 GIERIHLEQDAGKSIHDQY---SAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
           GI RIH+E+DAGK +H      S  S +D NR+GV L+EIV++PDMRS+ EA+A+  KLR
Sbjct: 118 GITRIHMEEDAGKLVHQGTITTSPYSLVDYNRTGVPLIEIVSEPDMRSAEEARAYAEKLR 177

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCRPGE-AWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           S+++Y G  D  MEEGS+R DVNVSV   G   +GTR E+KN+NS R +  A EYE  RQ
Sbjct: 178 SVIQYAGVSDCRMEEGSLRCDVNVSVHPVGTGEFGTRTEIKNMNSFRSIQKAAEYEIERQ 237

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I +LE+GG I QETR +D +K  T S+RTKE+A DYRYF +PDL+PL I+ +++ A++  
Sbjct: 238 IEVLENGGRIIQETRTWDENKGITVSMRTKEEAQDYRYFPDPDLVPLVIEREWVEAVRNS 297

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGV 376
           +PE+P+ +  R+I E G+S Y+A+VL + K ++DYF++      + K+V+NW++ DL  +
Sbjct: 298 LPEMPEQRVARYI-ESGLSEYEANVLTASKEVSDYFDQCLKTYNNPKMVSNWIMGDLSRL 356

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN     I D  + P QL +++ +I  GTISGKIAK +F  ++  G  P+ +V+E GL Q
Sbjct: 357 LNSVNMEICDCRVKPAQLADMLKMIDSGTISGKIAKTVFEEMFNTGKDPETVVKEKGLVQ 416

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           ++D SAI  VVDE+I +NP +V      K   + + VGQ+MK T GKANP +V K+LK+K
Sbjct: 417 ISDESAIAAVVDEIIAANPKSVEDFRNGKDKAIGFLVGQIMKATKGKANPQLVNKLLKDK 476

Query: 496 L 496
           L
Sbjct: 477 L 477


>gi|27380198|ref|NP_771727.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bradyrhizobium
           japonicum USDA 110]
 gi|47115785|sp|Q89K31|GATB_BRAJA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|27353352|dbj|BAC50352.1| glutamyl-tRNA amidotransferase subunit B [Bradyrhizobium japonicum
           USDA 110]
          Length = 492

 Score =  578 bits (1491), Expect = e-163,   Method: Composition-based stats.
 Identities = 301/491 (61%), Positives = 383/491 (78%), Gaps = 10/491 (2%)

Query: 13  SLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNG 72
            L  G TGDWE+VIG+E+HAQ++  SKLFSGAS  FG EPN+ VS  D AMPGMLP++N 
Sbjct: 7   KLLKGATGDWEMVIGMEIHAQVTSNSKLFSGASTAFGGEPNSHVSLVDVAMPGMLPVINE 66

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
            CV+QAV TGLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  P+VGEG+V V +    
Sbjct: 67  ECVRQAVRTGLGLNAKINLRSVFDRKNYFYPDLPQGYQISQYKSPVVGEGEVLVELDG-- 124

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKA 192
               R++ VGIER+H+EQD GK +HDQ  ++S ID NR GVALMEIV+KPD+R + +AKA
Sbjct: 125 ---GRSVTVGIERLHIEQDPGKMLHDQSPSLSLIDFNRCGVALMEIVSKPDIRDAEQAKA 181

Query: 193 FLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEY 252
           ++TKLRSI+RYLGTCDG+ME+G++RADVNVSV +PG   GTRCE+KN+NSI F+G AIEY
Sbjct: 182 YVTKLRSIMRYLGTCDGDMEKGNLRADVNVSVRKPGGPLGTRCEIKNMNSINFIGQAIEY 241

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           EARRQI ILEDGG I QETR FDP K ETRS+R+KE+A DYRYF +PDLLPLE  ++F+ 
Sbjct: 242 EARRQIEILEDGGQIEQETRRFDPDKGETRSMRSKEEAHDYRYFPDPDLLPLEFSQEFVD 301

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-----RDKKIVAN 367
            +K ++PELPD K+ RF+ +FG+S YDASVLV+++  A ++E +        RD K+ AN
Sbjct: 302 ELKAKLPELPDQKKTRFVADFGLSAYDASVLVAERESAVFYETVLDKLGDRARDGKMAAN 361

Query: 368 WVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKE 427
           WVIN+L G LN+ G+ I  +P++  QL  +IDLI +GTISGKIAKD+F I+W++GG P+ 
Sbjct: 362 WVINELFGRLNKEGRDITGSPVTAEQLAAIIDLIGEGTISGKIAKDLFEIVWQEGGDPRA 421

Query: 428 IVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSI 487
           +VE  G++QVTDLSAIEKVVD++I +NP+  A++  KP  + WFVGQVMK +GGKANP  
Sbjct: 422 LVESRGMKQVTDLSAIEKVVDDIIAANPDKAAQVKDKPQSLGWFVGQVMKASGGKANPQS 481

Query: 488 VQKMLKEKLGI 498
           V ++LK KLGI
Sbjct: 482 VNELLKSKLGI 492


>gi|90423772|ref|YP_532142.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodopseudomonas
           palustris BisB18]
 gi|109892057|sp|Q215W3|GATB_RHOPB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|90105786|gb|ABD87823.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodopseudomonas palustris BisB18]
          Length = 494

 Score =  578 bits (1491), Expect = e-163,   Method: Composition-based stats.
 Identities = 308/494 (62%), Positives = 384/494 (77%), Gaps = 10/494 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +   L  G TGDWE+VIG+EVHAQ+S  SKLFSGAS  FG +PN  VS  DAAMPGMLP+
Sbjct: 6   KPSKLIKGATGDWEIVIGLEVHAQVSSKSKLFSGASTEFGGDPNAHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QAV +GLGLNA IN  S F RKNYFYPDLPQGYQISQ   PIVGEG+V V + 
Sbjct: 66  INEECVKQAVRSGLGLNAQINLRSTFDRKNYFYPDLPQGYQISQFKSPIVGEGEVQVDVA 125

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
                    + VGIER+HLEQDAGK +HDQ   +S +DLNRSGVALMEIV+KPD+RS+ +
Sbjct: 126 DGDG-----VTVGIERLHLEQDAGKLLHDQNPTMSLVDLNRSGVALMEIVSKPDIRSADQ 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA++TKLR+ILRYLGTCDG+ME+GS+RADVNVSV +PG   GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRKPGAPLGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           I+YEARRQI ILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PDLLPL+ D+ 
Sbjct: 241 IDYEARRQIGILEDGGSIDQETRLFDAGKGETRSMRSKEEAHDYRYFPDPDLLPLQFDQA 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-----AVNRDKKI 364
           F+ A+K ++PELPDAK+ RFI +FG+S  DA VLVS++  A+++E +        RD K+
Sbjct: 301 FVDALKAELPELPDAKKARFIADFGLSADDAGVLVSERESAEFYETVLSKLADAGRDGKL 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN+ G +IE +P+S  QL  ++DLI + TISGKIAK++F I+W++GG 
Sbjct: 361 AANWVINELFGRLNKEGVAIEASPVSTAQLAAIVDLIGEATISGKIAKELFEIVWQEGGD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P+  VE  G+RQVTD  AIEKVVD+++N+NP+ VA+   KP L+ WFVGQVMK++GGKAN
Sbjct: 421 PRATVEARGMRQVTDTGAIEKVVDDIVNANPDKVAQAQAKPALIGWFVGQVMKSSGGKAN 480

Query: 485 PSIVQKMLKEKLGI 498
           P  V  +LK KLG+
Sbjct: 481 PQTVNDLLKSKLGL 494


>gi|296445893|ref|ZP_06887844.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylosinus
           trichosporium OB3b]
 gi|296256561|gb|EFH03637.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylosinus
           trichosporium OB3b]
          Length = 490

 Score =  578 bits (1490), Expect = e-163,   Method: Composition-based stats.
 Identities = 309/495 (62%), Positives = 388/495 (78%), Gaps = 5/495 (1%)

Query: 4   LDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAM 63
           ++    +   L  G TGDWEVV+G+E+HAQ+S  +KLFSGAS  +G EPN  VS  DAAM
Sbjct: 1   MNIRETQPSKLIKGATGDWEVVVGMEIHAQVSSKAKLFSGASAEYGGEPNDHVSLVDAAM 60

Query: 64  PGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGK 123
           PGMLP++N  CV+QA+ TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+
Sbjct: 61  PGMLPVINEECVRQAIRTGLGLQAQINLRSVFDRKNYFYPDLPQGYQISQYKHPIVGEGE 120

Query: 124 VSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPD 183
           V V + P +      I VGIER+HLEQDAGKS+HD     S +DLNRSGVALMEIV+KPD
Sbjct: 121 VVVDVTPTE-----RITVGIERLHLEQDAGKSMHDLSPTESHVDLNRSGVALMEIVSKPD 175

Query: 184 MRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSI 243
           +RS+ EA+A+++KLR+ILRY+G+CDGNME+GS+RADVNVSV +PG  +GTRCE+KNVNSI
Sbjct: 176 IRSAEEARAYVSKLRTILRYIGSCDGNMEQGSLRADVNVSVRKPGAPYGTRCEIKNVNSI 235

Query: 244 RFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLP 303
           RF+G AIE EARRQI ILEDGG IRQETRLFDP K ETRS+R+KE+A DYRYF +PDLLP
Sbjct: 236 RFIGQAIEVEARRQIGILEDGGVIRQETRLFDPGKGETRSMRSKEEAHDYRYFPDPDLLP 295

Query: 304 LEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKK 363
           LE D+ ++ A+K ++PELPD KR RFI E+G+  YDA VLV++++ AD+FE+ A  RD K
Sbjct: 296 LEFDQTYVDALKAELPELPDDKRARFIAEYGLPPYDAGVLVAERASADFFEEAATGRDAK 355

Query: 364 IVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG 423
           +VANWVIN+L G LN+ G  I  +P+S   +G ++DLI  G ISGKI KD+F I+W++GG
Sbjct: 356 LVANWVINELFGRLNKEGLDITRSPVSAAAIGAIVDLISQGVISGKIGKDVFEIVWQEGG 415

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKA 483
            P++IVE  GL+QVTD  AIEK +DE+I +NP+ VA+   KP ++ WFVGQVMK TGGKA
Sbjct: 416 DPRDIVETRGLKQVTDTGAIEKAIDEIIAANPDKVAQAKAKPTMLGWFVGQVMKGTGGKA 475

Query: 484 NPSIVQKMLKEKLGI 498
           NP  V ++LK +LGI
Sbjct: 476 NPQAVNELLKSRLGI 490


>gi|188585104|ref|YP_001916649.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179349791|gb|ACB84061.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 477

 Score =  578 bits (1490), Expect = e-163,   Method: Composition-based stats.
 Identities = 227/480 (47%), Positives = 318/480 (66%), Gaps = 9/480 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVH++L   +K+F G S +FG EPN+ V      MPG LP+LN R ++ A 
Sbjct: 2   ANYETVIGLEVHSELLTSTKIFCGCSTSFGDEPNSNVCPICLGMPGTLPVLNNRALELAA 61

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  I  +S F RKNYFYPDLP+ YQISQ D PI   G + V++  +K       
Sbjct: 62  KAGLSLNCEIADFSKFDRKNYFYPDLPKAYQISQFDLPIAKNGYLDVTVNGEK------K 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + I RIH+E+DAGK +H +    S +D NR+GV L+EIVT+PD+ S  EAKAFL  L++
Sbjct: 116 RIRINRIHMEEDAGKLVHSERGGGSLVDFNRTGVPLIEIVTEPDIGSPEEAKAFLEGLKA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL+Y    D  MEEGS+R D NVS+       +GT+ EVKN+NS R +  A+ YE  RQ 
Sbjct: 176 ILQYTDVSDCKMEEGSLRCDANVSLRPVGSTEFGTKTEVKNMNSFRAVERALNYEVERQA 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
             LEDG  I QETR +D  +  T S+R+KE+A DYRYF +PDL+P+ + E+ I  ++++I
Sbjct: 236 EALEDGEEIIQETRRWDEDRGITISMRSKEEAHDYRYFPDPDLVPVVMKEEQIEKVRQEI 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRD-KKIVANWVINDLLGVL 377
           PELP+ K+ERFI +F +S YDASV+ +DKS+A++F++     D  K +ANW++ ++  VL
Sbjct: 296 PELPNDKKERFIKDFNLSEYDASVITADKSLAEFFDECVKTYDEPKKIANWIMGEISRVL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N     IEDT ISP +L EL+ L  +GTIS KIAK++F  +++   +PK+IVEE GL Q+
Sbjct: 356 NEDQIGIEDTNISPERLTELLKLEDEGTISNKIAKEVFEDMYQNDKSPKQIVEEKGLVQI 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D S +E ++D+VI+ NP+ V      K   + + VGQVMK T GKANP  V ++L+EKL
Sbjct: 416 SDTSELEGIIDQVISENPSAVEDYRGGKKKAMGFLVGQVMKKTKGKANPQKVNELLQEKL 475


>gi|92117794|ref|YP_577523.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrobacter
           hamburgensis X14]
 gi|122417652|sp|Q1QL34|GATB_NITHX RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|91800688|gb|ABE63063.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Nitrobacter hamburgensis X14]
          Length = 494

 Score =  578 bits (1489), Expect = e-163,   Method: Composition-based stats.
 Identities = 307/494 (62%), Positives = 389/494 (78%), Gaps = 10/494 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +  +L  G TGDWE+VIG+EVHAQ++  +KLFSGAS  FG EPN+ VS  DAAMPGMLP+
Sbjct: 6   KPSNLIKGATGDWEMVIGLEVHAQVTSNAKLFSGASTAFGGEPNSHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QAV TGLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG++ V + 
Sbjct: 66  INEECVRQAVRTGLGLNAQINLRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGEIVVDLA 125

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
                   +I VGIER+HLEQDAGKS+HDQ++ +S IDLNRSGVALMEIV+KPD+RSS +
Sbjct: 126 D-----GASIAVGIERLHLEQDAGKSLHDQHADMSAIDLNRSGVALMEIVSKPDLRSSEQ 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA++TKLR+ILRYLGTCDG+ME+GS+RADVNVSV RPG A GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGAALGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IE+EARRQI ILEDGG I QETRLFDP K ETR++R+KE+A DYRYF +PDLLPLE  + 
Sbjct: 241 IEHEARRQIGILEDGGSIDQETRLFDPDKGETRAMRSKEEAHDYRYFPDPDLLPLEFSQG 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-----RDKKI 364
           F+ A+K  +PELPD K+ RFIG+FG++ YDA+VLV +   A+++E +        RD K+
Sbjct: 301 FVEALKADLPELPDQKKTRFIGDFGLTPYDAAVLVGEHESANFYEAVLAGLANGRRDGKL 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN+  + I  +P+S +QL  ++DLI + TISGKIAKD+F I+W +GG 
Sbjct: 361 AANWVINELFGRLNKESRGIAASPVSASQLAAIVDLIGEETISGKIAKDLFEIVWTEGGD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P+ +VE  G++QVTD+ AIEK VD+++ +NP+  A++  KP ++ WFVGQVMK +GGKAN
Sbjct: 421 PRTLVEARGMKQVTDMGAIEKAVDDIVAANPDKAAQVRAKPQMIGWFVGQVMKASGGKAN 480

Query: 485 PSIVQKMLKEKLGI 498
           P  V  +LK KLG+
Sbjct: 481 PQAVNDLLKTKLGL 494


>gi|316933663|ref|YP_004108645.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Rhodopseudomonas
           palustris DX-1]
 gi|315601377|gb|ADU43912.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Rhodopseudomonas
           palustris DX-1]
          Length = 494

 Score =  578 bits (1489), Expect = e-163,   Method: Composition-based stats.
 Identities = 309/492 (62%), Positives = 392/492 (79%), Gaps = 10/492 (2%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
             L  G TGDWEVVIG+E+HAQ+S  +KLFSGA+  FG E N+ VS  DAAMPGMLP++N
Sbjct: 8   SKLIKGATGDWEVVIGLEIHAQVSSHAKLFSGAATAFGGEQNSHVSLVDAAMPGMLPVIN 67

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV+QA+ +GLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V +   
Sbjct: 68  EECVRQAIRSGLGLNAKINLRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGEVVVDLPDG 127

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
            S     I VGIER+HLEQDAGK +HDQ+   + +DLNRSGVALMEIV+KPD+RSS +AK
Sbjct: 128 DS-----ITVGIERLHLEQDAGKLLHDQHPTSTFVDLNRSGVALMEIVSKPDIRSSEQAK 182

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A+++KLR+ILRYLGTCDG+ME+GS+RADVNVSV RPGE +GTRCE+KNVNSIRF+G AIE
Sbjct: 183 AYVSKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGEPYGTRCEIKNVNSIRFIGQAIE 242

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
           YEARRQI ILEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PDLLPLE  + ++
Sbjct: 243 YEARRQIGILEDGGTIDQETRLFDANKGETRSMRSKEEAHDYRYFPDPDLLPLEFSQAYV 302

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-----AVNRDKKIVA 366
             +K  +PELPDAK+ RFI +FG+S  DA VLVS++  A+++E +        RD K+ A
Sbjct: 303 DELKSGLPELPDAKKARFIRDFGLSAEDAGVLVSERESAEFYEAVLERLGDQARDGKLAA 362

Query: 367 NWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK 426
           NWVIN+L G LN+ G+SIE +P+S  QL  +++LI +GTISGKIAK++F I+W +GG P+
Sbjct: 363 NWVINELFGRLNKDGQSIESSPVSAAQLAAIVELIGEGTISGKIAKELFEIVWTEGGDPR 422

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPS 486
            +VE+ G++QVTDLSAIEKVVD+++ +NP+ VA++A KP ++ WFVGQVMK++GGKANP 
Sbjct: 423 TLVEQRGMKQVTDLSAIEKVVDDIVAANPDKVAQVAAKPAMLGWFVGQVMKSSGGKANPQ 482

Query: 487 IVQKMLKEKLGI 498
            V  +LK KLG+
Sbjct: 483 AVNDLLKRKLGL 494


>gi|158424471|ref|YP_001525763.1| glutamyl-tRNA(Gln) amidotransferase B subunit [Azorhizobium
           caulinodans ORS 571]
 gi|229486037|sp|A8ICV0|GATB_AZOC5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|158331360|dbj|BAF88845.1| glutamyl-tRNA(Gln) amidotransferase B subunit [Azorhizobium
           caulinodans ORS 571]
          Length = 492

 Score =  577 bits (1488), Expect = e-162,   Method: Composition-based stats.
 Identities = 311/498 (62%), Positives = 385/498 (77%), Gaps = 6/498 (1%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M +       ++ L  G TG+WEVVIG+E+HAQ+S  +KLFSGAS  FG  PN  VS  D
Sbjct: 1   MTA-HVRPTDAKKLIKGATGNWEVVIGMEIHAQVSSNAKLFSGASTAFGGPPNDHVSLVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ+  PIVG
Sbjct: 60  AAMPGMLPVINKECVAQAVRTGLGLRAQINLRSTFDRKNYFYPDLPQGYQISQYKSPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +   +S       VGIER+HLEQDAGKSIHD    +S +DLNRSGVALMEIV+
Sbjct: 120 EGEVIVDLLDGES-----FVVGIERLHLEQDAGKSIHDLSPTLSFVDLNRSGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           +PD+RSS EA+A++TKLRSILRYLGTCDG+ME+G++RADVNVSV RPGE  GTRCE+KNV
Sbjct: 175 RPDLRSSEEARAYVTKLRSILRYLGTCDGDMEKGNLRADVNVSVRRPGEPLGTRCEIKNV 234

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRF+G AIE EARRQI ILEDGG I QETRLFDP+K ETRS+R+KE+A DYRYF +PD
Sbjct: 235 NSIRFIGQAIEVEARRQIEILEDGGVIDQETRLFDPNKGETRSMRSKEEAHDYRYFPDPD 294

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPL +  DF+  +K  +PELPD K+ RFI ++G+S YDASVLV+++  ADYFE++A  R
Sbjct: 295 LLPLVLHADFVEELKSHLPELPDEKKARFIADYGLSPYDASVLVAERDTADYFEQVAKGR 354

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           D K  AN+VIN+L G LN+ GK +  +P+SP Q+  ++DLI +G IS KIAKD+F I++ 
Sbjct: 355 DGKAAANFVINELFGRLNKDGKDVITSPVSPAQVAAIVDLIGEGVISSKIAKDLFEIVYT 414

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           +GG P+ +VEE GL+QVTD  AIEKVVDE+I +NP+ VA++  KP ++ WFVGQ MK +G
Sbjct: 415 EGGDPRVLVEERGLKQVTDTGAIEKVVDEIIAANPDKVAQVQAKPTMLGWFVGQAMKASG 474

Query: 481 GKANPSIVQKMLKEKLGI 498
           GKANP  +  +LK KLGI
Sbjct: 475 GKANPQALNDILKRKLGI 492


>gi|302389231|ref|YP_003825052.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Thermosediminibacter oceani DSM 16646]
 gi|302199859|gb|ADL07429.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Thermosediminibacter oceani DSM 16646]
          Length = 475

 Score =  577 bits (1488), Expect = e-162,   Method: Composition-based stats.
 Identities = 213/480 (44%), Positives = 325/480 (67%), Gaps = 9/480 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVH +L   SK+F G +  FG E NT        MPG+LP+ N + V+ A+
Sbjct: 1   MEFETVIGLEVHVELHTKSKIFCGCTTEFGGEVNTHCCPVCLGMPGVLPVTNKKAVEYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              L LN  I ++S F RKNYFYPDLP+ YQISQ+D P+   G + + +        +  
Sbjct: 61  KAALALNCEIAEFSKFDRKNYFYPDLPKAYQISQYDLPLARNGYIEIEVDG------KVK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R+HLE+DAGK +H++  + S +DLNR+GV L+EIV++PD+RS  EA  +L KL++
Sbjct: 115 RIGINRVHLEEDAGKLVHEEGKSYSLVDLNRTGVPLIEIVSEPDIRSPEEAWLYLNKLKT 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL+Y+   D  MEEGS+R D N+S+     + +GT+ E+KN+ S R +  ++EYE +RQ 
Sbjct: 175 ILQYIEVSDCKMEEGSLRCDTNISIRPKGSDRFGTKVELKNLGSFRAVRRSLEYEEKRQR 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ILE GG I QETR +D ++  T SLR+KE+A DYRYF +PDL+P+ I+ +++  +K ++
Sbjct: 235 EILEQGGAIVQETRRWDEARGITISLRSKEEAHDYRYFPDPDLVPIVIEREWVEKLKSEL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELPDA+++R++ E+G+  YDA V+ + K++A++FE+      D K ++NWV+++++G+L
Sbjct: 295 PELPDARKKRYVEEYGLPAYDAEVITASKALANFFEQCVSLYHDPKTISNWVMSEMMGIL 354

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N +G+ +ED P+ P  L +++ +I DGTISGKIAK++F  +++ G  P+ IV+E GL Q+
Sbjct: 355 NETGREVEDIPLGPEHLVKMLKMIDDGTISGKIAKEVFREMFDTGKDPEAIVKEKGLVQI 414

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D + +EKV  +VI  NP +V      K   + + VGQVMK T GKANP +V K+LKE L
Sbjct: 415 SDEAELEKVARKVIEENPKSVEDYRNGKEKAIGFLVGQVMKETRGKANPQLVNKILKELL 474


>gi|170746915|ref|YP_001753175.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|229486440|sp|B1LUB2|GATB_METRJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|170653437|gb|ACB22492.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 490

 Score =  577 bits (1488), Expect = e-162,   Method: Composition-based stats.
 Identities = 317/490 (64%), Positives = 386/490 (78%), Gaps = 5/490 (1%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
             + L  G   DWEV++G+E+HAQ+S  +KLFSGAS  FGAEPN  VS  DAAMPGMLP+
Sbjct: 6   DPKKLIKGGLHDWEVIVGMEIHAQVSSRAKLFSGASTEFGAEPNDHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V + 
Sbjct: 66  INAECVAQAVRTGLGLKAKINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEVLVDLA 125

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
                   +I VGIER+HLEQDAGKS+HDQ    S +DLNRSGVALMEIV++PD+RSS E
Sbjct: 126 D-----GASITVGIERLHLEQDAGKSLHDQDPTRSFVDLNRSGVALMEIVSRPDLRSSEE 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA++TKLR+ILRYLGTCDG+ME+GS+RADVNVSV RPGE  GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IE EARRQIAILEDGG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLPLE D+ 
Sbjct: 241 IETEARRQIAILEDGGTIDQETRLFDPTKGETRSMRSKEEAHDYRYFPDPDLLPLEFDQA 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWV 369
           ++ A+ + +PELPDAK+ RF+  FG+S YDA VLV++++ ADY+E +A  RD K  ANWV
Sbjct: 301 YVDALAEGLPELPDAKKARFVSAFGLSPYDAGVLVAERASADYYEAVAKGRDGKAAANWV 360

Query: 370 INDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIV 429
           IN+L G LN+ G SIE TP+S +QLG +IDLI +G ISGKIAKD+F I+W +GG P+ +V
Sbjct: 361 INELFGRLNKEGLSIEATPVSADQLGTIIDLIGEGVISGKIAKDLFEIVWTEGGDPRVVV 420

Query: 430 EELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQ 489
           E  G++QVTD  AIE  VD++I +NP+ VA+   KP L+ WFVGQ MK TGGKANP+ V 
Sbjct: 421 ESRGMKQVTDTGAIEAAVDQIIAANPDKVAQAKEKPTLLGWFVGQTMKATGGKANPAAVN 480

Query: 490 KMLKEKLGIK 499
            +LK KLGI+
Sbjct: 481 ALLKAKLGIE 490


>gi|85716415|ref|ZP_01047387.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrobacter sp.
           Nb-311A]
 gi|85696772|gb|EAQ34658.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrobacter sp.
           Nb-311A]
          Length = 494

 Score =  577 bits (1487), Expect = e-162,   Method: Composition-based stats.
 Identities = 308/494 (62%), Positives = 392/494 (79%), Gaps = 10/494 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +  +L  G TGDWE+VIGIEVHAQ++  +KLFSGAS  FG  PN+ VSF DAAMPGMLP+
Sbjct: 6   KPSNLIKGATGDWEMVIGIEVHAQVTSNAKLFSGASTAFGGNPNSHVSFVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +NG CV+QAV TGLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+V V + 
Sbjct: 66  INGECVRQAVRTGLGLNARINLRSVFDRKNYFYPDLPQGYQISQYQSPIVGEGEVVVDLA 125

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
                   +  VGIER+HLEQDAGKS+HDQ++ +S IDLNRSGVALMEIV+KPD+RSS +
Sbjct: 126 D-----GTSFTVGIERLHLEQDAGKSLHDQHADMSAIDLNRSGVALMEIVSKPDLRSSEQ 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA++TKLR+ILRYLGTCDG+ME+G++RADVNVSV RPGE +GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRRPGEPFGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IE+EARRQI ILEDG  I QETRLFDP K ETR++R+KE+A DYRYF +PDLLPLE  + 
Sbjct: 241 IEHEARRQIGILEDGDSIDQETRLFDPDKGETRAMRSKEEAHDYRYFPDPDLLPLEFSQS 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-----AVNRDKKI 364
           F+ A++  +PELPD K+ RFI + G++ YDA+VLVS+   A+++E +        RD K+
Sbjct: 301 FVEALRADLPELPDQKKARFIADLGLTPYDAAVLVSEHECANFYESVLGGLADARRDGKV 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN+ G SI  +P+S +QL  +IDLI +GTISGKIAKD+F I+W +GG 
Sbjct: 361 AANWVINELFGRLNKEGLSIAASPVSASQLAAIIDLIGEGTISGKIAKDLFEIVWTEGGD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P+ +V+E G++QVTD+ AIEK+V +++++NP+ VA++  KP ++ WFVGQVMK +GGK N
Sbjct: 421 PRVLVDERGMKQVTDMGAIEKLVADIVDANPDKVAQVRAKPQMIGWFVGQVMKASGGKVN 480

Query: 485 PSIVQKMLKEKLGI 498
           P  V  +LK KLG+
Sbjct: 481 PQAVNDLLKTKLGL 494


>gi|296132393|ref|YP_003639640.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermincola sp. JR]
 gi|296030971|gb|ADG81739.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermincola potens
           JR]
          Length = 482

 Score =  577 bits (1486), Expect = e-162,   Method: Composition-based stats.
 Identities = 227/486 (46%), Positives = 329/486 (67%), Gaps = 13/486 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           + D+EV+IG+EVHA+L   SK+F  +S  FG +PNT V      +PG+LP+LN + V+ A
Sbjct: 2   SADYEVIIGLEVHAELKTDSKIFCCSSTEFGGDPNTHVCPVCLGLPGVLPVLNKKVVEFA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           + TGL LN  I ++S F RKNY+YPDLP+ YQISQ+D PI   G + +++  ++      
Sbjct: 62  IKTGLALNCKIAEFSKFDRKNYYYPDLPKNYQISQYDLPIAEHGYLDITVNGEQ------ 115

Query: 139 IEVGIERIHLEQDAGKSIHDQ----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFL 194
             +GI R+H+E+DAGK +H+      S  S +D NR+GV L+EIV++PDMRS  EA+ +L
Sbjct: 116 KRIGITRVHMEEDAGKLVHEGATIASSKYSRVDYNRTGVPLVEIVSEPDMRSPEEARLYL 175

Query: 195 TKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYE 253
            KL++IL+Y+   D  MEEGS+R D N+SV     + +GT+ E+KN+NS R L  A+EYE
Sbjct: 176 EKLKAILQYIDVSDCKMEEGSLRCDANISVRPVGQKEFGTKTELKNMNSFRALQRALEYE 235

Query: 254 ARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRA 313
            +RQI ILE+GG + QETR +D +K  T S+R+KE A DYRYF +PDL+PL IDE+++  
Sbjct: 236 VQRQIEILEEGGRVVQETRTWDENKGITLSMRSKEQAHDYRYFPDPDLVPLVIDEEWVNK 295

Query: 314 IKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVIND 372
           IK  +PELPD ++ R++ ++G+  YDA V+ + K+++DYF++      + K ++NWV+ +
Sbjct: 296 IKATLPELPDQRKARYVEQYGLPEYDAEVITASKALSDYFDRCLKYYDNPKALSNWVMGE 355

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEEL 432
           LL  LN +   I +  ISP  + EL+ LI  GTISGKIAK +F  ++  G  P++IV++ 
Sbjct: 356 LLKHLNGANIDITECKISPENMAELLTLIDKGTISGKIAKTVFEEMFATGEKPEKIVQDK 415

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL Q++D SAI  +VDEVI +NP +V      K   + + VGQVMK T GKANP IV K+
Sbjct: 416 GLVQISDESAIAALVDEVIANNPQSVEDYKNGKDRALGFLVGQVMKATKGKANPEIVNKL 475

Query: 492 LKEKLG 497
           LKE+L 
Sbjct: 476 LKERLN 481


>gi|53802671|ref|YP_112636.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Methylococcus
           capsulatus str. Bath]
 gi|81683215|sp|Q60CK9|GATB_METCA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|53756432|gb|AAU90723.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylococcus
           capsulatus str. Bath]
          Length = 476

 Score =  577 bits (1486), Expect = e-162,   Method: Composition-based stats.
 Identities = 244/481 (50%), Positives = 333/481 (69%), Gaps = 10/481 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +WE VIG+E+HAQL+  SK+FSGA   +GAEPNTQ    D  +PG+LP+LN   V+ AV
Sbjct: 1   MEWETVIGLEIHAQLATRSKIFSGAPTAYGAEPNTQACAIDLGLPGVLPVLNREAVRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I   SVFARKNYFYPDLP+GYQISQ+D P+V  GK+S+++        + +
Sbjct: 61  KFGLAIGAEIAPVSVFARKNYFYPDLPKGYQISQYDLPVVARGKLSINVDG------KAL 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +   + IDLNR+G  L+EIV++PD+RS+ EA A++ KL +
Sbjct: 115 TIGITRAHLEEDAGKSLHEDFHGYTGIDLNRAGTPLLEIVSEPDLRSAKEAVAYMKKLHA 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYL  CDGNM+EGS R D NVSV       +GTR E+KN+NS RF+  AI +E  RQI
Sbjct: 175 LVRYLEICDGNMQEGSFRCDANVSVRPKGQTKFGTRAEIKNLNSFRFVEKAINHEIARQI 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ILE GG + QETRL+D  K+ETRS+R+KE+A DYRYF +PDLLPLEI   FI  +K  +
Sbjct: 235 EILEGGGEVIQETRLYDSVKDETRSMRSKEEANDYRYFPDPDLLPLEISSGFIEEVKATL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK--LAVNRDKKIVANWVINDLLGV 376
           PELPDAKR+RF  ++G+S YDA VL + + +AD++E        D K+ ANWV+ +L G+
Sbjct: 295 PELPDAKRDRFKAQYGLSDYDAEVLTASREMADFYETVVREAAGDPKLCANWVMVELSGL 354

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN+ G  I  + I    L  L+  I D TISGKIAK +   +W +GG+  +I+E  GL+Q
Sbjct: 355 LNKDGLEITASKIDAAGLASLVRRIADATISGKIAKQVLETMWNEGGSADDIIERQGLKQ 414

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           +TD  AIE ++D++I +NP  +A+    K  L  +FVGQ MK T GKANP+ + ++LK+K
Sbjct: 415 ITDTGAIESIIDQIIAANPEQLAQYRAGKDKLFGFFVGQAMKATQGKANPAQLNELLKKK 474

Query: 496 L 496
           L
Sbjct: 475 L 475


>gi|163792878|ref|ZP_02186854.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [alpha
           proteobacterium BAL199]
 gi|159181524|gb|EDP66036.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [alpha
           proteobacterium BAL199]
          Length = 490

 Score =  576 bits (1485), Expect = e-162,   Method: Composition-based stats.
 Identities = 295/490 (60%), Positives = 369/490 (75%), Gaps = 10/490 (2%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
                G TG WEVVIG+EVHAQ+   SKLFSG++  FGA  NTQVS  DAAMPGMLP++N
Sbjct: 4   PYRIQGETGAWEVVIGLEVHAQVISKSKLFSGSATTFGAGANTQVSLVDAAMPGMLPVIN 63

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QAV TGL L A IN  SVF RKNYFY DLPQGYQISQ+++PIVGEG V + +   
Sbjct: 64  RECVDQAVRTGLALEAKINPVSVFDRKNYFYADLPQGYQISQYEQPIVGEGVVHLDLPDS 123

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
           +     T EVGIER+HLEQDAGKS+HDQ+ + S IDLNRSGVALMEIV+KPD+RS  +  
Sbjct: 124 E-----TKEVGIERLHLEQDAGKSLHDQHPSKSYIDLNRSGVALMEIVSKPDLRSPEDTA 178

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A++ KLRSILRY+GTCDGNM+EGSMR DVNVSV +PG+ +GTRCE+KNVNSIRF+  AIE
Sbjct: 179 AYIKKLRSILRYIGTCDGNMQEGSMRCDVNVSVRKPGDEYGTRCEIKNVNSIRFVQQAIE 238

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
           YEARRQ+ +LE+GG I+QETRLFD ++ ETRS+R+KEDA DYRYF +PDLLPL++D   +
Sbjct: 239 YEARRQVEVLEEGGSIKQETRLFDANRGETRSMRSKEDAHDYRYFPDPDLLPLKLDPARV 298

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRD----KKIVAN 367
            A+K  +PELPD K+ RFI E+G+S+YDAS L+ +++IAD++E L    +     KI AN
Sbjct: 299 EALKAALPELPDVKKARFIAEYGLSVYDASSLIEERAIADWYEALVKGGNGKRDPKIAAN 358

Query: 368 WVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKE 427
           W I++L G LN++G  + D+P+S + LG LIDLI DGTISG+IAKD+F  ++E G     
Sbjct: 359 WTISELFGALNKAGFDLADSPVSADALGGLIDLIGDGTISGRIAKDVFAEMFETGKDAAA 418

Query: 428 IVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPS 486
           IVEE GLRQV+D  AIE +VD V+  N + VA     K  L  +FVGQ MK +GGKANP 
Sbjct: 419 IVEEKGLRQVSDTGAIEAIVDAVLAENQDKVAEFRSGKDKLFGFFVGQTMKRSGGKANPG 478

Query: 487 IVQKMLKEKL 496
           +V ++LK KL
Sbjct: 479 MVNELLKAKL 488


>gi|134300179|ref|YP_001113675.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Desulfotomaculum
           reducens MI-1]
 gi|134052879|gb|ABO50850.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Desulfotomaculum reducens MI-1]
          Length = 479

 Score =  576 bits (1485), Expect = e-162,   Method: Composition-based stats.
 Identities = 221/484 (45%), Positives = 314/484 (64%), Gaps = 12/484 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  +E VIGIEVH +L   +K+F  ++  FG +PN         +PG LP+LN + V+ A
Sbjct: 2   TQQYETVIGIEVHVELKTNTKIFCNSTTEFGGDPNHHTCPVCLGLPGTLPVLNKKVVEYA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           V   L LN  +  +S F RKNY+YPDLP+ YQISQ+D PI   G + +            
Sbjct: 62  VRASLALNCQVANFSKFDRKNYYYPDLPKNYQISQYDLPIAEHGYLDIVADGQ------P 115

Query: 139 IEVGIERIHLEQDAGKSIHDQY---SAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
             +GI R+H+E+DAGK +H      +  S +D NR+GV L+EIV++PDMRSS EA+A++ 
Sbjct: 116 KRIGITRLHMEEDAGKLVHQGNIVTTPYSLVDYNRTGVPLIEIVSEPDMRSSEEARAYVE 175

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEA 254
           KL++I++Y G  D  MEEGS+R DVNVSV     + +GT+ E+KN+NS R L  A+++E 
Sbjct: 176 KLKAIVQYTGVSDCRMEEGSLRCDVNVSVRPVGQKEFGTKAEIKNLNSFRALQRALDFEV 235

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
            RQI +LE GG I QETR +D ++  T S+R+KE+A DYRYF +PDL+PL +D  +I  I
Sbjct: 236 ERQIGVLESGGRIIQETRTWDEARGITVSMRSKEEAHDYRYFPDPDLVPLVLDNQWIDFI 295

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDL 373
           ++ +PELPD +R R+I E+G+  YDA++L   K ++DYFE+ +    + K ++NW++ +L
Sbjct: 296 RESLPELPDQRRSRYITEYGLPEYDAALLTLTKEMSDYFEEVMEHYNNPKAISNWIMGEL 355

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
             +LN  G  I    I P QL E++ L+  GTISGKIAK +F  ++  G  P+ IV+E G
Sbjct: 356 SRLLNAGGIEITACKIKPAQLAEMLKLLDKGTISGKIAKAVFEEMFASGKDPEAIVKEKG 415

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           L Q++D  AI  +VDEVI +NP +V    A K   + + VGQVMK T GKANP +V KML
Sbjct: 416 LVQISDEGAIASIVDEVIAANPKSVQDYQAGKTQAIGFLVGQVMKATKGKANPEMVNKML 475

Query: 493 KEKL 496
           +EKL
Sbjct: 476 REKL 479


>gi|294084178|ref|YP_003550936.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663751|gb|ADE38852.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 484

 Score =  576 bits (1485), Expect = e-162,   Method: Composition-based stats.
 Identities = 278/487 (57%), Positives = 365/487 (74%), Gaps = 6/487 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
             L +G TGDWEVVIG+EVHAQ+S  +KLFSGA   FGAEPN  VS  DAAMPGMLP++N
Sbjct: 2   SDLVAGRTGDWEVVIGLEVHAQVSSSAKLFSGAPTKFGAEPNQNVSLVDAAMPGMLPVIN 61

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QAV TGLGL A IN +SVF RKNYFY DLPQGYQISQ  +PIVGEG + + +   
Sbjct: 62  SECVYQAVRTGLGLKAEINLFSVFDRKNYFYADLPQGYQISQFKQPIVGEGILRIDLADG 121

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
            S      ++GIER+HLEQDAGKS+HDQ+ + S IDLNR+GVALMEIV++PD+RS+ +A 
Sbjct: 122 SS-----KDIGIERLHLEQDAGKSMHDQHPSKSYIDLNRTGVALMEIVSRPDIRSATQAA 176

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A++ KLRSILRYLGTCDGNMEEGSMRADVNVSV RPG+  GTR E KN+NS+RF+  AI+
Sbjct: 177 AYVRKLRSILRYLGTCDGNMEEGSMRADVNVSVRRPGDELGTRTETKNLNSLRFIQQAID 236

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
           YE  RQI ++EDGG I QETRLFD +   TR++R+KEDA DYRYF +PDLLPLEI +  +
Sbjct: 237 YEVARQIEVIEDGGTIDQETRLFDTNTGMTRTMRSKEDAHDYRYFPDPDLLPLEITQSDV 296

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
             +  ++PELPD+ ++R + ++G+S YDA+V+  ++  A ++E  +  RD+K+VANW+  
Sbjct: 297 DKLAAELPELPDSIKDRLMNDYGLSAYDAAVITEERETAAFYEAASKGRDRKLVANWMTV 356

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           +L G LN++G  +  +P+SP+ LG L+D+I DGTISG+IAKD+F  +   G    +IVEE
Sbjct: 357 ELFGALNKAGLDLARSPVSPDALGGLVDMISDGTISGRIAKDVFADMMLSGKQAADIVEE 416

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+QV+D  AIE ++D+V+ +N + VA     K  L  +FVGQVMK +GG+ANP +V +
Sbjct: 417 KGLKQVSDSGAIETLIDDVMAANEDKVAEYRGGKDKLFGFFVGQVMKQSGGQANPGMVNQ 476

Query: 491 MLKEKLG 497
           +L+ KL 
Sbjct: 477 LLRSKLD 483


>gi|198283876|ref|YP_002220197.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218665662|ref|YP_002426511.1| glutamyl-tRNA(Gln)/aspartyl-tRNA(Asn) amidotransferase, B subunit
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198248397|gb|ACH83990.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218517875|gb|ACK78461.1| glutamyl-tRNA(Gln)/aspartyl-tRNA(Asn) amidotransferase, B subunit
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 478

 Score =  575 bits (1482), Expect = e-162,   Method: Composition-based stats.
 Identities = 252/479 (52%), Positives = 342/479 (71%), Gaps = 6/479 (1%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
             DWEVVIG+EVHAQL+  +K+F G    FGAEPN+       AMPG LP+LN   V +A
Sbjct: 2   NMDWEVVIGLEVHAQLNTATKIFCGCPTAFGAEPNSHTCPVCLAMPGALPVLNAAAVDKA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           +  GL + A +N++S+FARKNYFYPDLP+GYQISQ++ P+VG+G ++V +          
Sbjct: 62  IALGLAIGAELNRHSIFARKNYFYPDLPKGYQISQYELPVVGKGTLTVQLPDGG-----E 116

Query: 139 IEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
             VG+ R HLE+DAGKS+H+ +   S IDLNR+G  L+EIV++PDMRSS EA A+L KL 
Sbjct: 117 KVVGVTRAHLEEDAGKSLHEAFIGQSGIDLNRAGTPLLEIVSEPDMRSSAEAVAYLKKLH 176

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           +++RYL  CDGNM+EGS R D NVS+ RPG  +GTR E+KN+NS RFL  AIEYE  RQ 
Sbjct: 177 TLVRYLDICDGNMQEGSFRCDANVSLRRPGAPYGTRAEIKNLNSFRFLEKAIEYEIGRQR 236

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ILE GG I QETRL+D +++ETRS+R KE+A DYRYF +PDLLPL +DE  I  +++ +
Sbjct: 237 DILESGGQIVQETRLYDANRDETRSMRGKEEANDYRYFPDPDLLPLVLDESRIERVRETL 296

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLN 378
           PELPDA+R RF+ ++ + +YDA VL + +++ADY+E++AV+ D K+ ANWV+ DLLG LN
Sbjct: 297 PELPDARRIRFMRQYALPVYDAGVLTAGRTLADYYEQVAVDVDGKLAANWVMGDLLGALN 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++   IED P+S  +L  L+  I D TISGKIAK+IF  ++ +GG    I+E+ GLRQ+T
Sbjct: 357 KASIEIEDCPVSAEKLRLLVQRIEDQTISGKIAKEIFEEIFYRGGEVDAIIEDRGLRQIT 416

Query: 439 DLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           D++AI  +VD ++ +NP   A     K  L+ +FVGQVMK + GKANP  V  +L E+L
Sbjct: 417 DVAAIAAMVDAIVTANPQQAADFRAGKDKLLGFFVGQVMKASQGKANPDQVNAILLERL 475


>gi|322421571|ref|YP_004200794.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Geobacter sp. M18]
 gi|320127958|gb|ADW15518.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacter sp. M18]
          Length = 480

 Score =  575 bits (1482), Expect = e-162,   Method: Composition-based stats.
 Identities = 236/485 (48%), Positives = 322/485 (66%), Gaps = 13/485 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             ++VVIG+EVH QL+  +K+F G S  FGAEPN+Q        PG LP+LN + V+ A+
Sbjct: 1   MKYQVVIGLEVHTQLTTNTKIFCGCSTRFGAEPNSQTCPVCLGFPGALPVLNRQVVEFAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           + GL  N  I + +VFARKNYFYPDLP+GYQISQ D PI   G + + +  ++       
Sbjct: 61  LAGLATNCSITQRNVFARKNYFYPDLPKGYQISQFDLPICQHGHLDIEVEGEQ------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSA---VSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            +GI RIH+E+DAGK +H         SC+DLNR+   L+EIV++PDMRS  EA A+L K
Sbjct: 115 RIGITRIHMEEDAGKLVHADIPGVGDDSCVDLNRACTPLLEIVSEPDMRSPDEAIAYLKK 174

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEAR 255
           L  I+ YLG CDGN+EEGS R D NVS+   G + +GTR E+KN+NS +F+  AIEYE  
Sbjct: 175 LHQIVMYLGICDGNLEEGSFRCDANVSLMPVGSSVFGTRAELKNINSFKFIKQAIEYEME 234

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQ  IL++GG I QETRLFDP+   TRS+R KE+A DYRYF +PDL+P+ I + +I  ++
Sbjct: 235 RQAEILDEGGRIIQETRLFDPTTGTTRSMRGKEEAHDYRYFPDPDLVPVIIPDQWIEEVR 294

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLL 374
             +PELP+AKR R+I E G+  YDA VLV+   +A Y+E+        K V+NWV+ ++ 
Sbjct: 295 GTLPELPEAKRARYIAELGLPAYDAEVLVASCELARYYEETVALFPQAKTVSNWVMGEVT 354

Query: 375 GVLNRSGK-SIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
             LN  G   I D P++P  L +L+ L+  GTISGKIAK +F+ +++ G  P++IVEE G
Sbjct: 355 RALNDDGNRCISDCPVTPALLADLLKLMEKGTISGKIAKTVFDEMYKTGKAPEKIVEEKG 414

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           L QV+D  AIE +VDEV+  NP  VA     K  L  +FVGQVM+ + GKANP++V ++L
Sbjct: 415 LVQVSDTGAIEAMVDEVLEKNPGQVAEYKGGKETLFGFFVGQVMRASKGKANPAVVNELL 474

Query: 493 KEKLG 497
            +KL 
Sbjct: 475 LKKLN 479


>gi|126735406|ref|ZP_01751152.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter sp.
           CCS2]
 gi|126715961|gb|EBA12826.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter sp.
           CCS2]
          Length = 503

 Score =  575 bits (1481), Expect = e-162,   Method: Composition-based stats.
 Identities = 301/509 (59%), Positives = 376/509 (73%), Gaps = 17/509 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L  + A +    +G T DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDLQ-YTAPAPKTIAGATSDWELVIGLEVHAQVATNAKLFSGASTLFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           A MPGMLP++N  CV QAV TGLGLNA IN +S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AGMPGMLPVINEGCVAQAVKTGLGLNAEINLFSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G  ++       V IERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV+
Sbjct: 120 EGEVLVEMGNGEA-----RNVRIERIHLEQDAGKSIHDMDPTMSFVDLNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GE 229
           +PD+R   EA A++ KLR ILRYLGTCDGNM+ G++RADVNVSVC+P             
Sbjct: 175 RPDIRGPEEAAAYVLKLRQILRYLGTCDGNMQNGNLRADVNVSVCKPGDYEKYWETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+ +AI++EARRQIA++EDG  + QETRL+DP KNETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQMAIDFEARRQIALIEDGREVVQETRLYDPDKNETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  IK  +PELPD K+ RFI +FG+S YDASVL ++   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIKASLPELPDQKKARFISDFGLSDYDASVLTAEVVN 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFEK+A  RD K+ ANWVIN+L G L +   SIED+P+S  QLGELI LI  G I+GK
Sbjct: 355 AAYFEKVAEGRDGKLAANWVINELFGRLKKEDHSIEDSPVSAAQLGELIGLIKAGDINGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F I +  G  P EIVE  G++QVTD  AIE  VDE+I +NP  V +    P L+ 
Sbjct: 415 IAKDVFEISYTTGRNPAEIVETEGMKQVTDTGAIETAVDEIIAANPAQVEKAQANPKLIG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
           WFVGQVMK TGGKANP+ V +++  KLG+
Sbjct: 475 WFVGQVMKATGGKANPAAVNQIVSAKLGL 503


>gi|115525357|ref|YP_782268.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodopseudomonas
           palustris BisA53]
 gi|122295584|sp|Q07L96|GATB_RHOP5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|115519304|gb|ABJ07288.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodopseudomonas palustris BisA53]
          Length = 494

 Score =  574 bits (1479), Expect = e-161,   Method: Composition-based stats.
 Identities = 310/494 (62%), Positives = 386/494 (78%), Gaps = 10/494 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           +   L  G TGDWEVVIG+EVHAQ++  +KLFSGAS  FG  PN  VS  DAAMPGMLP+
Sbjct: 6   KPSKLIKGATGDWEVVIGLEVHAQVASNAKLFSGASTEFGGAPNAHVSLVDAAMPGMLPV 65

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV QAV TGLGLNA IN  SVF RKNYFYPDLPQGYQISQ+  P+VGEG V V + 
Sbjct: 66  INEECVAQAVRTGLGLNAQINLRSVFDRKNYFYPDLPQGYQISQYKSPVVGEGVVEVDLP 125

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
             +      I VGIER+HLEQDAGK +HDQ+   + +DLNRSGVALMEIV+KPD+RSS +
Sbjct: 126 DGEG-----ISVGIERLHLEQDAGKLLHDQHPTSTFVDLNRSGVALMEIVSKPDIRSSEQ 180

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           AKA+++KLR+ILRYLGTCDG+ME+GS+RADVNVSV +PG   GTRCE+KNVNSIRF+G A
Sbjct: 181 AKAYVSKLRTILRYLGTCDGDMEKGSLRADVNVSVRKPGGPLGTRCEIKNVNSIRFIGQA 240

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           IEYEARRQI ILEDGG I QETRLFD  K ETRS+R+KE+A DYRYF +PDLLPLE  +D
Sbjct: 241 IEYEARRQIGILEDGGAIVQETRLFDAGKGETRSMRSKEEAHDYRYFPDPDLLPLEFSQD 300

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-----AVNRDKKI 364
           ++ A+K ++PELPDAK+ RF+ EFG+SL DA VLV+++  A+++E +        RD K+
Sbjct: 301 YVDALKAKLPELPDAKKARFMAEFGLSLEDAGVLVAERESAEFYEAVLAALGNQPRDGKL 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            ANWVIN+L G LN+ G+ I  +P+S  QL  +++LI +GTISGKIAKD+F I+W +GG 
Sbjct: 361 AANWVINELFGRLNKEGRDIAASPVSAAQLATIVELIGEGTISGKIAKDLFEIVWCEGGD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKAN 484
           P+E+VE  G++QVTDL AIEKVVD++I +NP+ VA+   KP L+ WFVGQVMK++GGKAN
Sbjct: 421 PRELVETRGMKQVTDLGAIEKVVDDIIQANPDKVAQAQAKPALMGWFVGQVMKSSGGKAN 480

Query: 485 PSIVQKMLKEKLGI 498
           P  V  +LK KLG+
Sbjct: 481 PQSVNDLLKSKLGL 494


>gi|154247851|ref|YP_001418809.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Xanthobacter
           autotrophicus Py2]
 gi|229487480|sp|A7IMA9|GATB_XANP2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|154161936|gb|ABS69152.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Xanthobacter
           autotrophicus Py2]
          Length = 496

 Score =  574 bits (1479), Expect = e-161,   Method: Composition-based stats.
 Identities = 308/501 (61%), Positives = 390/501 (77%), Gaps = 9/501 (1%)

Query: 2   VSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDA 61
           ++L      ++ L SG TGDWEVVIG+EVHAQ++  +KLFSGAS  FG  PN  VS  DA
Sbjct: 1   MTLHVRPTDTKKLISGATGDWEVVIGLEVHAQVASNAKLFSGASTAFGGPPNDHVSLVDA 60

Query: 62  AMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGE 121
           AMPGMLP++N  CV QAV TGLGL A I+  SVF RKNYFYPDLPQGYQISQ+ +P+VGE
Sbjct: 61  AMPGMLPVINQECVAQAVRTGLGLKAQIHLTSVFDRKNYFYPDLPQGYQISQYKQPVVGE 120

Query: 122 GKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTK 181
           G+V V +   +S     I VGIER+HLEQDAGKSIHD     S +DLNRSGVALMEIV++
Sbjct: 121 GEVIVDLPDGES-----IPVGIERLHLEQDAGKSIHDLSPTQSFVDLNRSGVALMEIVSR 175

Query: 182 PDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVN 241
           PD+RS+ EAKA++TKLR+ILRYLGTCDG+ME+G++RADVNVSV RPGE +GTRCE+KNVN
Sbjct: 176 PDLRSAEEAKAYVTKLRTILRYLGTCDGDMEKGNLRADVNVSVRRPGEPFGTRCEIKNVN 235

Query: 242 SIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDL 301
           SIRF+G AIE EARRQI ILEDGG I QETRLFDP++ ETRS+R+KE+A DYRYF +PDL
Sbjct: 236 SIRFIGQAIETEARRQIEILEDGGSISQETRLFDPTRGETRSMRSKEEAHDYRYFPDPDL 295

Query: 302 LPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-- 359
           LPL +  +++  +K  +PELPD K+ RFI ++G+S YDA VLV+++  A YFE++A    
Sbjct: 296 LPLVLKPEWVEELKSGLPELPDEKKARFIADYGLSPYDAGVLVAERETAAYFEQVADGGG 355

Query: 360 --RDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNI 417
             RD K  AN+VIN+L G LN+ GK +  +P++P+Q+G ++DLI +GTIS KIAKD+F I
Sbjct: 356 VKRDGKAAANFVINELFGRLNKEGKDVTSSPVTPHQIGAILDLIAEGTISSKIAKDLFEI 415

Query: 418 LWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMK 477
           ++ +GG P+ +VE  GL+QVTDL AIEKVVDE+I  NP+ VA++  KP ++ WFVGQ MK
Sbjct: 416 IFTEGGDPRVVVEARGLKQVTDLGAIEKVVDEIIAKNPDKVAQVLAKPTMLGWFVGQAMK 475

Query: 478 NTGGKANPSIVQKMLKEKLGI 498
            +GGKANP  +  +LK KLGI
Sbjct: 476 ASGGKANPQALNDILKAKLGI 496


>gi|119384663|ref|YP_915719.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Paracoccus
           denitrificans PD1222]
 gi|119374430|gb|ABL70023.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Paracoccus denitrificans PD1222]
          Length = 504

 Score =  573 bits (1478), Expect = e-161,   Method: Composition-based stats.
 Identities = 300/508 (59%), Positives = 370/508 (72%), Gaps = 16/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+   T+ A    +  G   DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDHLTYTAPEPKIIQGAKQDWELVIGLEVHAQVASNAKLFSGASTGFGAEPNSHVAFVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEFCVAQAVKTGLGLKAAINLVSAFDRKNYFYPDLPQGYQISQLYHPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V + P  +       V IERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV+
Sbjct: 121 EGEVIVDMAPGVA-----RRVRIERIHLEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVS 175

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GE 229
           +PD+R   EA A++ KLR I+RYLGTCDGNM+ G++RADVNVSVC P             
Sbjct: 176 RPDIRGPEEAAAYVAKLRQIMRYLGTCDGNMQNGNLRADVNVSVCAPGAYERYQETGDFS 235

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AI+YEARRQIAI+EDGG + QETRL+DP + ETRS+R+KE+
Sbjct: 236 HLGTRCEIKNMNSLRFIQQAIDYEARRQIAIIEDGGKVVQETRLYDPDRGETRSMRSKEE 295

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPD K+ RF+   G+S YDA VL ++   
Sbjct: 296 AHDYRYFPDPDLLPLEIEQGWVDDIAAAMPELPDEKKARFVTGLGLSEYDAGVLTAEVES 355

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           ADYFE++A  RD K  ANWVIN+L G LN+ G S+E +P+S  QLG +IDLI  G ISGK
Sbjct: 356 ADYFEQVASGRDGKQAANWVINELFGRLNKEGLSVETSPVSAAQLGGVIDLIGSGAISGK 415

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F ILW +GG P EIVE  G++QVTDL AIEK VDE+I +NP  V +    P L  
Sbjct: 416 IAKDLFEILWTEGGDPAEIVESRGMKQVTDLGAIEKAVDEIIAANPAQVEKARANPKLAG 475

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           WFVGQV+K TGGKANP+ V +++  KLG
Sbjct: 476 WFVGQVLKATGGKANPAAVNELVARKLG 503


>gi|253702340|ref|YP_003023529.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Geobacter sp.
           M21]
 gi|259647234|sp|C6E6Z3|GATB_GEOSM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|251777190|gb|ACT19771.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacter sp. M21]
          Length = 479

 Score =  573 bits (1478), Expect = e-161,   Method: Composition-based stats.
 Identities = 232/483 (48%), Positives = 316/483 (65%), Gaps = 12/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             ++VVIG+EVH QL+  +K+F G S  FGAEPN+Q       +PG LP+LN + V+ A+
Sbjct: 1   MKYQVVIGLEVHTQLTTNTKIFCGCSTRFGAEPNSQTCPVCLGLPGALPVLNRQVVEYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL  N  I + +VFARKNYFYPDLP+GYQISQ D PI   G + + +      +    
Sbjct: 61  RAGLATNCSITQRNVFARKNYFYPDLPKGYQISQFDLPICQHGHLDIDL------EGERK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSA--VSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
            +GI RIH+E+DAGK +H        SC+DLNR+   L+EIV++PDMRS  EA A+L KL
Sbjct: 115 RIGITRIHMEEDAGKLVHADIPGVDDSCVDLNRACTPLLEIVSEPDMRSPDEAIAYLKKL 174

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
             I+ YLG CDGN+EEGS R D NVS+       +GTR E+KN+NS +F+  AIEYE  R
Sbjct: 175 HQIVMYLGICDGNLEEGSFRCDANVSLMPVGSNVFGTRAELKNINSFKFIKQAIEYEIER 234

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q  IL+DGG + QETRLFDP+   TRS+R KE+A DYRYF +PDL+P+ I +D+I  ++ 
Sbjct: 235 QAEILDDGGKVIQETRLFDPNTGTTRSMRGKEEAHDYRYFPDPDLVPVIISDDWIERVRG 294

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLG 375
           ++PELP+AKR RF+ E  +  YDA VL + + +A YFE         K V+NWV+ ++  
Sbjct: 295 ELPELPEAKRARFMSELSLPEYDAEVLAASRELAQYFEDTFALFPQAKTVSNWVMGEVTR 354

Query: 376 VLNRSGKS-IEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
            LN      I + P++P  L +L+ L+  GTISGKIAK +F+ +++ G  P++IVEE GL
Sbjct: 355 ALNDDNNRSIAECPVTPALLADLLKLMEKGTISGKIAKTVFDEMYKTGKAPEKIVEEKGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            QV+D  AIE ++DEV+  N   VA     K  L  +FVGQVM+ + GKANP +V +ML 
Sbjct: 415 VQVSDTGAIEAMIDEVLEKNAGQVAEYRGGKETLFGFFVGQVMRASKGKANPGVVNEMLL 474

Query: 494 EKL 496
           +KL
Sbjct: 475 KKL 477


>gi|304391694|ref|ZP_07373636.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ahrensia sp. R2A130]
 gi|303295923|gb|EFL90281.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ahrensia sp. R2A130]
          Length = 500

 Score =  573 bits (1477), Expect = e-161,   Method: Composition-based stats.
 Identities = 316/496 (63%), Positives = 388/496 (78%), Gaps = 1/496 (0%)

Query: 2   VSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDA 61
             +DT          G    WE+VIG+EVHAQ++  +KLFSG+S  FGAE N+ VS  DA
Sbjct: 5   ALVDTRTPNEAHFFPGEDHPWELVIGLEVHAQVTSEAKLFSGSSTGFGAEQNSHVSLVDA 64

Query: 62  AMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGE 121
           AMPGMLP++N  CV+QAV TGLGLNA INK S F RKNYFYPDLPQGYQISQ   PIVGE
Sbjct: 65  AMPGMLPVINEHCVRQAVKTGLGLNAQINKKSAFDRKNYFYPDLPQGYQISQLYHPIVGE 124

Query: 122 GKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTK 181
           G V V +GPDK G F ++E+G+ER+HLEQDAGKS+HDQ+  +S +DLNRSGVALMEIV+K
Sbjct: 125 GVVQVQVGPDKKGDFESVEIGVERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVSK 184

Query: 182 PDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVN 241
           PD+RS  EAKA++TKLRSILRYLGTCDGNM++GSMRADVNVSV +PG  +GTRCE+KNVN
Sbjct: 185 PDIRSIDEAKAYVTKLRSILRYLGTCDGNMDQGSMRADVNVSVRKPGGEFGTRCEIKNVN 244

Query: 242 SIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDL 301
           SIRF+G AI+YEARRQI ILE+GG I QETRLFDP K ETRS+R+KE+A DYRYF +PDL
Sbjct: 245 SIRFMGQAIDYEARRQIDILEEGGKIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPDL 304

Query: 302 LPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRD 361
           LPLE D+ ++  I+ ++PELPD KR RF    G+S YDAS+LV+DK++ DY+E++A  RD
Sbjct: 305 LPLEFDDAYVETIRAELPELPDEKRARFQA-NGLSEYDASILVADKAVGDYYEQVAEGRD 363

Query: 362 KKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK 421
            K+ ANW INDLLG LN++G  + D+P+S  QLG +IDLI   TISGKIAKD+F I+W +
Sbjct: 364 AKLAANWTINDLLGALNKAGTDLADSPVSAAQLGGIIDLIKADTISGKIAKDVFEIIWNE 423

Query: 422 GGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGG 481
           GG P +IVE+ G+ QVTD  AIE  VDE+I +NP  VA+   KP ++ WFVGQVMK TGG
Sbjct: 424 GGDPAKIVEDRGMAQVTDTGAIEAAVDEIIAANPEKVAQAKEKPAMLGWFVGQVMKATGG 483

Query: 482 KANPSIVQKMLKEKLG 497
           KANP  V  +L+ K+G
Sbjct: 484 KANPKAVNDLLRAKIG 499


>gi|182678844|ref|YP_001832990.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|229486039|sp|B2IEA3|GATB_BEII9 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|182634727|gb|ACB95501.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 495

 Score =  573 bits (1476), Expect = e-161,   Method: Composition-based stats.
 Identities = 311/501 (62%), Positives = 377/501 (75%), Gaps = 12/501 (2%)

Query: 4   LDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAM 63
           ++THV +   L  G TGDWE++IG+EVHAQ++  SKLFSGAS  FGAEPN+ VS  DAAM
Sbjct: 1   MNTHV-KPSKLIKGATGDWEIIIGLEVHAQVTSRSKLFSGASTQFGAEPNSNVSLVDAAM 59

Query: 64  PGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGK 123
           PGMLP++N  CV QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG 
Sbjct: 60  PGMLPVINEECVAQAVRTGLGLKAQINLRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGI 119

Query: 124 VSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPD 183
           V V + P +      IEVGIER+HLEQDAGKS+HDQ +  S +DLNRSGVALMEIV+KPD
Sbjct: 120 VIVDVSPTEQ-----IEVGIERLHLEQDAGKSLHDQSATDSFVDLNRSGVALMEIVSKPD 174

Query: 184 MRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSI 243
           MRS+ EA+A+++KLR+ILRYLGTCDGNME+GS+RADVNVSV RPGE +GTRCE+KNVNSI
Sbjct: 175 MRSADEARAYVSKLRTILRYLGTCDGNMEQGSLRADVNVSVRRPGEPFGTRCEIKNVNSI 234

Query: 244 RFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLP 303
           RF+G AIE EARRQI ILEDGG I QETRLFDP K ETRS+R+KE+A DYRYF +PDLLP
Sbjct: 235 RFIGQAIETEARRQIGILEDGGVIDQETRLFDPGKGETRSMRSKEEAHDYRYFPDPDLLP 294

Query: 304 LEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR--- 360
           LE D+ ++  +   +PELPDAK+ RF+ ++G+  YDA VLV+DK  ADY+E         
Sbjct: 295 LEFDQAYVDGLASALPELPDAKKARFMNDYGLPAYDAGVLVADKETADYYETTVNYNGVK 354

Query: 361 -DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW 419
            D K+VANWV  D+    N  G  +  T ++P Q+  L+DLI +  ISGKIAKD+  IL 
Sbjct: 355 RDPKLVANWVTGDVAAYANSVGLPVSQTHLTPAQIATLVDLISEEVISGKIAKDVLAILI 414

Query: 420 EKG--GTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMK 477
            +   G P+ IVE  GL+QVTD  AIE  VD +I +NP+ VA+   KP ++ WFVGQVMK
Sbjct: 415 NEDKAGDPRTIVEARGLKQVTDTGAIEAAVDAIIAANPDKVAQAQAKPTMLGWFVGQVMK 474

Query: 478 NTGGKANPSIVQKMLKEKLGI 498
            TGGKANP  V ++LK KLGI
Sbjct: 475 QTGGKANPQAVNEILKAKLGI 495


>gi|332974318|gb|EGK11250.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Desmospora sp. 8437]
          Length = 477

 Score =  573 bits (1476), Expect = e-161,   Method: Composition-based stats.
 Identities = 219/479 (45%), Positives = 311/479 (64%), Gaps = 9/479 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+EVHA+LS  +K+F G S  FGA PNTQ        PG+LP+LN + V+ A+  
Sbjct: 4   FETVIGLEVHAELSTQTKIFCGCSTEFGAPPNTQTCPICLGHPGVLPVLNRQAVEFAMKA 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
            L LN +I   S F RKNYFYPDLP+ YQISQ+D+PI  +G + + +  +K        +
Sbjct: 64  ALALNCNIADMSKFDRKNYFYPDLPKAYQISQYDQPIGTDGWLEIEVDGEK------KRI 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R+HLE+DAGK IH      + +D NR GV L+EIV++PDMRS  E +A+L KL+ I+
Sbjct: 118 GITRVHLEEDAGKLIHSDQGDGTLVDYNRVGVPLIEIVSEPDMRSPEEGRAYLEKLKQII 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           +Y G  D  MEEGS+R D N+S+       +GT+ E+KN+NS R +  A++YE  RQ  +
Sbjct: 178 QYTGVSDVKMEEGSLRCDANISLRPVGSTTFGTKTEMKNLNSFRNVERALKYEEERQAQV 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           L +GG I Q+T  +   +  T+ +R+KE+A DYRYF EPDL+ L+ DE +I  +K  +PE
Sbjct: 238 LSEGGTIVQQTMRWLEDQGRTKVMRSKEEAHDYRYFPEPDLVRLQPDEAWIERVKDSLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVLNR 379
           LPDA+RER++  F +S YDA +L S   IAD+F+++ A   D K  ANWV ++LLG LN 
Sbjct: 298 LPDARRERYMSTFSLSAYDAGLLTSSPKIADFFDQVAAAGADPKSAANWVTSELLGYLNN 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            GK +E+T I+ + L  +I LI  GTIS K+AK +F  L E+GG P +IVEE G  Q++D
Sbjct: 358 QGKELEETRITADSLARMIQLIDRGTISSKLAKKVFKELVEQGGDPAKIVEEKGWVQISD 417

Query: 440 LSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
              ++ +V +V+ +NP +V      K   + + VGQVMK T GKANP +V +++ E +G
Sbjct: 418 EGKLKGIVSDVLQANPQSVVDYKNGKDRALGFLVGQVMKATKGKANPKMVNQLILENIG 476


>gi|114778058|ref|ZP_01452958.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mariprofundus
           ferrooxydans PV-1]
 gi|114551664|gb|EAU54217.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mariprofundus
           ferrooxydans PV-1]
          Length = 477

 Score =  572 bits (1475), Expect = e-161,   Method: Composition-based stats.
 Identities = 233/480 (48%), Positives = 316/480 (65%), Gaps = 8/480 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+EVH Q++  +K F G S  FG+EPNTQ       MPG LP+LNG   ++ +
Sbjct: 1   MSWEVVIGLEVHVQINTATKAFCGCSTEFGSEPNTQTCPVCLGMPGQLPVLNGEAAEKTI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           +TGL +NA IN  S F RKNYFYPDLP+GYQISQ   P+V  G + + +           
Sbjct: 61  LTGLAINADINLESKFDRKNYFYPDLPKGYQISQFAVPLVENGYLDIPVKDGG-----EK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI RIH+E+DAGKS+H+    VS IDLNRSGV LMEIV++PDMRS+ EA A+L +L  
Sbjct: 116 RIGITRIHMEEDAGKSMHEGLDGVSHIDLNRSGVPLMEIVSEPDMRSADEAIAYLKQLHQ 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           ++ +L     NME G  R D NVSV +PG  +GTR E+KN+NS RF+  AIEYE  RQI 
Sbjct: 176 LIVFLDVSGANMEMGQFRCDANVSVHQPGTPFGTRAELKNLNSFRFIKQAIEYEVNRQIE 235

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++EDGG + QETRLFD +K E+R +R+KE+A DYRYF EPDL PL + +  + AI+  +P
Sbjct: 236 LIEDGGEVVQETRLFDSAKGESRPMRSKEEAHDYRYFPEPDLPPLRVTQQQVDAIRDGMP 295

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRD--KKIVANWVINDLLGVL 377
           ELP   R RF  E+G+S YDA VL   +++AD++E L        K  ANW+ N+LLG L
Sbjct: 296 ELPGQLRHRFETEYGLSSYDADVLTQTRALADWYESLVAAHPADPKRCANWLANELLGRL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
              GK IE +P+S  +L  ++D I D TISGKIAKD+ + + E       I+E  GL+QV
Sbjct: 356 KELGKEIEHSPVSAQRLAGMLDRIADNTISGKIAKDVLDAMLESDDDADAIIEAKGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D  AI+ +++ V+ +NP+ +A     K  L+ +FVGQVMK + G+ANP++V + L+  L
Sbjct: 416 SDSGAIDAIIEAVMAANPDQLAGYRAGKDKLMGFFVGQVMKASKGQANPAMVNQRLQVLL 475


>gi|303248217|ref|ZP_07334480.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfovibrio
           fructosovorans JJ]
 gi|302490355|gb|EFL50266.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfovibrio
           fructosovorans JJ]
          Length = 476

 Score =  572 bits (1475), Expect = e-161,   Method: Composition-based stats.
 Identities = 241/479 (50%), Positives = 317/479 (66%), Gaps = 9/479 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+EVHAQL   SK+F G S  FG +PN  V    + MPG+LP+LN + V+ A   
Sbjct: 4   YETVIGVEVHAQLKTESKIFCGCSTRFGDDPNENVCPVCSGMPGVLPVLNAKVVEFAAKM 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL  +  +N  SVFARKNYFYPDLP+GYQISQ ++PI   G + V +        +T  +
Sbjct: 64  GLATDCTVNPVSVFARKNYFYPDLPKGYQISQFEQPICEHGHIDVVVDG------KTRRI 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI RIH+E+DAGK+IH     +S +DLNRS V L+EIV++PDMRS  E  A+L  LR+IL
Sbjct: 118 GITRIHMEEDAGKNIHSAADNLSYVDLNRSCVPLLEIVSEPDMRSPEEVVAYLKALRAIL 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            YL  CDGNMEEGS R D NVS+   G+  +GTR E+KN+NS R +  AIEYE  RQ  I
Sbjct: 178 VYLDICDGNMEEGSFRCDANVSLRPVGQEAFGTRAELKNLNSFRHVQKAIEYEVERQGDI 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           L+DGG + QETRL+D +KN T S+R KE+A DYRYF +PDL+PL +D D I     ++PE
Sbjct: 238 LDDGGVVVQETRLYDAAKNSTASMRGKEEANDYRYFPDPDLVPLHLDRDTIARWGTELPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANWVINDLLGVLNR 379
           LP A+RERF   FG+S YDA VL +++ +ADYFE  +    D K  ANWV  +LL   ++
Sbjct: 298 LPAARRERFATAFGLSDYDADVLTAERDMADYFEAAVMAGADPKKAANWVQTELLRECHQ 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           SG +     +SP +L  L+ LI +G ISGKIAK IF  L+  G  P + V + GL Q++D
Sbjct: 358 SGATPGTCKLSPERLAGLLRLIDEGVISGKIAKQIFPELFASGDDPADYVRDKGLVQISD 417

Query: 440 LSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
            SA+E  VD V+ +NP  V      K  L+ +FVGQVMK T G+ANP +V ++L++KLG
Sbjct: 418 TSALETAVDTVLAANPAEVDAYRGGKTKLMGFFVGQVMKATKGQANPGLVNELLRKKLG 476


>gi|320352528|ref|YP_004193867.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Desulfobulbus propionicus DSM 2032]
 gi|320121030|gb|ADW16576.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Desulfobulbus propionicus DSM 2032]
          Length = 475

 Score =  572 bits (1473), Expect = e-161,   Method: Composition-based stats.
 Identities = 215/482 (44%), Positives = 321/482 (66%), Gaps = 10/482 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+E+HAQ+   SK+F G S  FGA PNT        MPG LP+LN + V+ A+
Sbjct: 1   MEFETVIGLEIHAQMKTKSKIFCGCSTEFGAPPNTHTCPVCLGMPGSLPVLNRKVVESAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL   + IN+ + FARKNYFYPDLP+GYQISQ + PI   G++ + +           
Sbjct: 61  KLGLATESTINRENRFARKNYFYPDLPKGYQISQFELPICEHGRIEIEVDGQ-----TPK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI RIH+E+DAGK +HD+   VS +DLNR+G  L+EIV++PD+RS  EA A+L KL +
Sbjct: 116 TIGITRIHMEEDAGKLVHDEREPVSYVDLNRTGTPLLEIVSEPDLRSPEEAAAYLKKLHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RYL  CDGNM+EGS R D N+S+     + +GTR E+KN+NS R + LA+EYE RRQ 
Sbjct: 176 IVRYLDICDGNMQEGSFRCDANISLRPRGQQEFGTRTELKNMNSFRNVQLALEYEIRRQR 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +L +GG + Q+T L+DP K  T  +R KE+A DYRYF +PDL+P+ +DE +I  ++ ++
Sbjct: 236 DVLLEGGEVIQQTLLWDPDKGRTEPMRGKEEAHDYRYFPDPDLIPVVVDEAWIEQVRAEL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVL 377
           PELPD +R+RF+ + G++ YDA++L + + +ADYFE+  +N  + K +AN++  +L  + 
Sbjct: 296 PELPDRRRQRFVSDIGLTDYDAALLTASRELADYFEEALLNFANAKKLANFIGTEL--LR 353

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           +   + I + P+ P QL +L+ LI +GTISGKIAK +F  +   G  P+ IV+  GL Q+
Sbjct: 354 DYGPERIGECPVRPAQLAKLLRLIEEGTISGKIAKTVFTEMLTSGDDPEAIVKAKGLVQM 413

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D  A+  +V E+IN+NP+ V +    K  ++ +FVGQ+M+ T G+ANP +  K+  ++L
Sbjct: 414 SDEGALVALVREIINANPDQVQQFRDGKTKVMGFFVGQLMQKTKGQANPQLANKLFAQEL 473

Query: 497 GI 498
             
Sbjct: 474 NA 475


>gi|302392789|ref|YP_003828609.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acetohalobium arabaticum DSM 5501]
 gi|302204866|gb|ADL13544.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acetohalobium arabaticum DSM 5501]
          Length = 482

 Score =  572 bits (1473), Expect = e-161,   Method: Composition-based stats.
 Identities = 223/484 (46%), Positives = 313/484 (64%), Gaps = 11/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            D+++ IG+EVHAQL   +K+F   S  FGAEPN         +PG+LP+LN R V+ AV
Sbjct: 3   ADYDITIGLEVHAQLDTETKIFCSCSTEFGAEPNVHTCPVCLGLPGVLPVLNKRAVEYAV 62

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  I  +S F RKNYFYPDLP+ YQISQ+D P+  +G + V        +   +
Sbjct: 63  KAGLALNCEIADFSKFDRKNYFYPDLPKAYQISQYDLPLCEDGYIDVE-----PEEGDAV 117

Query: 140 EVGIERIHLEQDAGKSIHDQ---YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            VGI RIH+E+DAGK +HD     S  S +D NR G  L+EIVT+PD+ S  +A A+L K
Sbjct: 118 RVGINRIHMEEDAGKLVHDGTITDSEGSLVDYNRVGTPLIEIVTEPDIESPAQAVAYLKK 177

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L+SIL YL   D NM EGS+R D N S+        G + E+KN+NS + +  A+ YE +
Sbjct: 178 LKSILEYLEVSDCNMAEGSLRCDANASIKPKGEAELGVKTELKNMNSFKAIEQALTYEIK 237

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQ  IL+ G  + QETR +DP   +T S+R KE+A DYRYF EPDL+PLEI+++++  I+
Sbjct: 238 RQKKILDSGKEVIQETRTWDPEAEKTYSMRGKEEAHDYRYFPEPDLVPLEIEQEWLEEIR 297

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLL 374
           + IPELP+ +R+RFI E G+  YDA VL   KSIAD+FE     + D K V+NW++ D++
Sbjct: 298 ETIPELPNVRRKRFIEELGLPEYDAQVLTDSKSIADFFEATVAEHNDPKSVSNWMMGDMM 357

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
            +LN  G  I++  I+P  L E+++L+ DGTIS KIAK +F  +++ G  P++IVE+ GL
Sbjct: 358 RLLNEEGLEIDEAEITPAGLAEMLELLDDGTISNKIAKTVFEEMFKTGKDPEDIVEDKGL 417

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           +Q++D   +  V+DEVI  NP+ V      K   + + VGQVM+ T GKANP + ++ML+
Sbjct: 418 KQISDEGELGNVIDEVIEDNPDAVEDYQGGKEQAIGYLVGQVMQATRGKANPQLAKEMLR 477

Query: 494 EKLG 497
           EKL 
Sbjct: 478 EKLN 481


>gi|169831196|ref|YP_001717178.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Candidatus
           Desulforudis audaxviator MP104C]
 gi|169638040|gb|ACA59546.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Candidatus
           Desulforudis audaxviator MP104C]
          Length = 481

 Score =  572 bits (1473), Expect = e-161,   Method: Composition-based stats.
 Identities = 220/485 (45%), Positives = 306/485 (63%), Gaps = 12/485 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             +E VIG+EVH +L   SK+F  +S  FG+  N+QV      +PG LP+LN + V+  +
Sbjct: 2   NKYEAVIGLEVHVELQTDSKIFCPSSTEFGSRHNSQVCPVCLGLPGTLPVLNRKVVEYGI 61

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              L LN  I ++S F RKNYFYPDLP+ YQISQ+D P+  EG +             T 
Sbjct: 62  RVALALNCSIARFSKFDRKNYFYPDLPKNYQISQYDLPLAYEGHLDYETDD-----GTTH 116

Query: 140 EVGIERIHLEQDAGKSIHDQY----SAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
             GI RIH+E+DAGK IH +        S +D NR+GV L+EIV+ PD+RS+ EA+A+L 
Sbjct: 117 RCGIARIHMEEDAGKLIHREGSENEPPYSLVDYNRTGVPLLEIVSAPDIRSAEEARAYLN 176

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEA 254
           +L+++++Y G  D  MEEGS+R D NVSV   GE   GT+ E+KN+NS R +  A+ YE 
Sbjct: 177 ELKTVIQYTGVSDCKMEEGSLRCDANVSVRPRGEETLGTKTEIKNLNSFRAVQRALAYEI 236

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
            RQI  LE G  I QETR +D  K  T  +R+KE+A DYRYF EPDL+PL I   ++  +
Sbjct: 237 ERQIGRLETGQQIVQETRSWDEEKGVTVPMRSKEEAHDYRYFPEPDLVPLVISPSWVDDV 296

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDL 373
           ++++PELP AKR+R++ E+ +  YD  VL    S+A YFE+   +  + K VANWV+ DL
Sbjct: 297 RRKLPELPQAKRDRYLKEYQLPAYDTRVLTGSPSLAGYFEECVRLYPEPKAVANWVMGDL 356

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
             +LN +  +IED  + P  L  L+ LI DGTISGKIAK +   ++  G  P+ I+ E G
Sbjct: 357 SRLLNAAPVAIEDCRVRPAGLCALLRLIDDGTISGKIAKAVLEEMFITGKDPRTIIAEKG 416

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           L Q+TD  A+E VVDEVI  +P+ V      K   + + VGQVMK+TGG+ANP++V  +L
Sbjct: 417 LVQITDTDALETVVDEVIAGHPDTVRDYRNGKTRALGFLVGQVMKSTGGRANPNLVNDLL 476

Query: 493 KEKLG 497
           K++L 
Sbjct: 477 KKRLD 481


>gi|116749140|ref|YP_845827.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Syntrophobacter
           fumaroxidans MPOB]
 gi|116698204|gb|ABK17392.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Syntrophobacter fumaroxidans MPOB]
          Length = 476

 Score =  571 bits (1472), Expect = e-161,   Method: Composition-based stats.
 Identities = 226/480 (47%), Positives = 316/480 (65%), Gaps = 9/480 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++EVVIG+E+HAQLS  SK+F G S  FGA PNT        MPG+LP+LN   V+ ++
Sbjct: 1   MEYEVVIGLEIHAQLSTRSKIFCGCSTTFGASPNTLTCPVCLGMPGVLPVLNRDVVEFSL 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              L  +  I  Y  FARKNYFYPDLP+GYQISQ++ P+   G + +  G          
Sbjct: 61  RMALAAHCEIAPYGQFARKNYFYPDLPKGYQISQYELPLARNGWIEIESGNG------PK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + I RIH+E+DAGK IHD    VS +D NR+GV L+EIV++PD+RSS +A ++L  +R 
Sbjct: 115 RIRIHRIHMEEDAGKLIHDDNKPVSYVDFNRTGVPLIEIVSEPDLRSSEDAVSYLKSVRE 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ILR+L  CDGNMEEGS+R D N+S+     E  G + E+KN+NS R +  A+++E RRQ 
Sbjct: 175 ILRFLEICDGNMEEGSLRCDANISLRPVGAEELGVKTELKNMNSFRNVQRALDFEIRRQR 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
           A+LE G  I QETRL+D +++ T S+R KE+A DYRYF +PDL+P+ +DE +I  ++  +
Sbjct: 235 ALLERGEPIVQETRLWDANRSITLSMRGKEEAHDYRYFPDPDLVPVVVDEAWIEQVRASL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVL 377
           PELPDA+RERF+GE+G+  +DA VL S K+++ YFE +       KIV+NW++++LL  L
Sbjct: 295 PELPDARRERFMGEYGLPSHDARVLTSSKALSVYFESVVAAFPQPKIVSNWMMSELLREL 354

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
            R  + IE+ P+ P  L +L+ LI  G +SGKIAK +F  ++  G     +VEE GL QV
Sbjct: 355 KRDEREIEECPVPPENLADLLQLIEKGVVSGKIAKTVFLEMYSTGRKAGAVVEEKGLVQV 414

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
            D  AIE +V EV+  NP+ V +    K  L  +FVGQVM+ + GKANP +V  +L+ KL
Sbjct: 415 KDEGAIEAIVAEVLAENPSEVEQYRAGKEKLFGFFVGQVMRKSKGKANPKLVNDILRGKL 474


>gi|209963378|ref|YP_002296293.1| aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit B, GatB
           putative [Rhodospirillum centenum SW]
 gi|229486447|sp|B6IPU4|GATB_RHOCS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|209956844|gb|ACI97480.1| aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit B, GatB
           putative [Rhodospirillum centenum SW]
          Length = 484

 Score =  571 bits (1472), Expect = e-161,   Method: Composition-based stats.
 Identities = 287/485 (59%), Positives = 372/485 (76%), Gaps = 6/485 (1%)

Query: 13  SLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNG 72
            L  G TG+WE+VIG+EVHAQ+   +KLFSGA+  FGA PN+QVSF DAA PGMLP++N 
Sbjct: 3   YLIQGETGEWEIVIGLEVHAQVISNAKLFSGAATAFGAAPNSQVSFVDAAFPGMLPVINE 62

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
            CV+QAV TGLGL A IN  SVF RKNYFY DLP GYQISQ  +P+VG G + + +    
Sbjct: 63  VCVEQAVKTGLGLKAQINLRSVFDRKNYFYADLPAGYQISQFQQPVVGNGTIVLDLAD-- 120

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKA 192
                T EVGIER+HLE DAGKS+HDQ+ + + +DLNR+GVALMEIV+KPDMRS  EA A
Sbjct: 121 ---GSTREVGIERLHLEIDAGKSLHDQHPSKTYVDLNRAGVALMEIVSKPDMRSPEEAAA 177

Query: 193 FLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEY 252
           +L KLR+ILRYLGTCDGNMEEGSMR DVNVSV + G+ +GTR E KNVNSIR++  AIEY
Sbjct: 178 YLRKLRTILRYLGTCDGNMEEGSMRCDVNVSVRKVGQPYGTRTETKNVNSIRYVQQAIEY 237

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           EA+RQ+ ++E GG + QETRL+DP+K ETRS+R+KE+A DYRYF +PDLLPLEI++ ++ 
Sbjct: 238 EAQRQVELIEGGGTVVQETRLWDPNKGETRSMRSKEEAHDYRYFPDPDLLPLEIEQSWVD 297

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIND 372
            IK+ +PELPD K+ RF+ ++G+S YDA +LV++++ AD++E +A  RD K+ AN+VI D
Sbjct: 298 RIKETLPELPDDKKARFMADYGLSAYDAGILVAERARADFYETVAKGRDPKLAANYVIGD 357

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEEL 432
           LLG LN++G+ I ++PI+ + LG LIDL+ DGTISG+IAKD+F  + E G  P  IVE+ 
Sbjct: 358 LLGALNKTGRDITESPIAADDLGGLIDLVTDGTISGRIAKDVFAEMLETGEKPSLIVEKK 417

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GLRQVTD  AI+K +DEV+ +N + VA     K  L  +FVGQVM+ T GKANP++V ++
Sbjct: 418 GLRQVTDTGAIDKAIDEVMAANADKVAEFRSGKEKLFGFFVGQVMRATQGKANPALVNEI 477

Query: 492 LKEKL 496
           L  KL
Sbjct: 478 LATKL 482


>gi|197120006|ref|YP_002140433.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Geobacter
           bemidjiensis Bem]
 gi|229486068|sp|B5ED20|GATB_GEOBB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|197089366|gb|ACH40637.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Geobacter bemidjiensis Bem]
          Length = 488

 Score =  570 bits (1470), Expect = e-160,   Method: Composition-based stats.
 Identities = 237/493 (48%), Positives = 320/493 (64%), Gaps = 21/493 (4%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             ++VVIG+EVH QL+  +K+F G S  FGAEPN+Q       +PG LP+LN + V+ A+
Sbjct: 1   MKYQVVIGLEVHTQLTTNTKIFCGCSTRFGAEPNSQTCPVCLGLPGALPVLNQQVVEYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL  N  I K +VFARKNYFYPDLP+GYQISQ D PI   G + + +  +K       
Sbjct: 61  RAGLATNCSITKRNVFARKNYFYPDLPKGYQISQFDLPICQHGHLDIEVEGEK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSA--VSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
            +GI RIH+E+DAGK +H        SC+DLNR+   L+EIV++PDMRS  EA A+L KL
Sbjct: 115 RIGITRIHMEEDAGKLVHADIPGVDDSCVDLNRACTPLLEIVSEPDMRSPDEAIAYLKKL 174

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
             I+ YLG CDGN+EEGS R D NVS+       +GTR E+KN+NS +F+  AIEYE  R
Sbjct: 175 HQIVMYLGICDGNLEEGSFRCDANVSLMPVGSNVFGTRAELKNINSFKFIKQAIEYEIER 234

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q  IL+DGG + QETRLFDP+   TRS+R KE+A DYRYF +PDL+P+ I +D+I  ++ 
Sbjct: 235 QAEILDDGGKVVQETRLFDPNTGTTRSMRGKEEAHDYRYFPDPDLVPVIISDDWIEKVRG 294

Query: 317 QIPELPDAKRERFIGE---------FGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVA 366
            +PELP+AKR RF+ E         FG+  YDA VLV+ + +A YFE         K V+
Sbjct: 295 GLPELPEAKRARFMSEGGAVFGGSAFGLPEYDAEVLVASRELAQYFEDTVALFPQAKTVS 354

Query: 367 NWVINDLLGVLNRSGKS-IEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           NWV+ ++   LN      I + P++P  L +L+ L+  GTISGKIAK +F+ +++ G   
Sbjct: 355 NWVMGEVTRALNDDNNRSIAECPVTPALLADLLKLMEKGTISGKIAKTVFDEMYKTGKAS 414

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKAN 484
           ++IVEE GL QV+D  AIE +VDEV+  NP  VA     K  L  +FVGQVM+ + GKAN
Sbjct: 415 EKIVEEKGLVQVSDTGAIEAMVDEVLEKNPGQVAEYRGGKETLFGFFVGQVMRASKGKAN 474

Query: 485 PSIVQKMLKEKLG 497
           P++V ++L +KL 
Sbjct: 475 PAVVNELLLKKLN 487


>gi|20807103|ref|NP_622274.1| aspartyl/glutamyl-tRNA amidotransferase subunit B
           [Thermoanaerobacter tengcongensis MB4]
 gi|24418403|sp|Q8RC39|GATB_THETN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|20515595|gb|AAM23878.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit (PET112 homolog)
           [Thermoanaerobacter tengcongensis MB4]
          Length = 475

 Score =  570 bits (1470), Expect = e-160,   Method: Composition-based stats.
 Identities = 225/480 (46%), Positives = 316/480 (65%), Gaps = 10/480 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             +E VIG+EVHA+L   SK+F G S  FG+EPNTQV      +PG LP+LN + V+ AV
Sbjct: 1   MKYEAVIGLEVHAELLTDSKIFCGCSTKFGSEPNTQVCPVCLGLPGTLPVLNKKVVEYAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  I  +S   RKNYFYPDLP+ YQISQ+D P+   G + + +      +  T 
Sbjct: 61  RAGLALNCTIANFSKMDRKNYFYPDLPKAYQISQYDLPLCSNGYIEIEV------EGGTK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI+RIH+E+DAGK +H+     S +D NR+GV L+EIV++PD+ +  EA  +L KL+S
Sbjct: 115 RIGIKRIHIEEDAGKLLHEGTDG-SLVDYNRAGVPLIEIVSEPDISTPEEAYQYLVKLKS 173

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL Y    D  M+EGS+R D NVSV        GT+ E+KN+NS + +  A+EYE +RQI
Sbjct: 174 ILEYTEVSDCKMQEGSLRVDTNVSVRPVGTTELGTKIELKNLNSFKAVQKALEYEIKRQI 233

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE+GG I QETR ++ +K  T  +RTKE+A DYRYF EPDL+P+ + E++   I+K +
Sbjct: 234 KVLEEGGTIVQETRRWNEAKGITEPMRTKEEAHDYRYFPEPDLVPIIVTEEWKEEIRKTL 293

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRD-KKIVANWVINDLLGVL 377
           PE+PDAKRERFI ++G+  YDA V+ S K +AD+FEK A N    KIV+NW++ +   +L
Sbjct: 294 PEMPDAKRERFITQYGLPEYDAKVITSSKKMADFFEKCASNYHSPKIVSNWLMGEFARLL 353

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N +GK I++ PI+P+ L EL+ L+ D  ISG IAK +F  ++  G  P+ IVEE GLRQ+
Sbjct: 354 NDTGKEIDEVPITPDMLIELLKLVDDNVISGSIAKTVFEEMFFTGKNPQIIVEEKGLRQI 413

Query: 438 TDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
            D   + ++V +VI  NP +V      K   + + VGQVMK T GKANP +  ++L+E+L
Sbjct: 414 ADEGELRRIVRKVIEENPKSVEDYKKGKEKALGFLVGQVMKETKGKANPQLTNQLLREEL 473


>gi|88810577|ref|ZP_01125834.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrococcus
           mobilis Nb-231]
 gi|88792207|gb|EAR23317.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrococcus
           mobilis Nb-231]
          Length = 477

 Score =  570 bits (1470), Expect = e-160,   Method: Composition-based stats.
 Identities = 252/481 (52%), Positives = 343/481 (71%), Gaps = 8/481 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +WE VIG+EVH QL+  +K+FSGA+  +GA PNTQ    D  MPG+LP+LN + V+ AV
Sbjct: 1   MNWEAVIGLEVHIQLATKTKIFSGAATAYGAAPNTQACAIDLGMPGVLPVLNEQAVRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL L A I   SVFARKNYFYPDLP+GYQISQ++ P+V +G++++ +  D S      
Sbjct: 61  KLGLALGATIAPRSVFARKNYFYPDLPKGYQISQYELPVVADGELTIELDADVS-----K 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +  V+ IDLNR+G  L+E+V+ PDMRS+ EA A++ KL S
Sbjct: 116 RIGIIRAHLEEDAGKSLHEGFEQVTAIDLNRAGTPLIEVVSAPDMRSAKEAVAYMKKLHS 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYL   DGNM+EGS R D N+SV     +  GTR EVKNVNS RF+  AI YE +RQI
Sbjct: 176 LVRYLEISDGNMQEGSFRCDANISVRPLGEQRLGTRTEVKNVNSFRFVERAINYEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LEDGG + QETRLFD S+NETR +RTKE+A DYRYF +PDLLPLEI+   I  ++K +
Sbjct: 236 ELLEDGGKVVQETRLFDTSRNETRPMRTKEEANDYRYFPDPDLLPLEIEPALIEEVRKTL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELPDAKRERF+ ++G+  YD++VL + +++ADYFE +A    D K+  NWV+ +L G L
Sbjct: 296 PELPDAKRERFMRDYGLDAYDSTVLTASRALADYFEAVAAQCADAKLAGNWVMGELAGAL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N++G  I +TP+S   LG L+  I D T+SGKIAK++F  +W   G    ++E  GL+Q+
Sbjct: 356 NKAGLDITETPVSSEMLGVLLQRIKDNTLSGKIAKEVFEAMWNGEGGADAVIERRGLKQL 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           TD SA+E +++EVI +NPN   +    K  L+ +FVGQVMK T G+ANP +V ++L+EKL
Sbjct: 416 TDRSALEAIIEEVIAANPNQTQQYRAGKEKLLGFFVGQVMKATKGQANPQLVNELLQEKL 475

Query: 497 G 497
           G
Sbjct: 476 G 476


>gi|283850824|ref|ZP_06368110.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfovibrio sp.
           FW1012B]
 gi|283573747|gb|EFC21721.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfovibrio sp.
           FW1012B]
          Length = 476

 Score =  570 bits (1469), Expect = e-160,   Method: Composition-based stats.
 Identities = 236/479 (49%), Positives = 314/479 (65%), Gaps = 9/479 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIGIEVHAQL   SK+F G S  FG EPN  V    A MPG+LP+LN   V+ A   
Sbjct: 4   YETVIGIEVHAQLKTASKIFCGCSTRFGNEPNENVCPVCAGMPGVLPVLNATAVEYAAKM 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL     +N  SVFARKNYFYPDLP+GYQISQ+++PI   G + +++G           +
Sbjct: 64  GLATGCVVNPVSVFARKNYFYPDLPKGYQISQYEQPICEHGHIDITVGGA------AKRI 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI RIH+E+DAGK+IH     VS +DLNR+ V L+EIV++PDMR++ E  A+L  LR+IL
Sbjct: 118 GITRIHMEEDAGKNIHSVAEGVSYVDLNRACVPLIEIVSEPDMRNAEEVVAYLKALRAIL 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            YL  CDGNMEEGS R D NVS+   G   +GTR E+KN+NS R +  AIEYE  RQ  +
Sbjct: 178 VYLDICDGNMEEGSFRCDANVSLRPVGREAFGTRTELKNLNSFRHVQKAIEYEVNRQADV 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           L+DGG + QETRL+D  KN T S+R KE+A DYRYF +PDL+PL +D   +   + ++PE
Sbjct: 238 LDDGGAVIQETRLYDAGKNVTVSMRGKEEANDYRYFPDPDLVPLSLDPVLLARWQDELPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVLNR 379
           LP A+R+RF+   G+S YDA VL +++ +ADYFE   A   D K  ANWV  +LL  LN+
Sbjct: 298 LPVARRDRFVTALGLSEYDAEVLTAERDMADYFEATLAAGADPKKAANWVQTELLRELNQ 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           +G +  D  ++P++L  L+ L+ +G ISGKIAK IF  L   G  P   V + GL Q++D
Sbjct: 358 AGIAARDCKLTPDKLAGLMRLVDEGAISGKIAKQIFPDLCATGLDPAAYVRDKGLVQISD 417

Query: 440 LSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
             A+E  VD VI +NP         K  L+ +FVGQ+MK T G+ANP +V ++L++KLG
Sbjct: 418 SGALESAVDAVIAANPAEAEAYRGGKTKLMGFFVGQIMKATKGQANPGLVNELLRKKLG 476


>gi|225850110|ref|YP_002730344.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Persephonella
           marina EX-H1]
 gi|254790961|sp|C0QUH9|GATB_PERMH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|225645542|gb|ACO03728.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Persephonella marina EX-H1]
          Length = 474

 Score =  570 bits (1468), Expect = e-160,   Method: Composition-based stats.
 Identities = 232/481 (48%), Positives = 328/481 (68%), Gaps = 12/481 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVH Q+S  +K F    + FGAEPNT V      MPG LP+LN + ++ A+
Sbjct: 1   MEFEPVIGLEVHVQMSTNTKCFCSCKIEFGAEPNTNVCPVCLGMPGSLPVLNKKALEYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              L LN  +++ SVFARKNYFYPDLP+GYQISQ+DKP+   G + + +        +T 
Sbjct: 61  KASLALNCEVHELSVFARKNYFYPDLPKGYQISQYDKPLATNGYIDIKVND------KTE 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + I R+H+E+DAGK+IH    + S +DLNR+G  LMEIV++PD+RS++ A+ +L KLR+
Sbjct: 115 RIRIHRLHMEEDAGKTIHKG--SYSYVDLNRAGTPLMEIVSEPDIRSAVGARLYLEKLRN 172

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RY+G  D +ME+G +R DVN+S+     E +GT+ E+KN+NS RF+  AIEYE  RQ 
Sbjct: 173 IMRYIGVSDADMEKGQLRCDVNISLRPKGEEKFGTKVEIKNINSFRFVQKAIEYEIERQA 232

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            IL  GG I QETRLFD    +T ++RTKE+A DYRYF +PDL+P+ I +++I  I+K +
Sbjct: 233 RILRKGGEIVQETRLFDEKTGKTFTMRTKEEAHDYRYFPDPDLIPVRITKEYIEEIRKSL 292

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK--LAVNRDKKIVANWVINDLLGV 376
           PELPD K ER++ E  ++ YDA VLV+DK  A +FEK     + + K +ANW+IN+LLG 
Sbjct: 293 PELPDQKAERYVKELKLTEYDAEVLVADKDRALFFEKAVSVYSENPKSIANWIINELLGK 352

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN  G  I ++P+ P  + EL+ LI  G IS KI K++F  +++ G +PK IVEE GL+Q
Sbjct: 353 LNEEGIEISNSPVRPEHIAELVQLIDKGDISSKIGKEVFEEVFKTGKSPKTIVEEKGLKQ 412

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D   I K+V+EV+N++P  V +       L+ +FVGQVMK T GKANP +V K+L+E 
Sbjct: 413 VSDEGEIRKIVEEVLNNHPAEVEKYKAGNQKLMGFFVGQVMKATRGKANPKLVNKILQEL 472

Query: 496 L 496
           L
Sbjct: 473 L 473


>gi|84516936|ref|ZP_01004294.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Loktanella
           vestfoldensis SKA53]
 gi|84509404|gb|EAQ05863.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Loktanella
           vestfoldensis SKA53]
          Length = 506

 Score =  570 bits (1468), Expect = e-160,   Method: Composition-based stats.
 Identities = 293/509 (57%), Positives = 373/509 (73%), Gaps = 17/509 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+ A +  + SG TGDWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 4   MLDL-TYDAPTPKVISGATGDWELVIGLEVHAQVATNAKLFSGASTLFGAEPNSNVAFVD 62

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           A MPGMLP++N  CV QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 63  AGMPGMLPVINEACVAQAVRTGLGLKAQINLTSAFDRKNYFYPDLPQGYQISQLYHPIVG 122

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +       V IERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV+
Sbjct: 123 EGEVLVEMGNGTA-----RLVRIERIHLEQDAGKSIHDMDPTMSFVDLNRTGVALMEIVS 177

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GE 229
           +PD+R   EA A++ KLR I+RYLGTCDGNM+ G++RADVNVSVCRP             
Sbjct: 178 RPDIRGPEEAAAYVLKLRQIMRYLGTCDGNMQNGNLRADVNVSVCRPGDYERYQATQDFS 237

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+ +AI++EARRQIA+LEDG  + QETRL+DP +NETRS+R+KE+
Sbjct: 238 HLGTRCEIKNMNSMRFIQMAIDFEARRQIALLEDGKSVTQETRLYDPDRNETRSMRSKEE 297

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPD K+ RFI ++G+S YDASVL ++   
Sbjct: 298 AHDYRYFPDPDLLPLEIEQAWVDDIAAHLPELPDTKKARFIADYGLSDYDASVLTAEGEN 357

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A +FEK A  RD K+ ANWVIN+L G L +  + I D+PIS  +LG++I LI   TISGK
Sbjct: 358 AAFFEKAAEGRDGKLAANWVINELFGRLKKDDRDIADSPISAQRLGQIIGLIKSDTISGK 417

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F+I + +   P+EIV   G+ QVTD  AIE+ VD +I +NP+ V +    P L  
Sbjct: 418 IAKDVFDIAYTQDRDPEEIVATEGMTQVTDTGAIEEAVDAIIAANPDQVEKAKANPKLAG 477

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
           WFVGQVMK TGGKANP+ V +++  +LG+
Sbjct: 478 WFVGQVMKATGGKANPAAVNQIVAARLGL 506


>gi|310816195|ref|YP_003964159.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ketogulonicigenium vulgare Y25]
 gi|308754930|gb|ADO42859.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ketogulonicigenium vulgare Y25]
          Length = 503

 Score =  569 bits (1467), Expect = e-160,   Method: Composition-based stats.
 Identities = 297/509 (58%), Positives = 372/509 (73%), Gaps = 17/509 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+ +    + +G   DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDL-TYTSPKPKVIAGAKYDWELVIGLEVHAQVATNAKLFSGASTGFGAEPNSHVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           A MPGMLP++N  C+ QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AGMPGMLPVINEECIAQAVRTGLGLKAAINLRSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +       V IERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV+
Sbjct: 120 EGEVLVEMGAGVA-----RRVRIERIHLEQDAGKSIHDMDPHMSFVDLNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GE 229
           +PD+R   EA A++ KLR I+RYLGTCDGNM+ G++RADVNVSVCRP             
Sbjct: 175 RPDIRGPEEAAAYVGKLRQIMRYLGTCDGNMQNGNLRADVNVSVCRPGAYEKFAETGDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+   IEYEARRQIAILEDGG I QETRL+DP K ETRS+R+KE+
Sbjct: 235 YLGTRCELKNMNSMRFIQQGIEYEARRQIAILEDGGTIDQETRLYDPEKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPDAK+ RF+ +FG++ YDASVL ++   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAAHLPELPDAKKARFMADFGLTEYDASVLTAEAEN 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE++A  RD K+ ANWVIN+L G L +  + I D+P+SP QLG ++ LI  G ISGK
Sbjct: 355 AAYFEEVAQGRDGKLSANWVINELFGRLKKDSREIGDSPVSPAQLGGIVALIASGDISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           I KD+F I++ +GG P EIVE  G+RQVTD  AIE  VD+VI +NP  V +    P L  
Sbjct: 415 IGKDLFEIIYTEGGDPAEIVESRGMRQVTDFGAIETAVDDVIAANPAQVEKAKANPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
           WFVGQVMK+TGGKANP+ V  ++ +KLG+
Sbjct: 475 WFVGQVMKSTGGKANPAAVNDIVAKKLGL 503


>gi|253577659|ref|ZP_04854967.1| glutamyl-tRNA(Gln) amidotransferase [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251842951|gb|EES70991.1| glutamyl-tRNA(Gln) amidotransferase [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 479

 Score =  569 bits (1467), Expect = e-160,   Method: Composition-based stats.
 Identities = 216/482 (44%), Positives = 302/482 (62%), Gaps = 9/482 (1%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
           +T  +E VIG+EVH +L   SK+F G S  FGA PNT         PG+LP+LN + V  
Sbjct: 2   STSKYETVIGLEVHVELHTKSKIFCGCSTEFGAPPNTHTCPVCLGHPGVLPVLNRQAVDY 61

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           A+   + LN  I     F RKNYFYPD P+ YQISQ+D+PI   G + + +        +
Sbjct: 62  AMKAAMALNCEIGDVCKFDRKNYFYPDSPKAYQISQYDQPIGKNGYIDIEVDG------K 115

Query: 138 TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
           T  +GI R+HLE+DAGK  H      S +D NR G  L+EIV++PD+ S  EA+A+L KL
Sbjct: 116 TKRIGITRLHLEEDAGKLTHVDGGYASLVDFNRVGTPLVEIVSEPDISSPEEARAYLEKL 175

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           R+I+ Y    D  MEEGSMR D N+S+     + +GTR E+KN+NS R +   +EYE  R
Sbjct: 176 RAIMLYCEVSDVKMEEGSMRCDANISLRPWGQKEFGTRAELKNMNSFRGVVRGLEYEQLR 235

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q  IL++GG + QETR +D ++ +T S+R KE+A DYRYF +PDL+ L ID+++   I+ 
Sbjct: 236 QAEILDEGGEVVQETRRWDEAQGKTFSMRGKEEAHDYRYFPDPDLVTLHIDQEWKDRIRA 295

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLG 375
            IPELPDA++ R+  E+G+  YDA V+ S K++AD FE      +D K V+NW++ DLLG
Sbjct: 296 SIPELPDARKARYTSEYGLPEYDAGVITSSKALADLFESSLEYTKDAKAVSNWIMGDLLG 355

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            LN +   + D  ++   LGE+I L+  GTIS KIAK +F  + + G  P++IVEE GL 
Sbjct: 356 YLNSNSLELSDVKLTGQGLGEMIGLLEKGTISSKIAKTVFKEMLQSGKLPQQIVEEQGLV 415

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q++D  AI  +V EV+ +NP +V      K   + + VGQVMK + GKANP +V K+L E
Sbjct: 416 QISDEGAIMAIVQEVVANNPASVEDYKAGKEKAIGFLVGQVMKQSKGKANPGLVNKLLVE 475

Query: 495 KL 496
            L
Sbjct: 476 VL 477


>gi|289207518|ref|YP_003459584.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Thioalkalivibrio
           sp. K90mix]
 gi|288943149|gb|ADC70848.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thioalkalivibrio
           sp. K90mix]
          Length = 477

 Score =  569 bits (1467), Expect = e-160,   Method: Composition-based stats.
 Identities = 235/481 (48%), Positives = 333/481 (69%), Gaps = 8/481 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +WE VIG+E+HAQL+ VSK+FSGA   +GAEPN Q    D  MPG+LP+LN   V++AV
Sbjct: 1   MEWETVIGLEIHAQLNTVSKIFSGAPTAYGAEPNRQACAVDLGMPGVLPVLNQGAVEKAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           M GL ++A I   SVFARKNYFYPDLP+GYQISQ++ PIVG G + + +         T 
Sbjct: 61  MLGLAIDAEITPRSVFARKNYFYPDLPKGYQISQYELPIVGLGHLDIELED-----GTTK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +G+ R HLE+DAGKS+H+ + +++ IDLNR+G  L+EIV++P++RS+ EA A++ KL S
Sbjct: 116 RIGVTRAHLEEDAGKSLHEGFESMTGIDLNRAGTPLIEIVSEPELRSAKEAVAYMKKLHS 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYL  CDGNM+EGS R D NVS+       +GTR E+KN+NS RF+  AI +E  RQI
Sbjct: 176 LVRYLDICDGNMQEGSFRCDANVSIRPKGQTEFGTRAELKNLNSFRFVERAINHEVERQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++E GG + QETRL+DP ++ETRS+RTKE+A DYRYF +PDLLP+ +D  F+  +++++
Sbjct: 236 DVIEGGGSVVQETRLYDPDRDETRSMRTKEEANDYRYFPDPDLLPVVVDAAFVNQMRERL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR-DKKIVANWVINDLLGVL 377
           PELP AKR RF+ ++G+S YDA VL + + + D++E +A      K+ ANWV+ +    +
Sbjct: 296 PELPGAKRARFVEQYGLSDYDAGVLTAAREMGDFYEAVAAGCGAPKLAANWVMGEFSAAM 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           NRS   + D P++   L  L+  I D TISGKIAK++F  +W   G    ++E  GL+Q+
Sbjct: 356 NRSEVELADAPVNAEGLAGLLARIQDETISGKIAKEVFEAMWNGEGDADTVIEAKGLKQI 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           TD +AI+ ++DEV+ +NP  + +    K  L  +FVGQVMK T GKANP+ V + LK KL
Sbjct: 416 TDTAAIDAIIDEVMANNPQQLEQYRGGKDKLFGFFVGQVMKATQGKANPAQVNERLKAKL 475

Query: 497 G 497
            
Sbjct: 476 D 476


>gi|119488990|ref|ZP_01621925.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Lyngbya sp. PCC
           8106]
 gi|119454946|gb|EAW36089.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Lyngbya sp. PCC
           8106]
          Length = 494

 Score =  569 bits (1467), Expect = e-160,   Method: Composition-based stats.
 Identities = 222/494 (44%), Positives = 313/494 (63%), Gaps = 9/494 (1%)

Query: 13  SLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNG 72
           +  +    ++EV+IG+E H QLS  +K+FS +S  FGA+PNT +      +PG+LP+LN 
Sbjct: 2   TSAASVKTEYEVIIGLETHCQLSTETKIFSSSSTAFGADPNTNIDPICLGLPGVLPVLNQ 61

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
           + ++ AV  GL LN  I  YS F RK YFYPDLP+ YQISQ D PI   G + + I   +
Sbjct: 62  KVLEYAVKAGLALNCKIAPYSKFDRKQYFYPDLPKNYQISQFDLPIAENGWLEIEIVD-E 120

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQYSA-----VSCIDLNRSGVALMEIVTKPDMRSS 187
            G     ++GI R+H+E+DAGK +H   S       S +D NR+G+AL+EIV++PD+RS 
Sbjct: 121 DGNATRKKIGITRLHMEEDAGKLVHAGSSGISGSTHSMVDYNRAGIALIEIVSEPDIRSG 180

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFL 246
           +EA  +  +LR I+RYLG  DGNM+EGS+R DVN+SV     + +GT+ E+KN+NS   +
Sbjct: 181 IEAAEYAQELRRIVRYLGVSDGNMQEGSLRCDVNISVRPVGQKEFGTKVEIKNMNSFSAI 240

Query: 247 GLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEI 306
             AI+YE  RQI  LE G  I QETRL++     T S+R+KE + DYRYF EPDL P+E+
Sbjct: 241 QRAIDYEIERQIEALETGEKISQETRLWEEGSQRTISMRSKEGSSDYRYFPEPDLPPIEV 300

Query: 307 DEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIV 365
             D + A K ++PELP  KR R+  E G+S YD  VL  D SI++YFE  +    D K  
Sbjct: 301 SPDQLEAWKTELPELPAQKRHRYETELGLSPYDTRVLTDDCSISEYFETAVQAGADTKQA 360

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
            NWV+ D+   L     +I +  + P+ L ELI LI  GTISGKIAKDI   L  KG +P
Sbjct: 361 VNWVMGDITAYLKNEKLAISEIALKPDGLAELIGLIDAGTISGKIAKDILPELLVKGDSP 420

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKAN 484
           K++VE+ GL Q++D   +E ++DEV+  +P+ V +    K  L  +FVGQ+MK T G+A+
Sbjct: 421 KKLVEKKGLIQISDTGELESIIDEVLADHPSEVEKYKAGKTKLKGFFVGQIMKKTQGRAD 480

Query: 485 PSIVQKMLKEKLGI 498
           P +  ++L++KL  
Sbjct: 481 PKLTNQLLEKKLNA 494


>gi|297616697|ref|YP_003701856.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Syntrophothermus
           lipocalidus DSM 12680]
 gi|297144534|gb|ADI01291.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 484

 Score =  569 bits (1467), Expect = e-160,   Method: Composition-based stats.
 Identities = 219/484 (45%), Positives = 310/484 (64%), Gaps = 12/484 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           TG +E VIG+EVHA+L   SK+F   S  FGAEPNTQV      MPG+LP+LN + V+ A
Sbjct: 3   TGRYEAVIGLEVHAELRTDSKIFCACSTRFGAEPNTQVCPICTGMPGVLPVLNRKVVEYA 62

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           + TGL LN  I ++S F RKNYFYPDLP+ YQISQ+D PI   G + + +      + R 
Sbjct: 63  IKTGLALNCEIAEFSKFDRKNYFYPDLPKAYQISQYDLPICRNGYIDIEV------EGRK 116

Query: 139 IEVGIERIHLEQDAGKSIHDQ---YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
             VGI R+H+E+DAGK +H      +  S +DLNRSGV L+EIV++PDMRS  EA+ ++ 
Sbjct: 117 KRVGITRVHMEEDAGKLLHQGTIASTPYSLVDLNRSGVPLLEIVSEPDMRSPAEARLYME 176

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEA 254
           KLRSIL +LG  D  MEEGS+R D NVSV     + +GT+ E+KN+NS + L  A+EYE 
Sbjct: 177 KLRSILLFLGVSDCRMEEGSLRCDANVSVRIQGQQGFGTKTEIKNLNSFKALERALEYEI 236

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           +RQI +LED   + QETR +D S+  T S+R+KE+A DYRYF +PDL+PL ID  ++  +
Sbjct: 237 KRQIELLEDDESVIQETRTWDESQQATLSMRSKEEAQDYRYFPDPDLVPLIIDRGWVEEV 296

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDL 373
           +  +PELPDA RER + +F +  YDA++L   K   D+F++        K V+NW++ +L
Sbjct: 297 RSSLPELPDAARERLMRQFNLPEYDANLLTMTKDTLDFFDECMQYYQDAKTVSNWIMGEL 356

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
             +LN+    ++D  I P  L E++ +I  G ISGK+AK +F  ++  G +P+ +V E G
Sbjct: 357 SRLLNQHNLELKDAKIKPAHLTEMLKMIDSGQISGKMAKTVFEEMFVSGKSPETVVREKG 416

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           + Q++D +A+E V+  +I  N   V      K     + VGQVMK T G+ANP +V  +L
Sbjct: 417 MVQISDEAALEPVIARIIAENSGVVEDYRKGKEKAFGFLVGQVMKATRGQANPKVVNDIL 476

Query: 493 KEKL 496
           +  L
Sbjct: 477 RRML 480


>gi|299068371|emb|CBJ39595.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Ralstonia solanacearum CMR15]
          Length = 488

 Score =  569 bits (1466), Expect = e-160,   Method: Composition-based stats.
 Identities = 245/487 (50%), Positives = 328/487 (67%), Gaps = 8/487 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E HAQLS  SK+FSGAS  FGA PNTQ +  D A+PG+LP+LN   V++A+
Sbjct: 1   MQWEVVIGLETHAQLSTASKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +           
Sbjct: 61  TFGLAIGAKIASKSIFARKNYFYPDLPKGYQISQYEIPVVQGGTLTIQVEGKNGQPGYEK 120

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L +
Sbjct: 121 TVQLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKSLHA 180

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV R P   +GTRCE+KN+NS RFL  AI YE RRQI
Sbjct: 181 LVMWLGICDGNMQEGSFRCDANVSVRRGPDAPFGTRCEIKNLNSFRFLEEAINYEVRRQI 240

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPL I  D++ A++  +
Sbjct: 241 ELIEDGGTVVQETRLYDPDRKETRSMRSKEDAHDYRYFPDPDLLPLMIGADWVDAVRATL 300

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A   RF   +G+  YDAS+L + K+ A YFE     A   + K  ANW++ ++  
Sbjct: 301 PELPAAMAARFESAYGLPRYDASILTATKATAAYFEAVVAAAGAANAKAAANWIMGEVAS 360

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEEL 432
            LNR+G  I+  P+SP QL  L+  I DGTIS   A KD+F  +W  E GG    I+ E 
Sbjct: 361 NLNRAGLEIDAAPVSPAQLAGLLARIADGTISNNTAKKDVFPAMWAGEHGGDADAIIAEK 420

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q++D   +EK++DEV+ +N  +V      K    +  VGQ MK T GKANPS V ++
Sbjct: 421 GLKQMSDSGELEKIIDEVLAANAKSVEEFRAGKDKAFNALVGQAMKATRGKANPSQVNEL 480

Query: 492 LKEKLGI 498
           LK+KLG 
Sbjct: 481 LKKKLGA 487


>gi|218778531|ref|YP_002429849.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfatibacillum
           alkenivorans AK-01]
 gi|226709604|sp|B8FJV3|GATB_DESAA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|218759915|gb|ACL02381.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfatibacillum
           alkenivorans AK-01]
          Length = 476

 Score =  569 bits (1466), Expect = e-160,   Method: Composition-based stats.
 Identities = 236/481 (49%), Positives = 310/481 (64%), Gaps = 9/481 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVHAQL   SK+F G S  FGA PNT        MPG LP+LN + V  A+
Sbjct: 1   MEFEAVIGLEVHAQLKTESKIFCGCSTAFGASPNTHTCPVCLGMPGSLPVLNKKVVDYAM 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              L     I+ YS FARKNYFYPDLP+GYQISQ++ PI   G + V     K       
Sbjct: 61  RMALATQCSISPYSRFARKNYFYPDLPKGYQISQYELPIAEHGHLMVDTDQGK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           ++GI RIH+E+DAGK  HD +  VS +DLNR+G  L+EIV++PDMRS  EA A+L +L +
Sbjct: 115 KIGITRIHMEEDAGKLTHDSHRPVSRVDLNRTGTPLIEIVSEPDMRSPWEASAYLKQLHA 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ILRYL  CDGNMEEGS R D NVSV     E +GTR E+KN+NS R +  AI YE  RQ 
Sbjct: 175 ILRYLDICDGNMEEGSFRCDANVSVRPRGQEEFGTRAEIKNMNSFRNVERAIAYEIDRQS 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++E+GG + QETRL+D  KN T S+R KE+A DYRYF +PDL+PL IDE +I  ++  +
Sbjct: 235 TLVEEGGEVIQETRLWDAEKNRTFSMRGKEEAHDYRYFPDPDLVPLVIDEAWIEQVRGLL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELP+ ++ RF+ ++G++  DA  L S + +ADY+E      +D K V NWV   L  +L
Sbjct: 295 PELPEERKARFLEQYGLAQDDAVFLTSAREMADYYEACVEIFKDPKQVCNWVTGALAALL 354

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N  G S+ ++PIS  +L  L+ LI DG ISGKIAK +F  +      P+ IV+E GL QV
Sbjct: 355 NAKGISVTESPISAQRLAALLKLIKDGVISGKIAKTVFECMETDERDPEAIVKEKGLVQV 414

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D   IE +V EV+++ P  V      K  L+ +FVGQ+MK T GKANP  V ++LKEKL
Sbjct: 415 SDSGEIESMVQEVLDACPEEVEAYRGGKKKLMGFFVGQIMKKTKGKANPQTVNQLLKEKL 474

Query: 497 G 497
            
Sbjct: 475 D 475


>gi|95931417|ref|ZP_01314125.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfuromonas
           acetoxidans DSM 684]
 gi|95132535|gb|EAT14226.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfuromonas
           acetoxidans DSM 684]
          Length = 481

 Score =  569 bits (1466), Expect = e-160,   Method: Composition-based stats.
 Identities = 226/482 (46%), Positives = 319/482 (66%), Gaps = 9/482 (1%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
              +EVVIG+EVH QL+  +K+F G S  FG +PN+Q       +PG LP+LN + V+ A
Sbjct: 2   RDKYEVVIGLEVHVQLTTKTKIFCGCSTQFGNQPNSQTCPVCLGLPGALPVLNRQVVENA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           +  GL  N  I+  S+FARKNYFYPDLP+GYQISQ + PI   G + +      +     
Sbjct: 62  IKAGLATNCQISPRSIFARKNYFYPDLPKGYQISQFELPICEHGHLDIESDHRGAQ---- 117

Query: 139 IEVGIERIHLEQDAGKSIHDQYSA-VSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
            ++GI RIH+E+DAGK +H       S +DLNR+   L+E+V++PDMRSS EA A+L KL
Sbjct: 118 -KIGITRIHMEEDAGKLLHSDDVGAGSRVDLNRACTPLLEVVSEPDMRSSDEAIAYLKKL 176

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
             I+ YLG CDGN+EEGS R D NVSV     E +GTR E+KN+NS RF+  AIEYE  R
Sbjct: 177 HQIVMYLGICDGNLEEGSFRCDANVSVRPWGQEEFGTRAELKNINSFRFIKEAIEYEIDR 236

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI ++EDGG + QETRLFD +   TRS+R KE+A DYRYF +PDL+PL I ++++  ++ 
Sbjct: 237 QIELVEDGGTVVQETRLFDSNTGLTRSMRGKEEAHDYRYFPDPDLVPLIISDEWVSDVRD 296

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLG 375
            +PELP+AK+ RFI ++ +   D  +L +++++A+YF+  A  ++D K  ANWV+ D+  
Sbjct: 297 GLPELPEAKKARFIKQYSLPERDTEILTAERALAEYFDACAQLHKDAKACANWVMGDVQR 356

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
             N  G S+ D P++P  L  ++  I D TISGKIAK +F+ +W  G     +++E GL+
Sbjct: 357 RRNDEGLSVADIPVTPELLVGILKRIDDKTISGKIAKTVFDEMWTTGKDADTVIDEKGLK 416

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           QVTD  AIEK+VD+VI +NP         K  L+ +FVGQ+MK + GKANP +V ++L++
Sbjct: 417 QVTDTGAIEKMVDDVIAANPAQAQEFSEGKDKLLGFFVGQIMKASKGKANPGMVNELLRK 476

Query: 495 KL 496
           KL
Sbjct: 477 KL 478


>gi|197104792|ref|YP_002130169.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Phenylobacterium
           zucineum HLK1]
 gi|196478212|gb|ACG77740.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Phenylobacterium
           zucineum HLK1]
          Length = 499

 Score =  569 bits (1466), Expect = e-160,   Method: Composition-based stats.
 Identities = 297/499 (59%), Positives = 369/499 (73%), Gaps = 16/499 (3%)

Query: 11  SESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPIL 70
           +  L  G TG WEVV+G+EVHAQ++  +KLFSGA+V FGA PN QVS  DAAMPGMLP++
Sbjct: 6   NAKLIQGRTGPWEVVLGLEVHAQVASNAKLFSGAAVGFGAGPNEQVSLVDAAMPGMLPVI 65

Query: 71  NGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP 130
           N  CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ+  PIVGEG+V V    
Sbjct: 66  NRHCVEQAVRTGLGLKAQINLKSRFDRKNYFYPDLPQGYQISQYQHPIVGEGEVIVERDD 125

Query: 131 DKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEA 190
                  T  V IER+HLEQDAGKS+HDQ    + +DLNR+G ALMEIV++PDMRSS EA
Sbjct: 126 -----GSTFTVRIERLHLEQDAGKSLHDQDPNFTYVDLNRAGTALMEIVSRPDMRSSDEA 180

Query: 191 KAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GEAWGTRCEVKN 239
            A++ KLR+IL YLG+CDG+ME+G++RADVNVSVCRP               GTRCE+KN
Sbjct: 181 AAYVKKLRTILIYLGSCDGDMEKGNLRADVNVSVCRPGAYEKYRQTGDFSHLGTRCEIKN 240

Query: 240 VNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEP 299
           VNS RF+  AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KE+A DYRYF +P
Sbjct: 241 VNSFRFMQQAIEYEARRQIEILEDGGSIDQETRLFDPNKGETRSMRSKEEAHDYRYFPDP 300

Query: 300 DLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN 359
           DLLPLE+D  +++ I+  +PELPDAK+ RF  ++G+S YDA VL++D++ AD++E  A  
Sbjct: 301 DLLPLELDPAWVKKIEADLPELPDAKKARFQSQYGLSAYDAGVLIADQAKADFYEAAANG 360

Query: 360 RDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW 419
           RD K+VANWV NDL   L+  G  I D+PI P  + EL+ LI DGTIS KIAKD+F  +W
Sbjct: 361 RDAKLVANWVTNDLAAKLSADGLEIGDSPIGPAAIAELVQLIEDGTISSKIAKDVFERMW 420

Query: 420 EKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNT 479
              G+  EIVE+ GL+QV+D  A+EK++D++I +NP   A +  KP  + WFVGQVMK T
Sbjct: 421 AGEGSASEIVEKQGLKQVSDTGALEKIIDDLIAANPGQAAAVKEKPQAIGWFVGQVMKAT 480

Query: 480 GGKANPSIVQKMLKEKLGI 498
           GGKANP  V ++LK KLG+
Sbjct: 481 GGKANPGAVNQLLKAKLGV 499


>gi|259418885|ref|ZP_05742802.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Silicibacter sp. TrichCH4B]
 gi|259345107|gb|EEW56961.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Silicibacter sp. TrichCH4B]
          Length = 502

 Score =  568 bits (1464), Expect = e-160,   Method: Composition-based stats.
 Identities = 293/508 (57%), Positives = 372/508 (73%), Gaps = 17/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+      + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDL-TYELPKPKVIAGAKHDWELVIGMEVHAQVSSNAKLFSGASTQFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPVINEYCVEQAVRTGLGLKADINLWSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +       V IERIH+EQDAGKSIHD   ++S +DLNR+GV LMEIV+
Sbjct: 120 EGEVLVELGDGTA-----RMVRIERIHMEQDAGKSIHDMDPSMSFVDLNRTGVCLMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSV-----------CRPGE 229
           +PD+R   EA A++ KLR I+RYLGTCDGNM+ G++RADVNVS+            +   
Sbjct: 175 RPDIRGPEEAAAYIAKLRQIMRYLGTCDGNMQNGNLRADVNVSICRAGQYEKYQETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIE EARRQIAI+E GG + QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIEVEARRQIAIVEAGGEVEQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++D++  IK  +PELPD K+ RFI +FG++ YDASVL +D   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQDWVDGIKAALPELPDDKKARFIKDFGLTDYDASVLTADLES 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A+YF+++A  R  K+ ANWVIN+L G L +  K I D+P+SP QLG +IDLI    ISGK
Sbjct: 355 ANYFDEVAKGRSGKLAANWVINELFGRLKKDDKDITDSPVSPAQLGGVIDLIASDAISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F I++ +GG P +IVEE G++QVTD  AIE  +DE+I +NP  V +    P L  
Sbjct: 415 IAKDLFEIVYTEGGDPAQIVEERGMKQVTDTGAIEAALDEIIAANPAQVEKAKENPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           WFVGQVMK TGGKANP  V +++ +KLG
Sbjct: 475 WFVGQVMKATGGKANPKAVNELVAKKLG 502


>gi|85703680|ref|ZP_01034784.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseovarius sp.
           217]
 gi|85672608|gb|EAQ27465.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseovarius sp.
           217]
          Length = 504

 Score =  568 bits (1464), Expect = e-160,   Method: Composition-based stats.
 Identities = 299/510 (58%), Positives = 378/510 (74%), Gaps = 18/510 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+ A    + +G   DWE+VIG+EVHAQ++  SKLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDL-TYKAPKPRVIAGAKHDWELVIGMEVHAQVASRSKLFSGASTQFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   P+VG
Sbjct: 60  AAMPGMLPVINEFCVEQAVRTGLGLKAKINLWSAFDRKNYFYPDLPQGYQISQLYHPLVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG++ V +GP  +       V +ERIH+EQDAGKSIHD   A+S +DLNR+GV LMEIV+
Sbjct: 120 EGEILVDMGPGVA-----RLVRVERIHMEQDAGKSIHDMDPAMSFVDLNRTGVCLMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A++TKLR ILRYLGTCDGNM+ G++RADVNVS+CRPG+           
Sbjct: 175 RPDIRGPEEAAAYVTKLRQILRYLGTCDGNMQNGNLRADVNVSICRPGQYEKYMETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+ +AI+YEARRQIAI+E GG + QETRL+DP KNETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQMAIDYEARRQIAIVEAGGTVVQETRLYDPDKNETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPDAK+ RF+ EFG+S YDASVL +D + 
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDEIAANLPELPDAKKARFVLEFGLSEYDASVLTADLAN 354

Query: 350 ADYFEKLAVNR-DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISG 408
           A YFE +A    D K+ ANWVIN+L G L +   SIED+P+SP QL  ++ LI    ISG
Sbjct: 355 AAYFEAVAAGAGDGKLAANWVINELFGRLKKEDHSIEDSPVSPAQLAGIVRLIKSDAISG 414

Query: 409 KIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLV 468
           KIAKD+F I++ +GG P+EIVE  G++QVTD  AIE+ V E+I +NP  V +    P L 
Sbjct: 415 KIAKDLFEIVYTEGGDPEEIVEARGMKQVTDTGAIEQAVAEIIAANPAQVEKAQANPKLA 474

Query: 469 SWFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
            WFVGQVMK TGGKANP  V  ++  KLG+
Sbjct: 475 GWFVGQVMKATGGKANPKAVNDIVMAKLGL 504


>gi|326403189|ref|YP_004283270.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acidiphilium multivorum AIU301]
 gi|325050050|dbj|BAJ80388.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acidiphilium multivorum AIU301]
          Length = 487

 Score =  568 bits (1464), Expect = e-160,   Method: Composition-based stats.
 Identities = 285/487 (58%), Positives = 366/487 (75%), Gaps = 6/487 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
             +  GTTG WE+VIG+EVHAQ+   SKLFSGA+  FGAEPN+QVSF DA  PGMLP++N
Sbjct: 2   SYVIEGTTGAWELVIGLEVHAQVISRSKLFSGAATAFGAEPNSQVSFVDAGFPGMLPVIN 61

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QAV TGLGL AHIN  S F RKNYFY DLPQGYQISQ++ PIVG G + + +   
Sbjct: 62  RECVAQAVRTGLGLAAHINLVSRFDRKNYFYADLPQGYQISQYEHPIVGAGAIEIELDSG 121

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
           +     T  +GI R+HLEQDAGKS+HDQ+ + S IDLNRSGVALMEIV++PDMRS  EA 
Sbjct: 122 E-----TRTIGITRLHLEQDAGKSMHDQHPSKSLIDLNRSGVALMEIVSEPDMRSPEEAG 176

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A+L KLR+ILRYLGTCDGNM+EGSMRADVNVSV + GE + TRCE+KNVNSIRF+  AIE
Sbjct: 177 AYLRKLRTILRYLGTCDGNMDEGSMRADVNVSVRKHGEPFRTRCEIKNVNSIRFVMQAIE 236

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
            EA+RQI I E GG + QETRLF+P++  TRS+R+KEDA DYRYF EPDLLPL ++E+++
Sbjct: 237 AEAKRQIEIWEAGGTVDQETRLFEPARGVTRSMRSKEDAHDYRYFPEPDLLPLVLEEEWV 296

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
            ++K  +PELPDAKR R + +FG+S Y+AS+ V ++  AD+FE +A  RD K+VANW++ 
Sbjct: 297 ESLKATLPELPDAKRARLMRDFGLSRYEASIFVMEQVTADFFETVAAGRDAKLVANWMLG 356

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D    LNR+G SIE +P++  +LGEL+DLI D TI+GKIAK++  ++++ G     IVE 
Sbjct: 357 DFFAHLNRTGTSIETSPVNAARLGELLDLITDKTINGKIAKEVLELMFDTGDAAGAIVEA 416

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+QVTD  AI++ +D+VI +N + +A     K  L  +FVGQVMK   GK NP++V +
Sbjct: 417 RGLKQVTDTGAIDEAIDKVIAANADKLAEYKAGKDKLFGFFVGQVMKAMQGKGNPALVNE 476

Query: 491 MLKEKLG 497
            LK K+G
Sbjct: 477 ALKRKIG 483


>gi|255262577|ref|ZP_05341919.1| aspartyl/glutamyl-tRNA [Thalassiobium sp. R2A62]
 gi|255104912|gb|EET47586.1| aspartyl/glutamyl-tRNA [Thalassiobium sp. R2A62]
          Length = 504

 Score =  568 bits (1464), Expect = e-160,   Method: Composition-based stats.
 Identities = 301/508 (59%), Positives = 372/508 (73%), Gaps = 18/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+      + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDL-TYETPKPKVIAGAKHDWELVIGLEVHAQVSSKAKLFSGASTQFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           A MPGMLP++N  CV  AV TGLGLNA IN  S F RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 60  AGMPGMLPVINEECVALAVKTGLGLNAEINLKSAFDRKNYFYPDLPQGYQISQLYEPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
            G++ V +GP         +V +ERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV+
Sbjct: 120 PGEILVDMGP-----GIARKVRVERIHLEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCR-----------PGE 229
            PD+R   EA A++ KLR ILRYLGTCDGNM+ G+MRADVNVSVCR              
Sbjct: 175 FPDIRGPEEAAAYVVKLRQILRYLGTCDGNMQNGNMRADVNVSVCRAGQYEKFQETGDFG 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+ LAI++EARRQIAILEDGG I QETRL+D  KNETRS+R+KE+
Sbjct: 235 HLGTRCELKNMNSMRFIQLAIDFEARRQIAILEDGGEITQETRLYDADKNETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPDAKR RF+G+FG+S YDASVL ++   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAASLPELPDAKRARFVGDFGLSQYDASVLTAEAEN 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKS-IEDTPISPNQLGELIDLIIDGTISG 408
           A YFE++A  RD K+ ANWVIN+L G L +     I D+P+SP QLG +I+LI    ISG
Sbjct: 355 AAYFEQVADGRDGKMAANWVINELFGRLKKDDDKAITDSPVSPAQLGGIIELISSDAISG 414

Query: 409 KIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLV 468
           KIAKD+F I++ +GG P  IVEE G++QVTD  AIE  VDE+I +NP+ VA+    P L 
Sbjct: 415 KIAKDLFEIVYTEGGDPAVIVEERGMKQVTDTGAIEAAVDEIIAANPDQVAKAKENPKLA 474

Query: 469 SWFVGQVMKNTGGKANPSIVQKMLKEKL 496
            WFVGQVMK TGGKANP  V +++ +KL
Sbjct: 475 GWFVGQVMKATGGKANPKAVNQLVAQKL 502


>gi|148553521|ref|YP_001261103.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sphingomonas
           wittichii RW1]
 gi|166198819|sp|A5V3U9|GATB_SPHWW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|148498711|gb|ABQ66965.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Sphingomonas wittichii RW1]
          Length = 494

 Score =  568 bits (1464), Expect = e-160,   Method: Composition-based stats.
 Identities = 282/494 (57%), Positives = 358/494 (72%), Gaps = 8/494 (1%)

Query: 11  SESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPIL 70
           S     G TG+WEVVIG+EVHAQ+   +KLFSGAS  FGAEPN  VS  DAAMPGMLP+ 
Sbjct: 2   SSYRIQGATGEWEVVIGLEVHAQVVSNAKLFSGASAAFGAEPNQSVSLVDAAMPGMLPVP 61

Query: 71  NGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP 130
           N  C++QAV TG+ L A IN++S F RKNYFY DLPQGYQISQ   P+VGEG +++    
Sbjct: 62  NEECIRQAVKTGMALGAEINRWSRFDRKNYFYADLPQGYQISQLYHPLVGEGTITID-AD 120

Query: 131 DKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEA 190
           +K+G      +G+ER+H+EQDAGK +HDQ+   S +DLNRSGVALMEIV+KPDMRS  EA
Sbjct: 121 EKAGIAEARTIGVERLHVEQDAGKLMHDQHPTRSYVDLNRSGVALMEIVSKPDMRSPSEA 180

Query: 191 KAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAI 250
            A+L KLRSILRY+G+CDGNMEEGSMRADVNVSV + G+ +GTR E KNVNSIRF+  AI
Sbjct: 181 GAYLRKLRSILRYVGSCDGNMEEGSMRADVNVSVRKAGDPFGTRTETKNVNSIRFVMAAI 240

Query: 251 EYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDF 310
           E EA RQ+ ++E GG I QETRL+DP +NETRS+R+KEDA DYRYF +PDLLPLE+ E+F
Sbjct: 241 ESEANRQVDVIEGGGKIVQETRLYDPDRNETRSMRSKEDAHDYRYFPDPDLLPLELSEEF 300

Query: 311 IRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK------LAVNRDKKI 364
           +   + ++PELPDAKR R+ GE G+  Y+A+VL SD   A +FE              + 
Sbjct: 301 VAQCRAELPELPDAKRARYEGELGLPAYNAAVLTSDVETARWFEALLDAAGKPGAEVARA 360

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            +NW+I+DL G LNR GK+I+++P+SP Q  EL+ L+ DGT+SG +AK +F I+ E G  
Sbjct: 361 ASNWLISDLFGALNRLGKAIDESPVSPRQGAELLALVADGTLSGTLAKQVFEIMLETGDD 420

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKA 483
           P  IVEE GL+Q +D  AIE V+ EV+ +N + VA     K  L  +FVGQ MK  GGKA
Sbjct: 421 PARIVEERGLKQTSDTGAIEAVIAEVMAANADKVAEYRGGKDKLFGFFVGQTMKAMGGKA 480

Query: 484 NPSIVQKMLKEKLG 497
           NP +V ++LK+ LG
Sbjct: 481 NPGVVNELLKKTLG 494


>gi|254466376|ref|ZP_05079787.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodobacterales bacterium Y4I]
 gi|206687284|gb|EDZ47766.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodobacterales bacterium Y4I]
          Length = 503

 Score =  568 bits (1464), Expect = e-160,   Method: Composition-based stats.
 Identities = 294/508 (57%), Positives = 371/508 (73%), Gaps = 17/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+      + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDL-TYELPKPKVIAGAKHDWELVIGMEVHAQVSSNAKLFSGASTKFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPVINEFCVEQAVRTGLGLKADINLWSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +      +V IERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV+
Sbjct: 120 EGEVLVELGDGTA-----RKVRIERIHMEQDAGKSIHDMDPHMSFVDLNRTGVCLMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A++ KLR I++YLGTCDGNM+ G++RADVNVSVC PG+           
Sbjct: 175 RPDIRGPEEAAAYIAKLRQIMQYLGTCDGNMQNGNLRADVNVSVCLPGQYEKYQETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  A E EARRQIAILE GG I QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQATEVEARRQIAILESGGEIVQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++D++  I   +PELPD K+ RFI +FG+S YDASVL +D   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQDWVDGIAASLPELPDEKKARFINDFGLSDYDASVLTADVES 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A +FE+ A  R  K+ ANWVIN+L G L +   +I ++P++P QLG +IDLI    ISGK
Sbjct: 355 ATFFEETAKGRSGKLAANWVINELFGRLKKEDHTITESPVTPAQLGGIIDLIASDAISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F I++ +GG P +IVEE G++QVTD  AIE  +DE+I +NP  V +    P L  
Sbjct: 415 IAKDLFEIVYTEGGDPAQIVEERGMKQVTDTGAIETALDEIIAANPAQVEKAKVNPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           WFVGQVMK TGGKANP  V +++ +KLG
Sbjct: 475 WFVGQVMKATGGKANPKAVNELVAKKLG 502


>gi|30250013|ref|NP_842083.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrosomonas
           europaea ATCC 19718]
 gi|47115760|sp|Q82T56|GATB_NITEU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|30139120|emb|CAD85984.1| gatB: glutamyl-tRNA(Gln) amidotransferase, B subunit [Nitrosomonas
           europaea ATCC 19718]
          Length = 478

 Score =  568 bits (1463), Expect = e-160,   Method: Composition-based stats.
 Identities = 246/482 (51%), Positives = 336/482 (69%), Gaps = 11/482 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+E+HAQLS  SK+FSGASV +GAEPN+Q    D A+PG+LP+LN + ++ A+
Sbjct: 1   MQWETVIGLEIHAQLSTRSKIFSGASVAYGAEPNSQACAVDIALPGVLPVLNRQAIEYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL ++A IN  SVFARKNYFYPDLP+GYQISQ + PIV  G V++  G  +       
Sbjct: 61  RFGLAIDATINSPSVFARKNYFYPDLPKGYQISQLEHPIVEGGHVAIQTGDQE------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + + R HLE+DAGKS H+++  ++ IDLNR+G  L+EIV++PDMRSS EA A+   L S
Sbjct: 115 TIRLTRAHLEEDAGKSTHEEFHGMTGIDLNRAGTGLLEIVSEPDMRSSAEAVAYAKVLHS 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++R++G CDGNM+EGS R D NVSV   G    GTRCE+KN+NS RFL  AI+YE  RQI
Sbjct: 175 LVRWIGICDGNMQEGSFRCDANVSVRPAGSEALGTRCEIKNLNSFRFLERAIDYEVARQI 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ILE GG I QETRL+D  ++ETR++R+KEDA DYRYF +PDLLP+ I +++I  I++++
Sbjct: 235 DILESGGSITQETRLYDADRDETRTMRSKEDAHDYRYFPDPDLLPVIIPQEWIDQIREKL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV--NRDKKIVANWVINDLLGV 376
           PELP  KR R+I +FG+  YDA++L + + +ADYFE++        K+ ANW++ ++   
Sbjct: 295 PELPKDKRNRYIQDFGLQTYDANILTAARELADYFEQMVSVLPGQSKLCANWIMGEVSAR 354

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT-PKEIVEELGLR 435
           LN+ G  I  +PISP QL  L+  I DGTISGKIAKD+F+ +W+  G     I++   LR
Sbjct: 355 LNKEGLEIARSPISPEQLAGLLLRITDGTISGKIAKDVFDSMWQSNGDSADTIIDAKNLR 414

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q++D S IEK VD+V+ +NP  VA     K    +  VGQVMK + GKANP+ V  +LK+
Sbjct: 415 QISDDSEIEKWVDDVLAANPQQVADYRAGKEKAFNSLVGQVMKTSKGKANPAQVNSVLKK 474

Query: 495 KL 496
           +L
Sbjct: 475 RL 476


>gi|224370225|ref|YP_002604389.1| GatB [Desulfobacterium autotrophicum HRM2]
 gi|223692942|gb|ACN16225.1| GatB [Desulfobacterium autotrophicum HRM2]
          Length = 476

 Score =  568 bits (1463), Expect = e-159,   Method: Composition-based stats.
 Identities = 218/480 (45%), Positives = 316/480 (65%), Gaps = 8/480 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             +E VIG+EVHAQL   +K+F   S  FGA PN         MPG+LP+LN + V  A+
Sbjct: 1   MQFEPVIGLEVHAQLDTETKIFCSCSTGFGASPNAHTCPVCTGMPGVLPVLNKKAVTYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
            TGL  N  +   S F RKNYFYPDLP+GYQI+Q   PI   G +++ +           
Sbjct: 61  RTGLATNCKVANESRFDRKNYFYPDLPKGYQITQFAAPIAEHGHLTIELDD-----GSEK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI RIH+E+DAGK IHD     S +DLNR+G+ L+EIV++PD+R+  EA ++L KL +
Sbjct: 116 RIGITRIHMEEDAGKLIHDPDRPRSMVDLNRTGIPLVEIVSEPDLRTPKEAGSYLRKLHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RY+G C+GNMEEGS R D N+S+   G   +GTR E+KN+NS R +  AI YE +RQ 
Sbjct: 176 IVRYIGVCNGNMEEGSFRCDANISLRPVGRKAFGTRTELKNLNSFRNVEKAIAYEIQRQT 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE+GG + QETRL+D + N+T S+R+KE+A DYRYF EPDL+PL +D+ ++  +++ +
Sbjct: 236 YVLEEGGEVIQETRLWDTANNKTVSMRSKEEAHDYRYFPEPDLVPLIVDDRWMEEVRQSL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVL 377
           PELPDAKR+RF+ ++ ++ YDASVL S  ++AD+FE+ A    + K+ ANW++  +L +L
Sbjct: 296 PELPDAKRQRFMDDYAMTAYDASVLTSSIALADFFEQTAKEINEPKLAANWIMGPVLALL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
                +I   PI+ + L EL+ LI  G I+   AK IF+ +      P +IVEE+GL QV
Sbjct: 356 KDQETTITSLPITADALAELLKLIEAGKINANAAKTIFDRMVTTSEGPGKIVEEMGLEQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D   +E +V EV+ +NP+ V      K  L+ +F+GQ+MK + GKA+P IV ++LK++L
Sbjct: 416 SDQGELETIVAEVLKANPDEVESYLGGKTKLMGFFMGQIMKKSRGKADPKIVTQILKQRL 475


>gi|94270556|ref|ZP_01291767.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [delta
           proteobacterium MLMS-1]
 gi|93450763|gb|EAT01821.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [delta
           proteobacterium MLMS-1]
          Length = 477

 Score =  568 bits (1463), Expect = e-159,   Method: Composition-based stats.
 Identities = 218/482 (45%), Positives = 310/482 (64%), Gaps = 10/482 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVHAQL   SK+F G S  FG  PN+        MPG+LP+LN R V+ A+
Sbjct: 1   MEFETVIGLEVHAQLKTRSKIFCGCSTEFGRPPNSNTCPVCLGMPGVLPVLNRRVVEFAL 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              L  +  +N+ +VFARKNYFYPDLP+GYQISQ D PI   G++++ +         + 
Sbjct: 61  KLALATDCTVNRRNVFARKNYFYPDLPKGYQISQFDLPIAEHGRLTIDLEGA------SR 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI RIH+E+DAGK IHD+    S +DLNR+GV L+EIV++PD+RS  EA A+L KL +
Sbjct: 115 NIGITRIHMEEDAGKLIHDEREPKSYVDLNRTGVPLLEIVSEPDLRSPAEAAAYLRKLHA 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RYL  CDGNM+EGS R D N+S+       +GTR E+KN+NS R +  A+EYE RRQ 
Sbjct: 175 IVRYLDICDGNMQEGSFRCDANISLRPVGQREFGTRTELKNMNSFRNVQRALEYEERRQR 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +L DG  + Q T L+D  +  T ++R+KE+A DYRYF +PDL+P+EID+D++   ++Q+
Sbjct: 235 DLLLDGEEVVQTTLLWDADRGVTVAMRSKEEAHDYRYFPDPDLVPVEIDDDWLATTRQQL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVL 377
           PELP AK+ RFI E G+  YDA VL S + +ADYFE+  A     K ++NW++ +L+  L
Sbjct: 295 PELPLAKKTRFINELGLPEYDAQVLTSSRELADYFEQALAAYPAAKKLSNWIMTELMRSL 354

Query: 378 N-RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
               G  I   P++P QL  L+ +I +GTISGKIAK +F  +   G  P  +V+E  L Q
Sbjct: 355 KGEEGLDIAACPVTPAQLARLLAMIDEGTISGKIAKTVFEEMVGSGADPDSVVQEKNLAQ 414

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D   +  +V  +I  NP  V +    K  ++ +FVGQ+MK T G ANP +  ++ + +
Sbjct: 415 VSDEGELTAMVQRIIADNPAQVEQYKAGKGKVMGFFVGQLMKQTQGTANPQLANELFRRE 474

Query: 496 LG 497
           L 
Sbjct: 475 LD 476


>gi|83748650|ref|ZP_00945668.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ralstonia solanacearum UW551]
 gi|207741933|ref|YP_002258325.1| aspartyl/glutamyl-trna(asn/gln) amidotransferase subunit b
           (asp/glu-adt subunit b) protein [Ralstonia solanacearum
           IPO1609]
 gi|83724694|gb|EAP71854.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ralstonia solanacearum UW551]
 gi|206593319|emb|CAQ60246.1| aspartyl/glutamyl-trna(asn/gln) amidotransferase subunit b
           (asp/glu-adt subunit b) protein [Ralstonia solanacearum
           IPO1609]
          Length = 488

 Score =  568 bits (1463), Expect = e-159,   Method: Composition-based stats.
 Identities = 241/487 (49%), Positives = 326/487 (66%), Gaps = 8/487 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E HAQLS  SK+FSGAS  FGA PNTQ +  D A+PG+LP+LN   V++A+
Sbjct: 1   MQWEVVIGLETHAQLSTASKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +           
Sbjct: 61  RFGLAIGATIAPKSIFARKNYFYPDLPKGYQISQYEIPVVQGGTLTIQVEGKSGQPGYEK 120

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L +
Sbjct: 121 TVHLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSATEAVAYAKALHA 180

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV   P    GTRCE+KN+NS RFL  AI YE RRQI
Sbjct: 181 LVVWLGICDGNMQEGSFRCDANVSVRPGPDAPLGTRCEIKNLNSFRFLEEAINYEVRRQI 240

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPL I  D++ A++  +
Sbjct: 241 ELIEDGGTVVQETRLYDPDRKETRSMRSKEDAHDYRYFPDPDLLPLVIGADWVDAVRATL 300

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A   RF   +G+  YDAS+L + K+ A YFE     A   + K  ANW++ ++  
Sbjct: 301 PELPAAMAVRFESAYGLPKYDASILTATKATAAYFEAVVAAAGAANAKAAANWIMGEVAS 360

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEEL 432
            LNR+G  I+  P+SP QL +L+  I DGTIS   A KD+F  +W  E GG    I+ E 
Sbjct: 361 NLNRAGLEIDAAPVSPAQLAKLLARIADGTISNNTAKKDVFPAMWAGEHGGDADTIIAEK 420

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q++D   +EK++D+V+ +N  +V      K    +  VGQ MK T GKANP+ V ++
Sbjct: 421 GLKQMSDSGELEKIIDDVLAANAKSVEEYRAGKEKAFNALVGQAMKATRGKANPAQVNEL 480

Query: 492 LKEKLGI 498
           LK+KL  
Sbjct: 481 LKKKLDA 487


>gi|220906860|ref|YP_002482171.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Cyanothece sp.
           PCC 7425]
 gi|219863471|gb|ACL43810.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Cyanothece sp. PCC
           7425]
          Length = 496

 Score =  568 bits (1463), Expect = e-159,   Method: Composition-based stats.
 Identities = 225/486 (46%), Positives = 306/486 (62%), Gaps = 9/486 (1%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
              +E +IG+E H QL   +K+F   S  FGAEPN  V      MPG+LP+LN   ++ A
Sbjct: 10  KTQYEAIIGLETHCQLKTATKIFCNCSTEFGAEPNHHVCPICMGMPGVLPVLNQTVLEYA 69

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           V  GL LN  I  YS F RK YFYPDLP+ YQISQ+D PI   G + + +     G+   
Sbjct: 70  VKAGLALNCQIADYSKFDRKQYFYPDLPKNYQISQYDLPIAEHGWLEIELVDA-QGEPVR 128

Query: 139 IEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
            ++GI R+H+E+DAGK +H        S  S  D NR+GV L EIV++PD+RS +EA  +
Sbjct: 129 KKIGITRLHMEEDAGKLVHGGSERLSGSTFSLADYNRAGVPLCEIVSEPDLRSGVEAAEY 188

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEY 252
             +LR ILRYL  CDGNM+EGS+R DVNVSV     + +GT+ E+KN+NS   +  AI+Y
Sbjct: 189 AQELRRILRYLEVCDGNMQEGSLRCDVNVSVRPVGSDKFGTKVEIKNMNSFNAIQRAIDY 248

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           E  RQIA LE GG I QETRL+D +  +T S+R KE + DYRYF EPDL P+E+ E+ + 
Sbjct: 249 EIERQIAQLEAGGRIVQETRLWDEASQQTISMRVKEGSSDYRYFPEPDLTPIEVSEEQLD 308

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVIN 371
             + Q+PELP  KR R+  E G+S YDA VL  D+ +A YFE       + K  ANW++ 
Sbjct: 309 QWQLQLPELPAQKRHRYESELGLSAYDARVLTDDRPVALYFEATVAQGANPKQAANWIMG 368

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D+   L     +I D P+SP  L ELI LI  GTIS KIAKD+   L  +GG+PK +VE+
Sbjct: 369 DITAYLKTEKLAITDLPLSPTGLAELIGLIEAGTISSKIAKDLLPELLAEGGSPKALVEQ 428

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL Q++D SA+  ++D+V+  +P  +A+    K  L  +FVGQ+MK +GG+A+P +  +
Sbjct: 429 KGLTQISDSSALAGLIDQVLQDHPQELAQYRAGKTKLQGFFVGQIMKRSGGRADPKLTNQ 488

Query: 491 MLKEKL 496
           +L EKL
Sbjct: 489 LLAEKL 494


>gi|307266286|ref|ZP_07547826.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|306918664|gb|EFN48898.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermoanaerobacter
           wiegelii Rt8.B1]
          Length = 475

 Score =  567 bits (1462), Expect = e-159,   Method: Composition-based stats.
 Identities = 217/480 (45%), Positives = 310/480 (64%), Gaps = 10/480 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             +E VIG+EVHA+L   SK+F   +  FG EPNT V      +PG LP+LN + V+ AV
Sbjct: 1   MKYEAVIGLEVHAELLTESKIFCSCTTKFGGEPNTHVCPVCLGLPGTLPVLNKKVVEYAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  I  +S   RKNYFYPDLP+ YQISQ+D P+   G V + +         T 
Sbjct: 61  RAGLALNCTIANFSKMDRKNYFYPDLPKAYQISQYDLPLCSNGYVEIEVDGQ------TK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           ++GI+RIH+E+DAGK +H+     S +D NR+GV L+EIV++PDM +  EA  +LTKL+S
Sbjct: 115 KIGIKRIHIEEDAGKLLHENTDG-SLVDYNRAGVPLIEIVSEPDMSTPEEAYQYLTKLKS 173

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL Y    D  M+EGS+R D NVSV        GT+ E+KN+NS + +  A+EYE +RQI
Sbjct: 174 ILEYTEVSDCKMQEGSLRVDTNVSVRPVGSTELGTKIELKNLNSFKAVQKALEYEIKRQI 233

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE+GG I QETR ++ SK  T  +RTKE+A DYRYF EPDL+P+ + +++   I+K +
Sbjct: 234 KVLEEGGTIVQETRRWNESKGITEPMRTKEEAHDYRYFPEPDLVPIIVTDEWKEEIRKSL 293

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVL 377
           PE+P  KRERFI E+G+  YDA ++ S K +AD+FEK A      K V+NW++ +   ++
Sbjct: 294 PEMPHHKRERFIAEYGLPEYDAKIITSSKKMADFFEKCALEYDSPKTVSNWLMGEFSRLM 353

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N +GK I++ P++P  L +L+ LI +G ISG IAK +F  ++  G  P+ IVEE GL+Q+
Sbjct: 354 NETGKEIDEVPVTPQMLVKLLKLIDNGVISGSIAKTVFEEMFGTGKEPEVIVEEKGLKQI 413

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
            +   + +++ +VI  NP +V      K   + + VGQVMK T GKANP +  ++LKE+L
Sbjct: 414 ANEDELREIIKKVIAENPKSVEDYKNGKEKAMGFLVGQVMKATKGKANPQLTNQILKEEL 473


>gi|308273720|emb|CBX30322.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [uncultured Desulfobacterium sp.]
          Length = 477

 Score =  567 bits (1462), Expect = e-159,   Method: Composition-based stats.
 Identities = 241/480 (50%), Positives = 325/480 (67%), Gaps = 9/480 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVHAQL   +K+F     +FGA PNT        MPG+LP+LN + V+ A+
Sbjct: 1   MEFEPVIGLEVHAQLKTNTKIFCSCPASFGAPPNTHTCPVCLGMPGVLPVLNKKVVEYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           + G+     I+K+S FARKNYFYPDLP+GYQISQ++ PI   G + V +   K       
Sbjct: 61  LMGIATKCTISKFSRFARKNYFYPDLPKGYQISQYELPICENGYIDVDVNGLK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI RIH+E+DAGK IHD     S +D NR+GV L+EIV++PD+RSS EA A+L K+RS
Sbjct: 115 RIGITRIHMEEDAGKLIHDPSRPFSMVDFNRTGVPLIEIVSEPDIRSSEEAVAYLRKIRS 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ILRYL  CDGNMEEGS R D N+S+     E +GTR E+KN+NS + +  AI YE  RQ 
Sbjct: 175 ILRYLDICDGNMEEGSFRCDANISIRSKGSEPFGTRTELKNLNSFKNVEKAILYEIERQK 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            I+ DG  + QETRL+DP KN T S+R KEDA DYRYF +PDLLPL ID+ +I  +KK++
Sbjct: 235 DIVFDGEEVIQETRLWDPEKNNTVSMRGKEDAHDYRYFPDPDLLPLSIDDSWIAKLKKEL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVL 377
           PELPD K+ERF+ E+G+  YDA VL     +A YFE  A   ++ K V+NW++  LLG+L
Sbjct: 295 PELPDEKKERFVSEYGLPEYDADVLTGAVELAGYFEACAKEFQNPKQVSNWIMGSLLGLL 354

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N  GK+IE +PI+P+ L EL+ LI    ISGKIAK +F  + + G  P+EI++E  L QV
Sbjct: 355 NAEGKTIEQSPITPSNLAELLKLIDQNIISGKIAKTVFEEMAKSGKPPQEIIKEKDLVQV 414

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           TD + +E +  ++I+S P  VA     K  ++ +FVG++MK T GKANP IV ++LK+KL
Sbjct: 415 TDEALLEDIAVKLISSCPKEVAEYKAGKTKVIGFFVGKIMKETKGKANPEIVNRILKDKL 474


>gi|167039200|ref|YP_001662185.1| aspartyl/glutamyl-tRNA amidotransferase subunit B
           [Thermoanaerobacter sp. X514]
 gi|256752854|ref|ZP_05493693.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|300913205|ref|ZP_07130522.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermoanaerobacter
           sp. X561]
 gi|307723781|ref|YP_003903532.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Thermoanaerobacter
           sp. X513]
 gi|229487448|sp|B0K3S4|GATB_THEPX RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|166853440|gb|ABY91849.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermoanaerobacter
           sp. X514]
 gi|256748256|gb|EEU61321.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|300889890|gb|EFK85035.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermoanaerobacter
           sp. X561]
 gi|307580842|gb|ADN54241.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermoanaerobacter
           sp. X513]
          Length = 475

 Score =  567 bits (1462), Expect = e-159,   Method: Composition-based stats.
 Identities = 218/480 (45%), Positives = 311/480 (64%), Gaps = 10/480 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             +E VIG+EVHA+L   SK+F G +  FG EPNT V      +PG LP+LN + V+ AV
Sbjct: 1   MKYEAVIGLEVHAELLTESKIFCGCTTKFGGEPNTHVCPVCLGLPGTLPVLNKKVVEYAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  I  +S   RKNYFYPDLP+ YQISQ+D P+   G V + +        +  
Sbjct: 61  RAGLALNCTIANFSKMDRKNYFYPDLPKAYQISQYDLPLCSNGYVEIEVDG------KVK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           ++GI+RIH+E+DAGK +H+     S +D NR+GV L+EIV++PDM +  EA  +LTKL+S
Sbjct: 115 KIGIKRIHIEEDAGKLLHENTDG-SLVDYNRAGVPLIEIVSEPDMSTPEEAYQYLTKLKS 173

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL Y    D  M+EGS+R D NVSV        GT+ E+KN+NS R +  A+EYE +RQI
Sbjct: 174 ILEYTEVSDCKMQEGSLRVDTNVSVRPVGSTELGTKIELKNLNSFRAVQKALEYEIKRQI 233

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE+GG I QETR ++ +K  T  +RTKE+A DYRYF EPDL+P+ + +++   I+K +
Sbjct: 234 KVLEEGGTIVQETRRWNEAKGITEPMRTKEEAHDYRYFPEPDLVPIIVTDEWKEEIRKSL 293

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVL 377
           PE+P  KRERFI E+G+  YDA ++ S K IAD+FEK A      K V+NW++ +   ++
Sbjct: 294 PEMPHRKRERFISEYGLPEYDAKIITSSKKIADFFEKCALEYDSPKAVSNWLMGEFSRLM 353

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N +GK I++ P++P  L +L+ LI +G ISG IAK +F  ++  G  P+ IVEE GL+Q+
Sbjct: 354 NETGKEIDEVPVTPQMLVKLLKLIDNGVISGSIAKTVFEEMFGTGKEPEVIVEEKGLKQI 413

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
            +   + +++ +VI  NP +V      K   + + VGQVMK T GKANP +  ++LKE+L
Sbjct: 414 ANEDELREIIKKVIAENPKSVEDYKNGKEKAMGFLVGQVMKATKGKANPQLTNQILKEEL 473


>gi|99080542|ref|YP_612696.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ruegeria sp.
           TM1040]
 gi|122398285|sp|Q1GIT2|GATB_SILST RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|99036822|gb|ABF63434.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ruegeria sp. TM1040]
          Length = 502

 Score =  567 bits (1462), Expect = e-159,   Method: Composition-based stats.
 Identities = 295/508 (58%), Positives = 372/508 (73%), Gaps = 17/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+      + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDL-TYELPKPKVIAGAKHDWELVIGMEVHAQVSSNAKLFSGASTQFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPVINEYCVEQAVRTGLGLKADINLWSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +       V IERIH+EQDAGKSIHD   ++S +DLNR+GV LMEIV+
Sbjct: 120 EGEVLVELGDGTA-----RMVRIERIHMEQDAGKSIHDMDPSMSFVDLNRTGVCLMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GE 229
           +PD+R   EA A++ KLR I+RYLGTCDGNM+ G++RADVNVS+CRP             
Sbjct: 175 RPDIRGPEEAAAYIAKLRQIMRYLGTCDGNMQNGNLRADVNVSICRPGAYEKYQETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIE EARRQIAI+E GG + QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIEVEARRQIAIVEAGGEVEQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  IK ++PELPD K+ RFI +FG++ YDASVL +D   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIKSKLPELPDEKKARFIKDFGLTDYDASVLTADLES 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YF+ +A  R  K+ ANWVIN+L G L +  K I D+P+SP QLG +IDLI    ISGK
Sbjct: 355 AHYFDAVAKGRSGKLAANWVINELFGRLKKDDKDITDSPVSPAQLGGVIDLIASDAISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F I++ +GG P +IVEE G++QVTD  AIE  +DE+I +NP  V +    P L  
Sbjct: 415 IAKDLFEIVYTEGGDPAQIVEERGMKQVTDTGAIEAALDEIIAANPAQVEKAKENPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           WFVGQVMK TGGKANP  V +++ +KLG
Sbjct: 475 WFVGQVMKATGGKANPKAVNQLVAKKLG 502


>gi|292493277|ref|YP_003528716.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Nitrosococcus
           halophilus Nc4]
 gi|291581872|gb|ADE16329.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Nitrosococcus
           halophilus Nc4]
          Length = 479

 Score =  567 bits (1462), Expect = e-159,   Method: Composition-based stats.
 Identities = 248/481 (51%), Positives = 346/481 (71%), Gaps = 9/481 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+E+HAQL+  SK+FSGA+  +GA PNTQ    D  +PG+LP+LN   V+ AV
Sbjct: 1   MQWEPVIGLEIHAQLATKSKIFSGAATAYGAPPNTQACAIDLGLPGVLPVLNETAVRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I + S+FARKNYFYPDLP+GYQISQ++ P+V  G   + +      +    
Sbjct: 61  KFGLAIGAKITERSIFARKNYFYPDLPKGYQISQYELPVVANGHTIIELE-----EGVEK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + I R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV+ PD+RS+ EA A++ K+ +
Sbjct: 116 HITIIRAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSGPDLRSTKEAVAYMKKIHT 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYLG CDGNM+EGS R D NVS+   G+  +GTR E+KN+NS RF+  A++YE  RQI
Sbjct: 176 LVRYLGICDGNMQEGSFRCDANVSIRPQGQEAFGTRTELKNINSFRFVERALQYEIERQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE GG + QETRLFDP+KNETR +RTKE+A DYRYF +PDLLPL +D+ FI  ++K +
Sbjct: 236 EVLESGGRVIQETRLFDPNKNETRPMRTKEEATDYRYFPDPDLLPLVLDDSFIEEVQKTL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK--LAVNRDKKIVANWVINDLLGV 376
           PELPD KR+RF+ E+ +S YDASVL + + +ADY+E        + K+ ANWV+ DL G 
Sbjct: 296 PELPDDKRKRFMAEYNLSAYDASVLTTSRELADYYEAVVKTAGGEAKLCANWVMGDLAGA 355

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN+ GK+IE++P++P QLG+LI  ++D TISGKIAK +F  ++ +GG   EI+E  GL+Q
Sbjct: 356 LNKEGKNIENSPVTPEQLGQLIKRVVDKTISGKIAKTVFETMYTQGGNADEIIERQGLKQ 415

Query: 437 VTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           VTD ++IEK++DEV+ ++P  + +  A K  L  +FVGQVMK + GKANP  V ++LK+K
Sbjct: 416 VTDTASIEKLIDEVLATHPQQLEQYQAGKNKLFGFFVGQVMKASKGKANPEQVNELLKKK 475

Query: 496 L 496
           L
Sbjct: 476 L 476


>gi|207727542|ref|YP_002255936.1| aspartyl/glutamyl-trna(asn/gln) amidotransferase subunit b
           (asp/glu-adt subunit b) protein [Ralstonia solanacearum
           MolK2]
 gi|206590779|emb|CAQ56391.1| aspartyl/glutamyl-trna(asn/gln) amidotransferase subunit b
           (asp/glu-adt subunit b) protein [Ralstonia solanacearum
           MolK2]
          Length = 488

 Score =  567 bits (1462), Expect = e-159,   Method: Composition-based stats.
 Identities = 241/487 (49%), Positives = 327/487 (67%), Gaps = 8/487 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E HAQLS  SK+FSGAS  FGA PNTQ +  D A+PG+LP+LN   V++A+
Sbjct: 1   MQWEVVIGLETHAQLSTASKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +           
Sbjct: 61  RFGLAIGATIAPKSIFARKNYFYPDLPKGYQISQYEIPVVQGGTLTIQVEGKSGQPGYEK 120

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L +
Sbjct: 121 TVHLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSATEAVAYAKALHA 180

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV   P   +GTRCE+KN+NS RFL  AI YE RRQI
Sbjct: 181 LVVWLGICDGNMQEGSFRCDANVSVRPGPDAPYGTRCEIKNLNSFRFLEEAINYEVRRQI 240

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPL I  D++ A++  +
Sbjct: 241 ELIEDGGTVVQETRLYDPDRKETRSMRSKEDAHDYRYFPDPDLLPLVIGADWVDAVRATL 300

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A   RF   +G+  YDAS+L + K+ A YFE     A   + K  ANW++ ++  
Sbjct: 301 PELPAAMAVRFESAYGLPKYDASILTATKATAAYFEAVVAAAGAANAKAAANWIMGEVAS 360

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEEL 432
            LNR+G  I+  P+SP QL +L+  I DGTIS   A KD+F  +W  E GG    I+ E 
Sbjct: 361 NLNRAGLEIDAAPVSPAQLAKLLARIADGTISNNTAKKDVFPAMWAGEHGGDADTIIAEK 420

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q++D   +EK++D+V+ +N  +V      K    +  VGQ MK T GKANP+ V ++
Sbjct: 421 GLKQMSDSGELEKIIDDVLAANAKSVEEYRAGKEKAFNALVGQAMKATRGKANPAQVNEL 480

Query: 492 LKEKLGI 498
           LK+KL  
Sbjct: 481 LKKKLDA 487


>gi|304570811|ref|YP_002517891.2| aspartyl/glutamyl-tRNA amidotransferase subunit B [Caulobacter
           crescentus NA1000]
          Length = 503

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 291/505 (57%), Positives = 371/505 (73%), Gaps = 16/505 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           + +  +  +  G TGDWE+V+G+EVHAQ++  SKLFSGA+V FGA PN QVS  DAAMPG
Sbjct: 4   SAMNENTKVIKGRTGDWEMVLGLEVHAQVASKSKLFSGAAVGFGAGPNEQVSLVDAAMPG 63

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP+LN  CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ D+PIVGEG VS
Sbjct: 64  MLPVLNRFCVEQAVKTGLGLRAQINLKSRFDRKNYFYPDLPQGYQISQFDQPIVGEGVVS 123

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V           T +V IER+HLEQDAGKS+HDQ    + +DLNR+G ALMEIV+KPDMR
Sbjct: 124 VERDD-----GTTFDVRIERLHLEQDAGKSLHDQDPNATYVDLNRAGTALMEIVSKPDMR 178

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GEAWGTR 234
           +S EA A++ KLR+IL YLGTCDG+ME+G++RADVNVSVCRP            +  GTR
Sbjct: 179 TSEEAAAYVKKLRTILVYLGTCDGDMEKGNLRADVNVSVCRPGDYEKFRATGDFKHLGTR 238

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KNVNS R++  AIEYEARRQI ILEDGG + QETRLFDP+K ETRS+R+KE+A DYR
Sbjct: 239 CEIKNVNSYRYIQQAIEYEARRQIEILEDGGKVDQETRLFDPTKGETRSMRSKEEAHDYR 298

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPL +D  ++++I++ +PELPDAK+ R   ++G+S YDA VL+ D   ADYFE
Sbjct: 299 YFPDPDLLPLVLDPAWVKSIEETLPELPDAKKARLQSQYGLSAYDAGVLIIDADRADYFE 358

Query: 355 KLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDI 414
             A  RD K+VANWV N+LL  L+ +G    ++P+    + +L++LI +GTIS KIAK++
Sbjct: 359 AAAKGRDAKLVANWVTNELLAKLSAAGTEFTNSPLPHTDIAQLVELIENGTISSKIAKEV 418

Query: 415 FNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQ 474
           F  +W   G P EIVE+ GL Q+ D  AIEK +D++I  NP+    +  KP  + WFVGQ
Sbjct: 419 FEHMWAGEGRPAEIVEKRGLVQINDTGAIEKAIDDLIAGNPDKAEAVKDKPQALGWFVGQ 478

Query: 475 VMKNTGGKANPSIVQKMLKEKLGIK 499
           VMK TGGKANP  V ++L++KLG++
Sbjct: 479 VMKATGGKANPGTVNELLRKKLGVE 503


>gi|120608994|ref|YP_968672.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acidovorax citrulli AAC00-1]
 gi|120587458|gb|ABM30898.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acidovorax citrulli AAC00-1]
          Length = 484

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 230/490 (46%), Positives = 313/490 (63%), Gaps = 13/490 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
            +  L  G    +EVVIG E HAQL+  SK+FS A   FGAEPNTQ    D A+PG LP+
Sbjct: 2   TTSKLIHG----YEVVIGFETHAQLATQSKIFSRAPTAFGAEPNTQACAVDLALPGTLPV 57

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N   V  A+  GL L + +   S+FARKNYFYPDLP+GYQISQ + P+V  G+VS  +G
Sbjct: 58  MNREAVACAIRLGLALGSRVAPESIFARKNYFYPDLPKGYQISQFEIPVVQGGEVSFYLG 117

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
            +K        V + R HLE+DAGKS+H+ +   S IDLNR+G  L+EIVT+PD+RSS E
Sbjct: 118 DEK------KTVRLVRAHLEEDAGKSLHEDFIGQSGIDLNRAGTPLLEIVTEPDIRSSEE 171

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           A A+  +L  I+ ++G CDGNM+EGS R D NVSV RPG   GTR E+KN+NS RF+  A
Sbjct: 172 AVAYARELHKIVTWIGICDGNMQEGSFRCDANVSVRRPGAPLGTRREIKNLNSFRFMQQA 231

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           I+YE R QI  +EDG  I+Q T LFDP   ETR++RTKEDA DYRYF +PDL PL I E 
Sbjct: 232 IDYEIRWQIEQIEDGHAIQQATVLFDPDTGETRAMRTKEDAADYRYFPDPDLPPLRISEQ 291

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANW 368
           +++  + ++PELP     RF+ ++G+  YDA+ L   K++A YFE+    +   K+ +NW
Sbjct: 292 WVQEERARMPELPRTMAARFVADYGLPEYDATTLTQSKAMAAYFEEAARASGSPKLASNW 351

Query: 369 VINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG-TPKE 427
           ++ ++   +N     I   P++   L +LI  I DGTIS   A+ +F  LW   G     
Sbjct: 352 IMGEVSRRVNAGETDIAAAPVTAALLAKLIQRIADGTISNAAARQVFEALWTGEGTDVDA 411

Query: 428 IVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPS 486
           ++E  GL+Q+ D  A+EK++DEVI +NP+NVA+    K    +  VGQ MK + GKANP 
Sbjct: 412 VIETRGLKQMNDSGALEKIIDEVIAANPDNVAQFKAGKGKAFNALVGQAMKASKGKANPQ 471

Query: 487 IVQKMLKEKL 496
            V +ML+ +L
Sbjct: 472 QVNEMLRARL 481


>gi|146295944|ref|YP_001179715.1| glutamyl-tRNA(Gln) amidotransferase, B subunit
           [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|166217745|sp|A4XHY9|GATB_CALS8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|145409520|gb|ABP66524.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 480

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 231/483 (47%), Positives = 322/483 (66%), Gaps = 12/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++EVVIG+EVHA+L+  SK+F   +  FG EPNT        MPG+LP+LN + V+ A+
Sbjct: 1   MEYEVVIGLEVHAELATKSKIFCSCTTEFGGEPNTHCCPICTGMPGVLPVLNKKAVEYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           M GL  N  I +YS   RKNYFYPDLP+ YQISQ+D P+   G + + +   K       
Sbjct: 61  MAGLATNCQIARYSKQDRKNYFYPDLPKAYQISQYDLPLCYNGYIDIEVNGQK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI+RIH+E+DAGK +HDQ+   S +D NR GV L+EIVT+PD+RSS E + FL KL++
Sbjct: 115 RIGIKRIHIEEDAGKLLHDQWEEGSLVDFNRCGVPLIEIVTEPDLRSSEETRIFLEKLKA 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL+Y G  D  M+EGS+R DVN+SV     + +GTR E+KN+NS R +  AIEYEA+RQI
Sbjct: 175 ILQYTGVSDCKMQEGSLRVDVNLSVRPKGSKEFGTRTEMKNLNSFRSVVRAIEYEAKRQI 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE GG + QETR +D +K  T S+RTKE+A DYRYF EPDL P+ +D+++I  I+K+I
Sbjct: 235 EVLESGGVVVQETRRWDEAKGITLSMRTKEEAHDYRYFPEPDLPPIIVDDNWIEEIRKRI 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDLLGVL 377
           PELPD K+ER+I E+G+  YDA VL S  +IA+YFE+        K  +NW++ +++ +L
Sbjct: 295 PELPDQKKERYIKEYGLPEYDAGVLTSSNAIANYFEECIKYTQNIKAASNWMMGEIMRIL 354

Query: 378 NRSG---KSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
           N  G   + I +  I PNQL  LI+L+ + TIS  IAK +F  ++E G  P+ IV+E GL
Sbjct: 355 NDRGLEPEEIVNIKIRPNQLASLINLVDNKTISNTIAKQVFEEMFETGKDPEVIVKEKGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            Q+TD + I + V + I +NP +V      K     + VGQVMK T GKANP +V ++L+
Sbjct: 415 VQITDRNVILEAVKQAIANNPKSVEDYKNGKDKAFGFLVGQVMKITKGKANPQLVNEILR 474

Query: 494 EKL 496
           E+L
Sbjct: 475 EEL 477


>gi|332557418|ref|ZP_08411740.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacter
           sphaeroides WS8N]
 gi|332275130|gb|EGJ20445.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacter
           sphaeroides WS8N]
          Length = 503

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 297/509 (58%), Positives = 374/509 (73%), Gaps = 17/509 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+ A    + +G   DWE+VIG+E+HAQ+S  +KLFSGAS  FGAEPN+ VSF D
Sbjct: 1   MLDL-TYEAPKPKVIAGAKHDWELVIGMEIHAQVSSNAKLFSGASTTFGAEPNSNVSFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
            AMPGMLP++N  CV QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  CAMPGMLPVINEFCVAQAVRTGLGLKAQINLFSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V + P  +       V IERIHLEQDAGKSIHD    +S +D NR+GVALMEIV+
Sbjct: 120 EGEVLVELAPGIA-----RLVRIERIHLEQDAGKSIHDMDPNLSFVDFNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A++ KLR ILRYLGTCDGNM+ G++RADVNVSVCRPG+           
Sbjct: 175 RPDIRGPEEAAAYVAKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AI+YEARRQIAILEDGG + QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIDYEARRQIAILEDGGKVVQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPDAK+ RF+ ++G++ YDA+VL ++   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQGWVDDIAASMPELPDAKKARFMADYGVTDYDANVLTAELDA 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE++A  RD K  ANWVIN+L G LN+ G +I DTP+   QLG ++DLI  G ISGK
Sbjct: 355 AAYFEEVARGRDGKQAANWVINELFGRLNKQGLTIADTPVKAGQLGGVLDLIASGEISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           +AKD+F ILW +GG P E+    G++QVTD  AIE  VDE+I +NP  V +    P L  
Sbjct: 415 MAKDLFEILWTEGGDPAEVAAARGMKQVTDTGAIETAVDEIIAANPAQVEKAKANPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
           WFVGQV+K TGGKANP+ V +++ +KLG+
Sbjct: 475 WFVGQVIKATGGKANPAAVNQIVAQKLGL 503


>gi|16126675|ref|NP_421239.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Caulobacter
           crescentus CB15]
 gi|24418431|sp|Q9A5L1|GATB_CAUCR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|13423981|gb|AAK24407.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Caulobacter
           crescentus CB15]
 gi|220964627|gb|ACL95983.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Caulobacter crescentus NA1000]
          Length = 498

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 291/503 (57%), Positives = 370/503 (73%), Gaps = 16/503 (3%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
           +  +  +  G TGDWE+V+G+EVHAQ++  SKLFSGA+V FGA PN QVS  DAAMPGML
Sbjct: 1   MNENTKVIKGRTGDWEMVLGLEVHAQVASKSKLFSGAAVGFGAGPNEQVSLVDAAMPGML 60

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P+LN  CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ D+PIVGEG VSV 
Sbjct: 61  PVLNRFCVEQAVKTGLGLRAQINLKSRFDRKNYFYPDLPQGYQISQFDQPIVGEGVVSVE 120

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
                     T +V IER+HLEQDAGKS+HDQ    + +DLNR+G ALMEIV+KPDMR+S
Sbjct: 121 RDD-----GTTFDVRIERLHLEQDAGKSLHDQDPNATYVDLNRAGTALMEIVSKPDMRTS 175

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GEAWGTRCE 236
            EA A++ KLR+IL YLGTCDG+ME+G++RADVNVSVCRP            +  GTRCE
Sbjct: 176 EEAAAYVKKLRTILVYLGTCDGDMEKGNLRADVNVSVCRPGDYEKFRATGDFKHLGTRCE 235

Query: 237 VKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYF 296
           +KNVNS R++  AIEYEARRQI ILEDGG + QETRLFDP+K ETRS+R+KE+A DYRYF
Sbjct: 236 IKNVNSYRYIQQAIEYEARRQIEILEDGGKVDQETRLFDPTKGETRSMRSKEEAHDYRYF 295

Query: 297 SEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL 356
            +PDLLPL +D  ++++I++ +PELPDAK+ R   ++G+S YDA VL+ D   ADYFE  
Sbjct: 296 PDPDLLPLVLDPAWVKSIEETLPELPDAKKARLQSQYGLSAYDAGVLIIDADRADYFEAA 355

Query: 357 AVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFN 416
           A  RD K+VANWV N+LL  L+ +G    ++P+    + +L++LI +GTIS KIAK++F 
Sbjct: 356 AKGRDAKLVANWVTNELLAKLSAAGTEFTNSPLPHTDIAQLVELIENGTISSKIAKEVFE 415

Query: 417 ILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVM 476
            +W   G P EIVE+ GL Q+ D  AIEK +D++I  NP+    +  KP  + WFVGQVM
Sbjct: 416 HMWAGEGRPAEIVEKRGLVQINDTGAIEKAIDDLIAGNPDKAEAVKDKPQALGWFVGQVM 475

Query: 477 KNTGGKANPSIVQKMLKEKLGIK 499
           K TGGKANP  V ++L++KLG++
Sbjct: 476 KATGGKANPGTVNELLRKKLGVE 498


>gi|153209977|ref|ZP_01947550.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Coxiella burnetii 'MSU Goat Q177']
 gi|154706369|ref|YP_001423933.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Coxiella
           burnetii Dugway 5J108-111]
 gi|161830892|ref|YP_001597315.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Coxiella
           burnetii RSA 331]
 gi|165924156|ref|ZP_02219988.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Coxiella burnetii RSA 334]
 gi|212219199|ref|YP_002305986.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Coxiella
           burnetii CbuK_Q154]
 gi|189045276|sp|A9KBI1|GATB_COXBN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|189045277|sp|A9N8Z5|GATB_COXBR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|229486062|sp|B6J4H6|GATB_COXB1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|120575203|gb|EAX31827.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Coxiella burnetii 'MSU Goat Q177']
 gi|154355655|gb|ABS77117.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Coxiella burnetii Dugway 5J108-111]
 gi|161762759|gb|ABX78401.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Coxiella burnetii RSA 331]
 gi|165916395|gb|EDR34999.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Coxiella burnetii RSA 334]
 gi|212013461|gb|ACJ20841.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Coxiella burnetii CbuK_Q154]
          Length = 477

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 240/482 (49%), Positives = 320/482 (66%), Gaps = 10/482 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +WE VIG+EVH QL   SK+FSGA+  +GAEPNTQ    D  +PG+LP+LN   V+ AV
Sbjct: 1   MEWEPVIGLEVHVQLRTQSKIFSGAATAYGAEPNTQACAIDLGLPGVLPVLNKEAVKLAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL +NA I  YS+FARKNYFYPDLP+GYQISQ++ PIV  G + +           T 
Sbjct: 61  CFGLSVNASIPPYSIFARKNYFYPDLPKGYQISQYNFPIVQNGHLDIENED-----GTTK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS H+     S ID NR+G  L+EIV++PD+RS+ EA A+L  L S
Sbjct: 116 RIGITRAHLEEDAGKSFHEGMQGYSGIDFNRAGTPLLEIVSEPDIRSAQEAVAYLKALHS 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RY+G  D NM+EG+ R DVN+S+     E +GTR E+KNVNS RF+  AI +E  RQ 
Sbjct: 176 LVRYIGVSDANMQEGAFRCDVNISLRPKGEEKFGTRAEIKNVNSFRFVERAILFEINRQK 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ILE+GG I QETRL+D  ++ETRS+RTKE+A DYRYF +PDLLP+EI  +FI A+K Q+
Sbjct: 236 EILENGGTIVQETRLYDAVQDETRSMRTKEEAHDYRYFPDPDLLPVEIGPEFIEAVKNQL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK---LAVNRDKKIVANWVINDLLG 375
           PELP  KR+RF   + +S YD  +L +   IA+YFE    +      K+ ANW+  DL  
Sbjct: 296 PELPWEKRKRFAASYQLSNYDVKLLTTQIEIANYFETVLKIDKTIPPKLAANWINGDLAA 355

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            LN++  SI  +PI+  QL  L+  I D T+SG + K +F  +W   G    I+E  GL+
Sbjct: 356 ALNKNNLSITQSPINAEQLAGLLHRIADNTLSGSMGKQVFETMWGGEGDADTIIERHGLK 415

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q+TD  A+EK++DEVI +NP  V +    K  L+++FVGQVMK T GKANP  V ++ K+
Sbjct: 416 QITDTEALEKIIDEVIENNPTQVEQYRSGKDKLIAFFVGQVMKATKGKANPQQVNELFKK 475

Query: 495 KL 496
           KL
Sbjct: 476 KL 477


>gi|289577829|ref|YP_003476456.1| glutamyl-tRNA(Gln) amidotransferase subunit beta
           [Thermoanaerobacter italicus Ab9]
 gi|289527542|gb|ADD01894.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermoanaerobacter
           italicus Ab9]
          Length = 475

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 215/480 (44%), Positives = 310/480 (64%), Gaps = 10/480 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             +E VIG+EVHA+L   SK+F   +  FG EPNT V      +PG LP+LN + V+ AV
Sbjct: 1   MKYEAVIGLEVHAELLTESKIFCSCTTKFGGEPNTHVCPVCLGLPGTLPVLNKKVVEYAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  I  +S   RKNYFYPDLP+ YQISQ+D P+   G V + +        +  
Sbjct: 61  RAGLALNCTIANFSKMDRKNYFYPDLPKAYQISQYDLPLCSNGYVEIEVDG------KVK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           ++GI+RIH+E+DAGK +H+     S +D NR+GV L+EIV++PD+ +  EA  +LTKL+S
Sbjct: 115 KIGIKRIHIEEDAGKLLHENTDG-SLVDYNRAGVPLIEIVSEPDISTPEEAYQYLTKLKS 173

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL Y    D  M+EGS+R D NVSV        GT+ E+KN+NS R +  A+EYE +RQI
Sbjct: 174 ILEYTEVSDCKMQEGSLRVDTNVSVRPVGSTDLGTKIELKNLNSFRAVQKALEYEIKRQI 233

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE+GG I QETR ++ +K  T  +RTKE+A DYRYF EPDL+P+ + +++   I+K +
Sbjct: 234 KVLEEGGTIVQETRRWNEAKGITEPMRTKEEAHDYRYFPEPDLVPIIVTDEWKEEIRKSL 293

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVL 377
           PE+P  KRERFI E+G+  YDA ++ S K +AD+FEK A      K V+NW++ +   ++
Sbjct: 294 PEMPHRKRERFIAEYGLPEYDAKIITSSKKMADFFEKCALEYDSPKTVSNWLMGEFSRLM 353

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N +GK I++ P++P  L +L+ LI +G ISG IAK +F  ++  G  P+ IVEE GL+Q+
Sbjct: 354 NETGKEIDEVPVTPQMLVKLLKLIDNGVISGSIAKTVFEEMFGTGKEPEVIVEEKGLKQI 413

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
            +   + +++ +VI  NP +V      K   + + VGQVMK T GKANP +  ++LKE+L
Sbjct: 414 ANEDELREIIKKVIAENPKSVEDYKNGKEKAMGFLVGQVMKATKGKANPQLTNQILKEEL 473


>gi|29654766|ref|NP_820458.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Coxiella
           burnetii RSA 493]
 gi|47115764|sp|Q83BM8|GATB_COXBU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|29542034|gb|AAO90972.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Coxiella burnetii RSA 493]
          Length = 477

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 240/482 (49%), Positives = 320/482 (66%), Gaps = 10/482 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +WE VIG+EVH QL   SK+FSGA+  +GAEPNTQ    D  +PG+LP+LN   V+ AV
Sbjct: 1   MEWEPVIGLEVHVQLRTQSKIFSGAATAYGAEPNTQACAIDLGLPGVLPVLNKEAVKLAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL +NA I  YS+FARKNYFYPDLP+GYQISQ++ PIV  G + +           T 
Sbjct: 61  CFGLSVNASIPPYSIFARKNYFYPDLPKGYQISQYNFPIVQNGHLDIENED-----GTTK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS H+     S ID NR+G  L+EIV++PD+RS+ EA A+L  L S
Sbjct: 116 RIGITRAHLEEDAGKSFHEGMQGYSGIDFNRAGTPLLEIVSEPDIRSAQEAVAYLKALHS 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RY+G  D NM+EG+ R DVN+S+    E  +GTR E+KNVNS RF+  AI +E  RQ 
Sbjct: 176 LVRYIGVSDANMQEGAFRCDVNISLRPKSEEKFGTRAEIKNVNSFRFVERAILFEINRQK 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ILE+GG I QETRL+D  ++ETRS+RTKE+A DYRYF +PDLLP+EI  +FI A+K Q+
Sbjct: 236 EILENGGTIVQETRLYDAVQDETRSMRTKEEAHDYRYFPDPDLLPVEIGPEFIEAVKNQL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK---LAVNRDKKIVANWVINDLLG 375
           PELP  KR+RF   + +S YD  +L +   IA+YFE    +      K+ ANW+  DL  
Sbjct: 296 PELPWEKRKRFAASYQLSNYDVKLLTTQIEIANYFETVLKIDKTIPPKLAANWINGDLAA 355

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            LN++  SI  +PI+  QL  L+  I D T+SG + K +F  +W   G    I+E  GL+
Sbjct: 356 ALNKNNLSITQSPINAEQLAGLLHRIADNTLSGSMGKQVFETMWGGEGDADTIIERHGLK 415

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q+TD  A+EK++DEVI +NP  V +    K  L+++FVGQVMK T GKANP  V ++ K+
Sbjct: 416 QITDTEALEKIIDEVIENNPTQVEQYRSGKDKLIAFFVGQVMKATKGKANPQQVNELFKK 475

Query: 495 KL 496
           KL
Sbjct: 476 KL 477


>gi|167038086|ref|YP_001665664.1| aspartyl/glutamyl-tRNA amidotransferase subunit B
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|320116493|ref|YP_004186652.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
 gi|229487447|sp|B0KBN3|GATB_THEP3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|166856920|gb|ABY95328.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319929584|gb|ADV80269.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
          Length = 475

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 217/480 (45%), Positives = 310/480 (64%), Gaps = 10/480 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             +E VIG+EVHA+L   SK+F   +  FG EPNT V      +PG LP+LN + V+ AV
Sbjct: 1   MKYEAVIGLEVHAELLTESKIFCSCTTKFGGEPNTHVCPVCLGLPGTLPVLNKKVVEYAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  I  +S   RKNYFYPDLP+ YQISQ+D P+   G V + +        +  
Sbjct: 61  RAGLALNCTIANFSKMDRKNYFYPDLPKAYQISQYDLPLCSNGYVEIEVDG------KVK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           ++GI+RIH+E+DAGK +H+     S +D NR+GV L+EIV++PDM +  EA  +LTKL+S
Sbjct: 115 KIGIKRIHIEEDAGKLLHENTDG-SLVDYNRAGVPLIEIVSEPDMSTPEEAYQYLTKLKS 173

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL Y    D  M+EGS+R D NVSV        GT+ E+KN+NS R +  A+EYE +RQI
Sbjct: 174 ILEYTEVSDCKMQEGSLRVDTNVSVRPVGSTELGTKIELKNLNSFRAVQKALEYEIKRQI 233

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE+GG I QETR ++ +K  T  +RTKE+A DYRYF EPDL+P+ + +++   I+K +
Sbjct: 234 KVLEEGGTIVQETRRWNEAKGITEPMRTKEEAHDYRYFPEPDLVPIIVTDEWKEEIRKSL 293

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVL 377
           PE+P  KRERFI E+G+  YDA ++ S K IAD+FEK A      K V+NW++ +   ++
Sbjct: 294 PEMPHRKRERFISEYGLPEYDAKIITSSKKIADFFEKCALEYDSPKAVSNWLMGEFSRLM 353

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N +GK I++ P++P  L +L+ LI +G ISG IAK +F  ++  G  P+ IVEE GL+Q+
Sbjct: 354 NETGKEIDEVPVTPQMLVKLLKLIDNGVISGSIAKTVFEEMFGTGKEPEVIVEEKGLKQI 413

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
            +   + +++ +VI  NP +V      K   + + VGQVMK T GKANP +  ++LKE+L
Sbjct: 414 ANEDELREIIKKVIAENPKSVEDYKNGKEKAMGFLVGQVMKATKGKANPQLTNQILKEEL 473


>gi|171321050|ref|ZP_02910034.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           ambifaria MEX-5]
 gi|171093685|gb|EDT38833.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           ambifaria MEX-5]
          Length = 496

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 241/492 (48%), Positives = 336/492 (68%), Gaps = 16/492 (3%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGA   FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGAPTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++    Q    
Sbjct: 65  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQAYEK 124

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 125 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKSLHA 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQI 244

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I +D+I  ++  +
Sbjct: 245 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGQDWIERVQAGM 304

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV--------NRDKKIVANWVI 370
           PELP A ++RF+ ++G+S YDA VL S K++A YFE +            + KI ANW++
Sbjct: 305 PELPAAMQQRFVEQYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAATADGANAKIAANWLM 364

Query: 371 NDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT----PK 426
            D+   LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF+ +W++  T      
Sbjct: 365 GDVSSQLNRDGIEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFSAIWDEKATDEAAAD 424

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANP 485
            I++  GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP
Sbjct: 425 RIIDAKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANP 484

Query: 486 SIVQKMLKEKLG 497
             V ++LK+KLG
Sbjct: 485 QQVNELLKKKLG 496


>gi|212212161|ref|YP_002303097.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Coxiella
           burnetii CbuG_Q212]
 gi|229486063|sp|B6IZ24|GATB_COXB2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|212010571|gb|ACJ17952.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Coxiella burnetii CbuG_Q212]
          Length = 477

 Score =  566 bits (1460), Expect = e-159,   Method: Composition-based stats.
 Identities = 240/482 (49%), Positives = 320/482 (66%), Gaps = 10/482 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +WE VIG+EVH QL   SK+FSGA+  +GAEPNTQ    D  +PG+LP+LN   V+ AV
Sbjct: 1   MEWEPVIGLEVHVQLRTQSKIFSGAATAYGAEPNTQACAIDLGLPGVLPVLNKEAVKLAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL +NA I  YS+FARKNYFYPDLP+GYQISQ++ PIV  G + +           T 
Sbjct: 61  CFGLSVNASIPPYSIFARKNYFYPDLPKGYQISQYNFPIVQNGHLDIENED-----GTTK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS H+     S ID NR+G  L+EIV++PD+RS+ EA A+L  L S
Sbjct: 116 RIGITRAHLEEDAGKSFHEGMQGYSGIDFNRAGTPLLEIVSEPDIRSAQEAVAYLKALHS 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RY+G  D NM+EG+ R DVN+S+     E +GTR E+KNVNS RF+  AI +E  RQ 
Sbjct: 176 LVRYIGVSDANMQEGAFRCDVNISLRPKGEEKFGTRAEIKNVNSFRFVERAILFEINRQK 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ILE+GG I QETRL+D  ++ETRS+RTKE+A DYRYF +PDLLP+EI  +FI A+K Q+
Sbjct: 236 EILENGGTIVQETRLYDAVQDETRSMRTKEEAHDYRYFPDPDLLPVEIGPEFIEAVKNQL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK---LAVNRDKKIVANWVINDLLG 375
           PELP  KR+RF   + +S YD  +L +   IA+YFE    +      K+ ANW+  DL  
Sbjct: 296 PELPWEKRKRFAASYQLSNYDVKLLTTQIEIANYFETVLKIDKTIPPKLAANWINGDLAA 355

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            LN++  SI  +PI+  QL  L+  I D T+SG + K +F  +W   G    I+E  GL+
Sbjct: 356 ALNKNNLSITQSPINAEQLASLLHRIADNTLSGSMGKQVFETMWGGEGDADTIIERHGLK 415

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q+TD  A+EK++DEVI +NP  V +    K  L+++FVGQVMK T GKANP  V ++ K+
Sbjct: 416 QITDTEALEKIIDEVIENNPTQVEQYRSGKDKLIAFFVGQVMKATKGKANPQQVNELFKK 475

Query: 495 KL 496
           KL
Sbjct: 476 KL 477


>gi|159043756|ref|YP_001532550.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Dinoroseobacter
           shibae DFL 12]
 gi|189045278|sp|A8LI95|GATB_DINSH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|157911516|gb|ABV92949.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Dinoroseobacter
           shibae DFL 12]
          Length = 505

 Score =  566 bits (1460), Expect = e-159,   Method: Composition-based stats.
 Identities = 298/508 (58%), Positives = 367/508 (72%), Gaps = 18/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+      + +G   DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDL-TYETPKPKVIAGAREDWELVIGLEVHAQVATNAKLFSGASTLFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           A MPGMLP++N  CV QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AGMPGMLPVINEECVAQAVRTGLGLKAAINLTSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +       V IERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV+
Sbjct: 120 EGEVLVELGDGTA-----RVVRIERIHLEQDAGKSIHDMDPHMSFVDLNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GE 229
           +PD+R   EA A+++KLR I+RYLGTCDGNM+ G++RADVNVSVCRP             
Sbjct: 175 RPDIRGPEEAAAYVSKLRQIMRYLGTCDGNMQNGNLRADVNVSVCRPGDYEKYQASQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIEYEARRQIAI+EDGG + QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSLRFIQQAIEYEARRQIAIIEDGGSVTQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPDAK+ RFI EFG+S YDASVL +D + 
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAAALPELPDAKKARFITEFGLSDYDASVLTADTTN 354

Query: 350 ADYFEKLAVNR-DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISG 408
           A YFE +A    D K+ ANWVIN+L G L +    I ++P+SP QL  +I LI    ISG
Sbjct: 355 AAYFEAVAGEAGDGKLAANWVINELFGRLKKEDHDITESPVSPAQLAGIIKLIKADAISG 414

Query: 409 KIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLV 468
           KIAKD+F I++ +GG P EIVE  G++QVTD  AIE  VDE+I +NP  VA+    P L 
Sbjct: 415 KIAKDLFEIVYTEGGDPAEIVEARGMKQVTDTGAIEAAVDEIIAANPAQVAKAQENPKLA 474

Query: 469 SWFVGQVMKNTGGKANPSIVQKMLKEKL 496
            WFVGQVMK TGGKANP  V +++  KL
Sbjct: 475 GWFVGQVMKATGGKANPKAVNQIVAAKL 502


>gi|56697685|ref|YP_168055.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ruegeria
           pomeroyi DSS-3]
 gi|81558383|sp|Q5LPK1|GATB_SILPO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|56679422|gb|AAV96088.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Ruegeria pomeroyi
           DSS-3]
          Length = 503

 Score =  566 bits (1460), Expect = e-159,   Method: Composition-based stats.
 Identities = 297/508 (58%), Positives = 369/508 (72%), Gaps = 17/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T         +G   DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ VSF D
Sbjct: 1   MLDL-TFETPKPKTIAGAKHDWELVIGMEVHAQVASQAKLFSGASTAFGAEPNSNVSFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPVINEFCVEQAVRTGLGLKAEINLKSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +       V IERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV+
Sbjct: 120 EGEVLVEMGDGTA-----RRVRIERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GE 229
           +PD+R   EA A++ KLR ILRYLGTCDGNM+ G++RADVNVS+CRP             
Sbjct: 175 RPDIRGPEEAAAYIAKLRQILRYLGTCDGNMQNGNLRADVNVSICRPGAYEKYQETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIEYEARRQIAI+E GG + QETRL+DP KNETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQAAIEYEARRQIAIVEAGGEVDQETRLYDPDKNETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPD K+ RFI EFG++ YDASVL ++   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAASLPELPDDKKARFIKEFGLTDYDASVLTAEVES 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE++A  R+ K+ ANWVIN+L G L +    I D+P+SP+QLG +IDLI    ISGK
Sbjct: 355 ARYFEEVAQGRNGKLAANWVINELFGRLKKEDHDITDSPVSPSQLGGIIDLIASDAISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F I++ +GG P EIVE  G++QVTD  AIE  +DE+I +NP  V +    P L  
Sbjct: 415 IAKDLFEIVYTEGGDPAEIVEARGMKQVTDTGAIEAALDEIIAANPAQVEKAKVNPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           WFVGQVMK TGGKANP +V +M+ +KL 
Sbjct: 475 WFVGQVMKATGGKANPGVVNQMVSKKLN 502


>gi|326390894|ref|ZP_08212445.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325993042|gb|EGD51483.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 475

 Score =  566 bits (1460), Expect = e-159,   Method: Composition-based stats.
 Identities = 216/480 (45%), Positives = 310/480 (64%), Gaps = 10/480 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             +E VIG+EVHA+L   SK+F   +  FG EPNT V      +PG LP+LN + V+ AV
Sbjct: 1   MKYEAVIGLEVHAELLTESKIFCSCTTKFGGEPNTHVCPVCLGLPGTLPVLNKKVVEYAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  I  +S   RKNYFYPDLP+ YQISQ+D P+   G V + +         T 
Sbjct: 61  RAGLALNCTIANFSKMDRKNYFYPDLPKAYQISQYDLPLCSNGYVEIEVDGQ------TK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           ++GI+RIH+E+DAGK +H+     S +D NR+GV L+EIV++PDM +  EA  +LTKL+S
Sbjct: 115 KIGIKRIHIEEDAGKLLHENTDG-SLVDYNRAGVPLIEIVSEPDMSTPEEAYQYLTKLKS 173

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL Y    D  M+EGS+R D NVSV        GT+ E+KN+NS + +  A+EYE +RQI
Sbjct: 174 ILEYTEVSDCKMQEGSLRVDTNVSVRPVGSTELGTKIELKNLNSFKAVQKALEYEIKRQI 233

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE+GG I QETR ++ SK  T  +RTKE+A DYRYF EPDL+P+ + +++   I+K +
Sbjct: 234 KVLEEGGTIVQETRRWNESKGITEPMRTKEEAHDYRYFPEPDLVPIIVTDEWKEEIRKSL 293

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVL 377
           PE+P  KRERFI E+G+  YDA ++ S K +AD+FEK        K V+NW++ +   ++
Sbjct: 294 PEMPHHKRERFIAEYGLPEYDAKIITSSKKMADFFEKCVLEYDSPKTVSNWLMGEFSRLM 353

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N +GK I++ P++P  L +L+ LI +G ISG IAK +F  ++  G  P+ IVEE GL+Q+
Sbjct: 354 NETGKEIDEVPVTPQMLVKLLKLIDNGVISGSIAKTVFEEMFGTGKEPEVIVEEKGLKQI 413

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
            + + + +++ +VI  NP +V      K   + + VGQVMK T GKANP +  ++LKE+L
Sbjct: 414 ANENELREIIKKVIAENPKSVEDYKNGKEKAMGFLVGQVMKATKGKANPQLTNQILKEEL 473


>gi|94268845|ref|ZP_01291299.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [delta
           proteobacterium MLMS-1]
 gi|93451445|gb|EAT02287.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [delta
           proteobacterium MLMS-1]
          Length = 477

 Score =  566 bits (1460), Expect = e-159,   Method: Composition-based stats.
 Identities = 217/482 (45%), Positives = 311/482 (64%), Gaps = 10/482 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVHAQL   SK+F G S  FG  PN+        MPG+LP+LN R V+ A+
Sbjct: 1   MEFETVIGLEVHAQLKTRSKIFCGCSTEFGRPPNSNTCPVCLGMPGVLPVLNRRVVEFAL 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              L  +  +N+ +VFARKNYFYPDLP+GYQISQ D PI   G++++ +         + 
Sbjct: 61  KLALATDCTVNRRNVFARKNYFYPDLPKGYQISQFDLPIAEHGRLTIDLEGA------SR 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI RIH+E+DAGK IHD+    S +DLNR+GV L+EIV++PD+RS  EA A+L KL +
Sbjct: 115 NIGITRIHMEEDAGKLIHDEREPKSYVDLNRTGVPLLEIVSEPDLRSPAEAAAYLRKLHA 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RYL  CDGNM+EGS R D N+S+     + +GTR E+KN+NS R +  A+EYE RRQ 
Sbjct: 175 IVRYLDICDGNMQEGSFRCDANISLRPVGQQEFGTRTELKNMNSFRNVQRALEYEERRQR 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +L DG  + Q T L+D  +  T ++R+KE+A DYRYF +PDL+P+EID+D++   ++Q+
Sbjct: 235 DLLLDGEEVVQATLLWDADRGVTMAMRSKEEAHDYRYFPDPDLVPVEIDDDWLATTRQQL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYF-EKLAVNRDKKIVANWVINDLLGVL 377
           PELP AK+ RFI E G+  YDA VL + + +ADYF + LA     K ++NW++ +L+  L
Sbjct: 295 PELPLAKKTRFINELGLPEYDAQVLTASRELADYFEQALAAYPVAKKLSNWIMTELMRSL 354

Query: 378 N-RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
               G  I   P++P QL  L+ +I +GTISGKIAK +F  +   G  P  +V+E  L Q
Sbjct: 355 KGEEGLDIAACPVTPAQLARLLAMIDEGTISGKIAKTVFEEMVGSGADPDSVVQEKNLAQ 414

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D   +  +V  +I  NP  V +    K  ++ +FVGQ+MK T G ANP +  ++ + +
Sbjct: 415 VSDEGELTAMVQRIIADNPAQVEQYKAGKGKVMGFFVGQLMKQTQGTANPQLANELFRRE 474

Query: 496 LG 497
           L 
Sbjct: 475 LD 476


>gi|148259881|ref|YP_001234008.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acidiphilium
           cryptum JF-5]
 gi|166217728|sp|A5FWV7|GATB_ACICJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|146401562|gb|ABQ30089.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acidiphilium cryptum JF-5]
          Length = 487

 Score =  566 bits (1460), Expect = e-159,   Method: Composition-based stats.
 Identities = 284/487 (58%), Positives = 365/487 (74%), Gaps = 6/487 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
             +  GTTG WE+VIG+EVHAQ+   SKLFSGA+  FGAEPN+QVSF DA  PGMLP++N
Sbjct: 2   SYVIEGTTGAWELVIGLEVHAQVISRSKLFSGAATAFGAEPNSQVSFVDAGFPGMLPVIN 61

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QAV TGLGL AHIN  S F RKNYFY DLPQGYQISQ++ PIVG G + + +   
Sbjct: 62  RECVAQAVRTGLGLAAHINLVSRFDRKNYFYADLPQGYQISQYEHPIVGAGAIEIELESG 121

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
           +     T  +GI R+HLEQDAGKS+HDQ+ + S IDLNRSGVALMEIV++PDMRS  EA 
Sbjct: 122 E-----TRTIGITRLHLEQDAGKSMHDQHPSKSLIDLNRSGVALMEIVSEPDMRSPEEAG 176

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A+L KLR+ILRYLGTCDGNM+EGSMRADVNVSV + GE + TRCE+KNVNSIRF+  AIE
Sbjct: 177 AYLRKLRTILRYLGTCDGNMDEGSMRADVNVSVRKHGEPFRTRCEIKNVNSIRFVMQAIE 236

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
            EA+RQI I E GG + QETRLF+P++  TRS+R+KEDA DYRYF EPDLLPL ++E+++
Sbjct: 237 AEAKRQIEIWEAGGTVDQETRLFEPARGVTRSMRSKEDAHDYRYFPEPDLLPLVLEEEWV 296

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
            ++K  +PELPDAKR R + +FG+S Y+AS+ V ++  AD+FE +A  RD K+VANW++ 
Sbjct: 297 ESLKATLPELPDAKRARLMRDFGLSRYEASIFVMEQVTADFFETVAAGRDAKLVANWMLG 356

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D    LNR+G SIE +P++  +LGEL+DLI D TI+GKIAK++  ++++ G     IVE 
Sbjct: 357 DFFAHLNRTGTSIETSPVTAARLGELLDLITDKTINGKIAKEVLELMFDTGDAAGAIVEA 416

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+QVTD  AI++ +D V+ +N + +A     K  L  +FVGQVMK   GK NP++V +
Sbjct: 417 RGLKQVTDTGAIDEAIDRVVAANADKLAEYKAGKDKLFGFFVGQVMKAMQGKGNPALVNE 476

Query: 491 MLKEKLG 497
            LK K+G
Sbjct: 477 ALKRKIG 483


>gi|170693995|ref|ZP_02885151.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           graminis C4D1M]
 gi|170141067|gb|EDT09239.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           graminis C4D1M]
          Length = 491

 Score =  566 bits (1460), Expect = e-159,   Method: Composition-based stats.
 Identities = 239/490 (48%), Positives = 333/490 (67%), Gaps = 11/490 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  WEVVIG+E HAQLS  SK+FSGA   FGA PNTQ    D A+PG LP++N   V++A
Sbjct: 2   TKQWEVVIGLETHAQLSTQSKIFSGAPTQFGAAPNTQACPVDLALPGTLPVMNRGAVERA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSG--QF 136
           +  GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G+V++ +  ++      
Sbjct: 62  IEFGLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQVTIQVPANEKAGTAA 121

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            T  V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   
Sbjct: 122 YTKVVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKT 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L +++ +LG CDGNM+EGS R D NVSV       +GTR E+KN+NS RFL  AI+YE R
Sbjct: 182 LHTLVTWLGICDGNMQEGSFRCDANVSVRPVGQAEFGTRAEIKNLNSFRFLEEAIQYEVR 241

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL ID  ++  +K
Sbjct: 242 RQIELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIDAAWVERVK 301

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVIND 372
           + +PELP+  ++RF+ ++G++ YDA+VL S K+ A YFE +       + K+ ANWV+ +
Sbjct: 302 RDMPELPETIQQRFVSQYGLTPYDANVLTSSKATAAYFEAVVEKLGAANAKVAANWVMGE 361

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT----PKEI 428
           +   LNR G  I   P+S  QL  L+  I DGTIS KIAK+IF  +WE+  T       I
Sbjct: 362 VSSQLNREGLDIAGCPVSSAQLTLLLQRIADGTISNKIAKEIFLAIWEEKATDEAAADRI 421

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSI 487
           +E  GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP+ 
Sbjct: 422 IEAKGLKQISDTGALEAIIDEVLAANQKSVEEFRAGKEKAFNALIGQAMKATKGKANPAQ 481

Query: 488 VQKMLKEKLG 497
           V ++LK+KLG
Sbjct: 482 VNELLKKKLG 491


>gi|94264364|ref|ZP_01288155.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [delta
           proteobacterium MLMS-1]
 gi|93455193|gb|EAT05409.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [delta
           proteobacterium MLMS-1]
          Length = 477

 Score =  566 bits (1460), Expect = e-159,   Method: Composition-based stats.
 Identities = 218/482 (45%), Positives = 310/482 (64%), Gaps = 10/482 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVHAQL   SK+F G S  FG  PN+        MPG+LP+LN R V+ A+
Sbjct: 1   MEFETVIGLEVHAQLKTRSKIFCGCSTEFGRPPNSNTCPVCLGMPGVLPVLNRRVVEFAL 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              L  +  +N+ +VFARKNYFYPDLP+GYQISQ D PI   G +++ +         + 
Sbjct: 61  KLALATDCTVNRRNVFARKNYFYPDLPKGYQISQFDLPIAEHGLLTIDLEGA------SR 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           ++GI RIH+E+DAGK IHD+    S +DLNR+GV L+EIV++PD+RS  EA A+L KL +
Sbjct: 115 DIGITRIHMEEDAGKLIHDEREPKSYVDLNRTGVPLLEIVSEPDLRSPAEAAAYLRKLHA 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RYL  CDGNM+EGS R D N+S+       +GTR E+KN+NS R +  A+EYE RRQ 
Sbjct: 175 IVRYLDICDGNMQEGSFRCDANISLRPVGQREFGTRTELKNMNSFRNVQRALEYEERRQR 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +L DG  + Q T L+D  +  T ++R+KE+A DYRYF +PDL+P+EID+D++   ++Q+
Sbjct: 235 DLLLDGEEVVQATLLWDADRGVTMAMRSKEEAHDYRYFPDPDLVPVEIDDDWLATTRQQL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVL 377
           PELP AK+ RFI E G+  YDA VL S + +ADYFE+  A     K ++NW++ +L+  L
Sbjct: 295 PELPLAKKTRFINELGLPEYDAQVLTSSRELADYFEQALAAYPAAKKLSNWIMTELMRSL 354

Query: 378 N-RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
               G  I   P++P QL  L+ +I +GTISGKIAK +F  +   G  P  +V+E  L Q
Sbjct: 355 KGEEGLDIAACPVTPAQLARLLAMIDEGTISGKIAKTVFEEMVGSGADPDSVVQEKNLAQ 414

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D   +  +V  +I  NP  V +    K  ++ +FVGQ+MK T G ANP +  ++ + +
Sbjct: 415 VSDEGELTAMVQRIIADNPAQVEQYKAGKGKVMGFFVGQLMKQTQGTANPQLANELFRRE 474

Query: 496 LG 497
           L 
Sbjct: 475 LD 476


>gi|315649450|ref|ZP_07902536.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Paenibacillus vortex V453]
 gi|315275138|gb|EFU38510.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Paenibacillus vortex V453]
          Length = 479

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 213/483 (44%), Positives = 302/483 (62%), Gaps = 9/483 (1%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
           +T  +E VIG+EVH +L   SK+F G S  FGA PNT         PG+LP+LN + V+ 
Sbjct: 2   STSKYETVIGLEVHVELHTNSKIFCGCSTAFGAPPNTHTCPICLGHPGVLPVLNRQAVEY 61

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           A+   + LN  I   S F RKNYFYPD P+ YQISQ+D+PI   G + + +        +
Sbjct: 62  AMKAAMALNCTIGDVSKFDRKNYFYPDSPKAYQISQYDQPIGLNGWIDIEVDG------K 115

Query: 138 TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
           T  +GI R+HLE+DAGK  H      S +D NR G  L+EIV++P++ +  EAKA+L K+
Sbjct: 116 TKRIGITRLHLEEDAGKLTHVDGGYASLVDFNRVGTPLVEIVSEPEISTPEEAKAYLEKM 175

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           R+I++Y    D  MEEGS+R D N+S+     +  GT+ E+KN+NS R +   +EYE  R
Sbjct: 176 RAIMQYCDVSDVKMEEGSLRCDANISLRPWGQKELGTKAELKNMNSFRGVQRGLEYEQFR 235

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q   L++GG I QETR +D ++ +T S+R KE A DYRYF +PDL+ + I E++  +++ 
Sbjct: 236 QAETLDEGGVIVQETRRWDEAQAKTFSMRGKEQAHDYRYFPDPDLVTVHISEEWKESVRA 295

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLG 375
            IPELPDA++ R+  E+G+  YDA+V+ S K +AD+FE      +D K V+NW++ DLLG
Sbjct: 296 TIPELPDARKARYASEYGLPDYDAAVITSSKLLADFFEDSLNYTKDAKSVSNWIMGDLLG 355

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            LN     + D  IS   LGE+I LI  GTIS KIAK +F  + E G  P  IVEE GL 
Sbjct: 356 YLNSGNLELSDVKISGQGLGEMIGLIEKGTISSKIAKTVFKEMLESGKLPAGIVEEKGLV 415

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q++D  AI+ +V++V+ +NP +V      K   + + VGQVMK + GKANP++  K+L E
Sbjct: 416 QISDEGAIKSIVEQVVANNPQSVEDYKAGKQKAIGFLVGQVMKESKGKANPALANKLLVE 475

Query: 495 KLG 497
            L 
Sbjct: 476 VLN 478


>gi|329928588|ref|ZP_08282455.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Paenibacillus sp. HGF5]
 gi|328937704|gb|EGG34113.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Paenibacillus sp. HGF5]
          Length = 479

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 212/483 (43%), Positives = 306/483 (63%), Gaps = 9/483 (1%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
           +T  +E VIG+EVH +L   SK+F G S  FGA PNT         PG+LP+LN + V+ 
Sbjct: 2   STSKYETVIGLEVHVELHTHSKIFCGCSTAFGAPPNTHTCPICLGHPGVLPVLNRQAVEY 61

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           A+   + LN  I   S F RKNYFYPD P+ YQISQ+D+PI   G + + +        +
Sbjct: 62  AIKAAMALNCTIGDVSKFDRKNYFYPDSPKAYQISQYDQPIGENGWIDIEVDG------K 115

Query: 138 TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
           T  +GI R+HLE+DAGK  H      S +D NR G  L+EIV++P++ +  EAKA+L K+
Sbjct: 116 TKRIGITRLHLEEDAGKLTHVDGGYASLVDFNRVGTPLVEIVSEPEISTPEEAKAYLEKM 175

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           R+I++Y    D  MEEGS+R D N+S+     + +GT+ E+KN+NS R +   +EYE  R
Sbjct: 176 RAIMQYCDVSDVKMEEGSLRCDANISLRPWGQKEFGTKAELKNMNSFRGVQRGLEYEQFR 235

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q  IL++GG I QETR +D ++ +T S+R KE A DYRYF +PDL+ + I E++  A++ 
Sbjct: 236 QAEILDEGGVIVQETRRWDEAQAKTFSMRGKEQAHDYRYFPDPDLVSVHISEEWKEAVRA 295

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLG 375
            IPELPDA++ R+  E+G+  YDA+V+ S K +AD+FE      +D K V+NW++ DLLG
Sbjct: 296 TIPELPDARKARYASEYGLPDYDAAVITSSKLLADFFEDSLNYTKDAKSVSNWIMGDLLG 355

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            LN +   + +  ++   LGE+I LI  GTIS KIAK +F  + E G  P +IVEE GL 
Sbjct: 356 YLNSNNLELSEVKMTGQGLGEMIGLIEKGTISSKIAKTVFKEMLESGKLPAQIVEEKGLV 415

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q++D  AI+ +V++V+ +NP +V      K   + + VGQVMK + GKANP++  K+L E
Sbjct: 416 QISDEGAIKGIVEQVVANNPQSVEDYKAGKQKAIGFLVGQVMKESKGKANPALANKLLVE 475

Query: 495 KLG 497
            L 
Sbjct: 476 VLN 478


>gi|83949491|ref|ZP_00958224.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseovarius
           nubinhibens ISM]
 gi|83837390|gb|EAP76686.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseovarius
           nubinhibens ISM]
          Length = 503

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 292/509 (57%), Positives = 370/509 (72%), Gaps = 17/509 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+      + +G   DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDL-TYDTPKPKVIAGAKQDWELVIGMEVHAQVASRAKLFSGASTQFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+Q V TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPVINEFCVEQTVRTGLGLKADINLKSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG++ V + P  +       V IERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV+
Sbjct: 120 EGEILVDLEPGIA-----RLVRIERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GE 229
           +PD+R   EA A++ KLR ILRYLGTCDGNM+ G++RADVNVS+C+P             
Sbjct: 175 RPDIRGPEEAAAYVGKLRQILRYLGTCDGNMQNGNLRADVNVSICQPGAYERFRETGDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIE EARRQIAI+E GG + QETRL+DP +NETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQAAIEVEARRQIAIVEAGGAVVQETRLYDPDRNETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  IK  +PELPD K+ RF+  FG+S YDASVL +D + 
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDEIKASLPELPDEKKARFVTAFGLSEYDASVLTADVAN 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE+ A +RD K+VANWVIN+L G L +  + I D P++P QLG ++DLI    ISGK
Sbjct: 355 AAYFEEAAQDRDGKLVANWVINELFGRLKKDDRDITDCPVTPAQLGGIVDLIASDAISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F I++ +GG P +IVEE G++QVTD  AIE  VD++I  NP  V +    P L  
Sbjct: 415 IAKDLFEIVYTEGGDPAQIVEERGMKQVTDTGAIETAVDQIIADNPAQVEKAKQNPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
           WFVGQVMK TGGKANP  V +++  KLG+
Sbjct: 475 WFVGQVMKATGGKANPKAVNEIVAAKLGL 503


>gi|312134645|ref|YP_004001983.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Caldicellulosiruptor
           owensensis OL]
 gi|311774696|gb|ADQ04183.1| glutamyl-tRNA(Gln) amidotransferase, B subunit
           [Caldicellulosiruptor owensensis OL]
          Length = 480

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 231/483 (47%), Positives = 321/483 (66%), Gaps = 12/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++EVVIG+EVHA+L+  SK+F   +  FG EPNT        MPG+LP+LN + V+ A+
Sbjct: 1   MEYEVVIGLEVHAELATKSKIFCSCTTEFGGEPNTHCCPICTGMPGVLPVLNKKAVEYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           M GL  N  I +YS   RKNYFYPDLP+ YQISQ+D P+   G + + +   K       
Sbjct: 61  MAGLATNCQIARYSKQDRKNYFYPDLPKAYQISQYDLPLCYNGYIDIEVNGQK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI+RIH+E+DAGK +HDQ+   S +D NR GV L+EIVT+PD+RSS E + FL KL++
Sbjct: 115 RIGIKRIHIEEDAGKLLHDQWEEGSLVDFNRCGVPLIEIVTEPDLRSSEETRVFLEKLKA 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL+Y    D  M+EGS+R DVN+SV     + +GTR E+KN+NS R +  AIEYEARRQI
Sbjct: 175 ILQYTEVSDCKMQEGSLRVDVNLSVRPKGSKEFGTRTEMKNLNSFRSVVRAIEYEARRQI 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE GG I QETR +D +K  + S+RTKE+A DYRYF EPDL P+ +D+ +I  I+K+I
Sbjct: 235 EVLESGGVIVQETRRWDDAKGISLSMRTKEEAHDYRYFPEPDLPPIVVDDSWIEEIRKRI 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDLLGVL 377
           PELPD K+ER+I E+G+  YDA VL S K+IA +FE+        K  +NW++ +++ +L
Sbjct: 295 PELPDQKKERYIKEYGLPEYDAGVLTSSKAIASFFEECIKYTQNIKAASNWMMGEIMRIL 354

Query: 378 NRSG---KSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
           N  G   + I++  I PNQL  LI+L+ + TIS  IAK +F  +++ G  P+ IV+E GL
Sbjct: 355 NDKGLEPEEIDNIKIKPNQLASLINLVDNKTISNTIAKQVFEEMFDTGKDPEVIVKEKGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            Q+TD + I + V + I +NP +V      K     + VGQVMK T GKANP +V ++LK
Sbjct: 415 VQITDRNVILEAVKQAIANNPKSVEDYKNGKDKAFGFLVGQVMKITKGKANPQLVNEILK 474

Query: 494 EKL 496
           E+L
Sbjct: 475 EEL 477


>gi|149201944|ref|ZP_01878918.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseovarius sp.
           TM1035]
 gi|149144992|gb|EDM33021.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseovarius sp.
           TM1035]
          Length = 511

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 297/510 (58%), Positives = 374/510 (73%), Gaps = 18/510 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L     +   + +G   DWE+VIG+EVHAQ++  SKLFSGAS  FGAEPN+ V+F D
Sbjct: 8   MLDLAYETPKP-RVIAGAKHDWELVIGMEVHAQVASKSKLFSGASTQFGAEPNSNVAFVD 66

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   P+VG
Sbjct: 67  AAMPGMLPVINEFCVEQAVRTGLGLKAKINLWSAFDRKNYFYPDLPQGYQISQLYHPLVG 126

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG++ V + P  +       V IERIH+EQDAGKSIHD   A+S +DLNR+GV LMEIV+
Sbjct: 127 EGEILVDMAPGVA-----RLVRIERIHMEQDAGKSIHDMDPAMSFVDLNRTGVCLMEIVS 181

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A++TKLR ILRYLGTCDGNM+ G++RADVNVS+CRPG+           
Sbjct: 182 RPDIRGPEEAAAYVTKLRQILRYLGTCDGNMQNGNLRADVNVSICRPGQYEKYMETQDFS 241

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIEYEARRQIAI+E GG + QETRL+DP KNETRS+R+KE+
Sbjct: 242 HLGTRCEIKNMNSMRFIQAAIEYEARRQIAIVEAGGTVVQETRLYDPDKNETRSMRSKEE 301

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPDAK+ RF+ EFG+S YDA+VL +D + 
Sbjct: 302 AHDYRYFPDPDLLPLEIEQAWVDEIAANLPELPDAKKARFVLEFGLSEYDANVLTADLAN 361

Query: 350 ADYFEKLAVNR-DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISG 408
           A YFE +A    D K+ ANWVIN+L G L +   SIED+P+SP QL  ++ LI    ISG
Sbjct: 362 AAYFEAVAEGAGDGKLAANWVINELFGRLKKEDHSIEDSPVSPAQLAGIVRLIKSDAISG 421

Query: 409 KIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLV 468
           KIAKD+F I++ +GG P+EIVE  G++QVTD  AIE+ V E+I +NP  V +    P L 
Sbjct: 422 KIAKDLFEIVYTEGGDPEEIVEARGMKQVTDTGAIEQAVAEIIAANPAQVEKAQANPKLA 481

Query: 469 SWFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
            WFVGQVMK TGGKANP  V  ++  KLG+
Sbjct: 482 GWFVGQVMKATGGKANPKAVNDIVMAKLGL 511


>gi|326315167|ref|YP_004232839.1| glutamyl-tRNA(gln) amidotransferase subunit B [Acidovorax avenae
           subsp. avenae ATCC 19860]
 gi|323372003|gb|ADX44272.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 486

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 229/492 (46%), Positives = 316/492 (64%), Gaps = 13/492 (2%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
            A+S  L  G    +EVVIG E H QL+  SK+FS A   FGAEPNTQ    D A+PG L
Sbjct: 2   PAKSSLLIHG----YEVVIGFETHTQLATQSKIFSRAPTAFGAEPNTQACAVDLALPGTL 57

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P++N   V  A+  GL L + +   S+FARKNYFYPDLP+GYQISQ + P+V  G+VS  
Sbjct: 58  PVMNREAVACAIRLGLALGSRVAPESIFARKNYFYPDLPKGYQISQFEIPVVQGGEVSFY 117

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
           +G +K        V + R HLE+DAGKS+H+ +   S IDLNR+G  L+EIVT+PD+RSS
Sbjct: 118 LGDEK------KTVRLVRAHLEEDAGKSLHEDFIGQSGIDLNRAGTPLLEIVTEPDIRSS 171

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLG 247
            EA A+  +L  I+ ++G CDGNM+EGS R D NVSV +PG+  GTR E+KN+NS +F+ 
Sbjct: 172 EEAVAYARELHKIVTWIGICDGNMQEGSFRCDANVSVRKPGQPLGTRREIKNLNSFKFMQ 231

Query: 248 LAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEID 307
            AI+YE R QI  +EDG  I+Q T LFDP   ETR++RTKEDA DYRYF +PDL PL I 
Sbjct: 232 QAIDYEIRWQIEQIEDGHAIQQATVLFDPDTGETRAMRTKEDAADYRYFPDPDLPPLRIS 291

Query: 308 EDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVA 366
           E +++  + ++PELP     RF+ ++G+  YDA+ L   K++A YFE+    +   K+ +
Sbjct: 292 EQWVQEERARMPELPRTMAARFVADYGLPEYDATTLTQSKAMAAYFEEAAKASGQPKLAS 351

Query: 367 NWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG-TP 425
           NW++ ++   +N     I   P++   L +LI  I DGTIS   A+ +F+ LW   G   
Sbjct: 352 NWIMGEVSRRVNAGETDIAAAPVTAALLAKLIARIADGTISNAAARQVFDALWTGEGTDV 411

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKAN 484
             ++E  GL+Q+ D  A+EK++DEVI +NP+NVA+    K    +  VGQ MK + GKAN
Sbjct: 412 DAVIEAKGLKQMNDSGALEKIIDEVIAANPDNVAQFKAGKDKAFNALVGQAMKASKGKAN 471

Query: 485 PSIVQKMLKEKL 496
           P  V +ML+ +L
Sbjct: 472 PQQVNEMLRARL 483


>gi|221638387|ref|YP_002524649.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacter
           sphaeroides KD131]
 gi|254790964|sp|B9KMT6|GATB_RHOSK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|221159168|gb|ACM00148.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodobacter sphaeroides KD131]
          Length = 503

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 298/509 (58%), Positives = 374/509 (73%), Gaps = 17/509 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+ A    + +G   DWE+VIG+E+HAQ+S  +KLFSGAS  FGAEPN+ VSF D
Sbjct: 1   MLDL-TYEAPKPKVIAGAKHDWELVIGMEIHAQVSSNAKLFSGASTTFGAEPNSNVSFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
            AMPGMLP++N  CV QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  CAMPGMLPVINEFCVAQAVRTGLGLKAQINLFSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V + P  +       V IERIHLEQDAGKSIHD    +S +D NR+GVALMEIV+
Sbjct: 120 EGEVLVEMAPGIA-----RLVRIERIHLEQDAGKSIHDMDPNLSFVDFNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A++ KLR ILRYLGTCDGNM+ G++RADVNVSVCRPG+           
Sbjct: 175 RPDIRGPEEAAAYVAKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AI+YEARRQIAILEDGG + QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIDYEARRQIAILEDGGKVVQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPDAK+ RF+ ++G++ YDA+VL ++   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQGWVDEIAASMPELPDAKKARFMADYGVTDYDANVLTAELEA 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE++A  RD K  ANWVIN+L G LN+ G +I DTP+   QLG ++DLI  G ISGK
Sbjct: 355 AAYFEEVARGRDGKQAANWVINELFGRLNKQGLTIADTPVKAGQLGGVLDLIASGEISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           +AKD+F ILW +GG P E+    G++QVTD  AIE  VDE+I +NP  V +    P L  
Sbjct: 415 MAKDLFEILWTEGGDPAEVAAARGMKQVTDTGAIETAVDEIIAANPAQVEKAKANPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
           WFVGQV+K TGGKANP+ V +++ EKLG+
Sbjct: 475 WFVGQVIKATGGKANPAAVNQIVAEKLGL 503


>gi|319761101|ref|YP_004125038.1| glutamyl-tRNA(gln) amidotransferase, b subunit [Alicycliphilus
           denitrificans BC]
 gi|330822959|ref|YP_004386262.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Alicycliphilus
           denitrificans K601]
 gi|317115662|gb|ADU98150.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Alicycliphilus
           denitrificans BC]
 gi|329308331|gb|AEB82746.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Alicycliphilus
           denitrificans K601]
          Length = 481

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 231/487 (47%), Positives = 312/487 (64%), Gaps = 13/487 (2%)

Query: 13  SLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNG 72
            L  G    +EVVIG E HAQL+  +K+FS AS  FGAEPNTQ    D A+PG LP++N 
Sbjct: 4   KLIQG----YEVVIGFETHAQLATKAKIFSRASTAFGAEPNTQACAVDLALPGTLPVMNR 59

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
             V  A+  GL L +HI   S+FARKNYFYPDLP+GYQISQ + P+V  G+V   +G +K
Sbjct: 60  EAVACAIKLGLALGSHIAPESIFARKNYFYPDLPKGYQISQFEIPVVQGGEVGFYLGDEK 119

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKA 192
                   V + R HLE+DAGKS+H+++  +S IDLNR+G  L+EIVT+PDMRS+ EA A
Sbjct: 120 ------KTVRLVRAHLEEDAGKSLHEEFHGMSGIDLNRAGTPLLEIVTEPDMRSTEEAVA 173

Query: 193 FLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEY 252
           +   L  I+ ++G CDGNM+EGS R D NVSV RPG+  GTR E+KN+NS +++  AI+Y
Sbjct: 174 YAKALHQIVTWIGICDGNMQEGSFRCDANVSVRRPGQPLGTRREIKNLNSFKYMQQAIDY 233

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           E R QI  LEDG  I+Q T LFDP   ETR++RTKEDA DYRYF +PDL PL I  +++ 
Sbjct: 234 EIRWQIEQLEDGHAIQQATVLFDPDTGETRAMRTKEDAADYRYFPDPDLPPLVIAPEWVE 293

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYF-EKLAVNRDKKIVANWVIN 371
            +K  +PELP A   RF+ ++G+  YDA+ L   +++A YF +        K+ +NWV+ 
Sbjct: 294 QVKAAMPELPRAMAARFVQQYGLPEYDATTLTQSQAMAAYFEDAAKACGAPKLASNWVMG 353

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG-TPKEIVE 430
           ++   LN     ++   +S  QL  LI  I DGTIS   A+ +F  LW   G     +++
Sbjct: 354 EISRRLNTEEIGMDAVKVSSQQLATLIGRIGDGTISNNAARQVFEALWSGEGSDVDAVID 413

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q+ D  A+EK++DEVI +NP NV +    K    +  VGQVMK + GKANP  V 
Sbjct: 414 AKGLKQMNDSGALEKIIDEVIAANPANVEQYKAGKDKAFNALVGQVMKASKGKANPQQVN 473

Query: 490 KMLKEKL 496
           ++LK KL
Sbjct: 474 ELLKAKL 480


>gi|261409297|ref|YP_003245538.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Paenibacillus sp.
           Y412MC10]
 gi|261285760|gb|ACX67731.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Paenibacillus sp.
           Y412MC10]
          Length = 479

 Score =  566 bits (1458), Expect = e-159,   Method: Composition-based stats.
 Identities = 213/483 (44%), Positives = 307/483 (63%), Gaps = 9/483 (1%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
           +T  +E VIG+EVH +L   SK+F G S  FGA PNT         PG+LP+LN + V+ 
Sbjct: 2   STSKYETVIGLEVHVELHTHSKIFCGCSTAFGAPPNTHTCPICLGHPGVLPVLNRQAVEY 61

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           A+   + LN  I   S F RKNYFYPD P+ YQISQ+D+PI   G + + +        +
Sbjct: 62  AIKAAMALNCTIGDVSKFDRKNYFYPDSPKAYQISQYDQPIGENGWIDIEVDG------K 115

Query: 138 TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
           T  +GI R+HLE+DAGK  H      S +D NR G  L+EIV++P++ +  EAKA+L K+
Sbjct: 116 TKRIGITRLHLEEDAGKLTHVDGGYASLVDFNRVGTPLVEIVSEPEISTPEEAKAYLEKM 175

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           R+I++Y    D  MEEGS+R D N+S+     + +GT+ E+KN+NS R +   +EYE  R
Sbjct: 176 RAIMQYCDVSDVKMEEGSLRCDANISLRPWGQKEFGTKAELKNMNSFRGVQRGLEYEQFR 235

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q  IL++GG I QETR +D ++ +T S+R KE A DYRYF +PDL+ + I E++  A++ 
Sbjct: 236 QAEILDEGGVIVQETRRWDEAQAKTFSMRGKEQAHDYRYFPDPDLVSVHISEEWKEAVRA 295

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLG 375
            IPELPDA++ R+  E+G+  YDA+V+ S K +AD+FE   +  +D K V+NW++ DLLG
Sbjct: 296 TIPELPDARKARYASEYGLPDYDAAVITSSKLLADFFEDSLSYTKDAKSVSNWIMGDLLG 355

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            LN +   + +  I+   LGE+I LI  GTIS KIAK +F  + E G  P +IVEE GL 
Sbjct: 356 YLNSNNLELSEVKITGQGLGEMIGLIEKGTISSKIAKTVFKEMLESGKLPAQIVEEKGLV 415

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q++D  AI+ +V++V+ +NP +V      K   + + VGQVMK + GKANP++  K+L E
Sbjct: 416 QISDEGAIKGIVEQVVANNPQSVEDYKAGKQKAIGFLVGQVMKESKGKANPALANKLLVE 475

Query: 495 KLG 497
            L 
Sbjct: 476 VLN 478


>gi|87200844|ref|YP_498101.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Novosphingobium
           aromaticivorans DSM 12444]
 gi|109892042|sp|Q2G4F6|GATB_NOVAD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|87136525|gb|ABD27267.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 497

 Score =  566 bits (1458), Expect = e-159,   Method: Composition-based stats.
 Identities = 276/498 (55%), Positives = 354/498 (71%), Gaps = 13/498 (2%)

Query: 11  SESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPIL 70
           SE    G TG+WEVVIG+EVHAQ++  +KLFSGA+  FGAEPNTQVS  DAAMPGMLP+ 
Sbjct: 2   SEYRIQGATGEWEVVIGLEVHAQVTSNAKLFSGAATAFGAEPNTQVSLVDAAMPGMLPVP 61

Query: 71  NGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP 130
           N  C++QAV TG+ +NA INK+S F RKNYFY DLPQGYQISQ   PIVGEG + V +  
Sbjct: 62  NRECIRQAVRTGMAINAQINKWSRFDRKNYFYADLPQGYQISQLYHPIVGEGSIEVQLDD 121

Query: 131 DKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEA 190
                     +GIERIH+EQDAGK +HDQ+  +S +DLNRSGVALMEIV++PDMRS  EA
Sbjct: 122 --KNPESLKTIGIERIHVEQDAGKLMHDQHPTMSYVDLNRSGVALMEIVSRPDMRSPAEA 179

Query: 191 KAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAI 250
            A+L+KLR+ILRY+G+CDGNM++GSMRADVNVSV RPGE +GTR E KNVNS+RF+   +
Sbjct: 180 GAYLSKLRTILRYVGSCDGNMDQGSMRADVNVSVRRPGEPFGTRTETKNVNSVRFVMAVV 239

Query: 251 EYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDF 310
           E EA+RQ+A++EDGG + QETRL+DP +NETRS+R+KEDA DYRYF +PDLLPLE+D+ F
Sbjct: 240 EQEAKRQVALIEDGGTVVQETRLYDPDRNETRSMRSKEDAHDYRYFPDPDLLPLELDDAF 299

Query: 311 IRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKI------ 364
           +   +  +PELPDAKR R+    G+S Y+A VL +D   A +FE L      K       
Sbjct: 300 LEECRASLPELPDAKRHRYETALGLSAYNAGVLTADVETARWFEALLAETAAKAKKPEAE 359

Query: 365 ----VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
                ANW+I++L G LN+ G S+E +P++P    EL+ LI DGTISG IAK +   + E
Sbjct: 360 VAKQAANWLISELFGALNKLGASLETSPVTPAAGAELLALIADGTISGSIAKQVLEKMLE 419

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNT 479
            G     IVE  GL+Q +D  AIE  +D ++ +N + V +    K  L  +FVGQ MK  
Sbjct: 420 TGDGAAAIVEREGLKQTSDTGAIEAAIDGILAANADKVGQYKAGKEALFGFFVGQTMKAM 479

Query: 480 GGKANPSIVQKMLKEKLG 497
            GKANP +V ++L++KLG
Sbjct: 480 QGKANPGVVNELLRKKLG 497


>gi|260428477|ref|ZP_05782456.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Citreicella sp. SE45]
 gi|260422969|gb|EEX16220.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Citreicella sp. SE45]
          Length = 504

 Score =  566 bits (1458), Expect = e-159,   Method: Composition-based stats.
 Identities = 296/510 (58%), Positives = 372/510 (72%), Gaps = 18/510 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L ++ A    + +G   DWE+VIG+E+HAQ+S  +KLFSGAS  FGAEPN+ VSF D
Sbjct: 1   MLDL-SYEAPKPKVIAGAKHDWELVIGMEIHAQVSSQAKLFSGASTRFGAEPNSNVSFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPVINEYCVEQAVRTGLGLKAQINLKSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V + P          V IERIH+EQDAGKSIHD    +S +DLNR+GVALMEIV+
Sbjct: 120 EGEVLVDMEP-----GIARLVRIERIHIEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GE 229
           +PD+R   EA A++ KLR ILRYLGTCDGNM+ G++RADVNVSVC P             
Sbjct: 175 RPDIRGPEEAAAYVGKLRQILRYLGTCDGNMQNGNLRADVNVSVCLPGAYERYQETQDFG 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AI+YEA+RQIAILE GG I QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIDYEAKRQIAILEAGGSIDQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPDAK+ RF+ EFG+S YDA VL ++ + 
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAASLPELPDAKKARFVTEFGLSEYDAGVLTAEVAN 354

Query: 350 ADYFEKLAVNR-DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISG 408
           A YFE++A +  D K+ ANWVIN+L G L +   SIED+P++P QL  +I LI    ISG
Sbjct: 355 AAYFEQVAGDAGDGKLAANWVINELFGRLKKEDHSIEDSPVTPAQLAGIIRLITSDAISG 414

Query: 409 KIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLV 468
           KIAKD+F I++ +GG P++IVEE G++QVTD  AIE  VDE+I +NP  V +    P L 
Sbjct: 415 KIAKDLFEIVYTEGGDPEKIVEERGMKQVTDTGAIETAVDEIIAANPAQVEKAKQNPKLA 474

Query: 469 SWFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
            WFVGQVMK TGGKANP  V +++  +LG+
Sbjct: 475 GWFVGQVMKATGGKANPKAVNEIVAARLGL 504


>gi|295690142|ref|YP_003593835.1| glutamyl-tRNA(Gln) amidotransferase, subunit B [Caulobacter segnis
           ATCC 21756]
 gi|295432045|gb|ADG11217.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Caulobacter segnis
           ATCC 21756]
          Length = 498

 Score =  566 bits (1458), Expect = e-159,   Method: Composition-based stats.
 Identities = 291/503 (57%), Positives = 371/503 (73%), Gaps = 16/503 (3%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
           + +      G TG WE+V+G+EVHAQ++  SKLFSGA+V FGA PN QVS  DAAMPGML
Sbjct: 1   MTQESKQIQGRTGPWEMVLGLEVHAQVASKSKLFSGAAVGFGAGPNEQVSLVDAAMPGML 60

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P+LN  CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ D+PIVGEG V+V 
Sbjct: 61  PVLNRFCVEQAVKTGLGLKAQINLKSRFDRKNYFYPDLPQGYQISQFDQPIVGEGVVTVE 120

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
                     T +V IER+HLEQDAGKS+HDQ    + +DLNR+G ALMEIV+KPDMR+S
Sbjct: 121 RDD-----GTTFDVRIERLHLEQDAGKSLHDQDPNATYVDLNRAGTALMEIVSKPDMRTS 175

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GEAWGTRCE 236
            EA A++ KLR+IL YLGTCDG+ME+G++RADVNVSVCRP            +  GTRCE
Sbjct: 176 EEAAAYVKKLRTILVYLGTCDGDMEKGNLRADVNVSVCRPGDYEKFRATGDFKHLGTRCE 235

Query: 237 VKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYF 296
           +KNVNS R++  AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KE+A DYRYF
Sbjct: 236 IKNVNSYRYIQQAIEYEARRQIEILEDGGKIDQETRLFDPNKGETRSMRSKEEAHDYRYF 295

Query: 297 SEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL 356
            +PDLLPL +D  ++++I++ +PELPDAK+ R   ++G+S YDA VL+ D   ADYFE  
Sbjct: 296 PDPDLLPLVLDPAWVKSIEQTLPELPDAKKARLQSQYGLSAYDAGVLIIDADRADYFEAA 355

Query: 357 AVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFN 416
           A  RD K+VANWV N+LL  L+ +G +  D+P+  + + +L++LI +GTIS KIAK++F 
Sbjct: 356 AKGRDAKLVANWVTNELLAKLSAAGTAFTDSPLPSSDITQLVELIENGTISSKIAKEVFE 415

Query: 417 ILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVM 476
            +W   G P EIVE+ GL Q+ D  AIEK +D++I  NP+    +  KP  + WFVGQVM
Sbjct: 416 HMWAGEGRPAEIVEKRGLVQINDTGAIEKAIDDLIAGNPDKAEAVKDKPQALGWFVGQVM 475

Query: 477 KNTGGKANPSIVQKMLKEKLGIK 499
           K TGGKANP+ V ++L++KLG++
Sbjct: 476 KATGGKANPATVNELLRKKLGVE 498


>gi|323524443|ref|YP_004226596.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Burkholderia sp.
           CCGE1001]
 gi|323381445|gb|ADX53536.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia sp.
           CCGE1001]
          Length = 491

 Score =  566 bits (1458), Expect = e-159,   Method: Composition-based stats.
 Identities = 237/490 (48%), Positives = 335/490 (68%), Gaps = 11/490 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  WEVVIG+E HAQLS  SK+FSGA   FGA PNTQ    D A+PG LP++N   V++A
Sbjct: 2   TKQWEVVIGLETHAQLSTQSKIFSGAPTQFGAAPNTQACPVDLALPGTLPVMNRGAVERA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSG--QF 136
           +  GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G+V++ +  ++      
Sbjct: 62  IQFGLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQVTIQVPANEKAGTAA 121

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
               V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   
Sbjct: 122 YAKVVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKT 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L +++ +LG CDGNM+EGS R D NVSV       +GTR E+KN+NS RFL  AI+YE R
Sbjct: 182 LHTLVTWLGICDGNMQEGSFRCDANVSVRPLGQAEFGTRAEIKNLNSFRFLEEAIQYEVR 241

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDL+PL ID  ++  +K
Sbjct: 242 RQIELIEDGGTVVQETRLYDPDRRETRSMRSKEDAHDYRYFPDPDLMPLVIDAAWVERVK 301

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVIND 372
           +++PELP+A ++RF+ ++G++ YDA+VL S K+ A YFE +       + K+ ANWV+ +
Sbjct: 302 REMPELPEAIQQRFVSQYGLTPYDANVLTSSKATAAYFEAVVEKLGAANAKVAANWVMGE 361

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT----PKEI 428
           +   LNR G  I + P+S  QL  ++  I DGTIS KIAK+IF  +WE+  T       I
Sbjct: 362 VSSQLNREGLDIAECPVSSAQLALVLQRIADGTISNKIAKEIFLAIWEEKATDDVAADRI 421

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSI 487
           +E  GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP+ 
Sbjct: 422 IEAKGLKQISDTGALEAIIDEVLAANQKSVEEFRAGKEKAFNALIGQAMKATKGKANPAQ 481

Query: 488 VQKMLKEKLG 497
           V ++LK+KLG
Sbjct: 482 VNELLKKKLG 491


>gi|114570252|ref|YP_756932.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Maricaulis maris MCS10]
 gi|114340714|gb|ABI65994.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Maricaulis maris MCS10]
          Length = 497

 Score =  566 bits (1458), Expect = e-159,   Method: Composition-based stats.
 Identities = 294/500 (58%), Positives = 364/500 (72%), Gaps = 16/500 (3%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
           ++    +  G TGDWEVV+G+E+HAQ+   +KLFSGA+  FGA PNTQVS  DAAMPGML
Sbjct: 1   MSDHSYILPGATGDWEVVMGLEIHAQVVSNAKLFSGAATAFGAAPNTQVSLVDAAMPGML 60

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P++N   V+QAV TGLGLNA IN  S F RKNYFYPDLPQGYQISQ   PIVGEG++   
Sbjct: 61  PVINSHVVEQAVRTGLGLNAQINLMSRFDRKNYFYPDLPQGYQISQFQFPIVGEGEIECE 120

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
                        VGIER+HLEQDAGKSIHD     + +DLNRSGVALMEIV++P +RS 
Sbjct: 121 RDD-----GSRFTVGIERLHLEQDAGKSIHDLDPNSTYVDLNRSGVALMEIVSRPHIRSP 175

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-----------AWGTRCE 236
            EA A++ KLR+ILRYLGTC G+ME+G +RADVNVSVCRPG+             GTRCE
Sbjct: 176 EEASAYVAKLRTILRYLGTCGGDMEKGQLRADVNVSVCRPGQYEKFRETGDFSHLGTRCE 235

Query: 237 VKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYF 296
           +KNVNS+RF+  AIEYEA+RQI I+EDGG I QETRLFD +   TRS+R+KE+A DYRYF
Sbjct: 236 IKNVNSLRFIRQAIEYEAQRQIDIIEDGGKIDQETRLFDANTGVTRSMRSKEEAHDYRYF 295

Query: 297 SEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL 356
            +PDLLPLE+ + F+  IK  +PELPD KR R + E G+S YDA+VL +DK  ADY+E +
Sbjct: 296 PDPDLLPLELQQSFVDEIKAGLPELPDQKRARLVSELGLSDYDAAVLSADKDRADYYEIV 355

Query: 357 AVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFN 416
           A  RD K+ ++WV N+L G LN+ G  I D+P+S  QLG LI LI D TISGKIAKD+F 
Sbjct: 356 AEGRDAKLASSWVNNELYGRLNKEGLDITDSPVSATQLGGLIALISDDTISGKIAKDVFE 415

Query: 417 ILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVM 476
           ILW +GG P +IV+E GL+QVTD  AIE V+D++I  NP+  A++  KP  + WFVGQVM
Sbjct: 416 ILWSEGGDPAKIVDEKGLKQVTDTGAIEAVIDQLIADNPDQAAQVKEKPKTMGWFVGQVM 475

Query: 477 KNTGGKANPSIVQKMLKEKL 496
           K   GKANP  V ++L++KL
Sbjct: 476 KAMQGKANPQAVNEILRKKL 495


>gi|310643934|ref|YP_003948692.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit b
           [Paenibacillus polymyxa SC2]
 gi|309248884|gb|ADO58451.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Paenibacillus polymyxa SC2]
          Length = 481

 Score =  566 bits (1458), Expect = e-159,   Method: Composition-based stats.
 Identities = 211/483 (43%), Positives = 297/483 (61%), Gaps = 9/483 (1%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
           TT  +E VIG+EVH +L   SK+F G S +FGA PN+         PG+LP+LN + V  
Sbjct: 4   TTSKYETVIGLEVHVELHTKSKIFCGCSTSFGAPPNSHTCPVCLGHPGVLPVLNRQAVDY 63

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           A+   + LN  I   S F RKNYFYPD P+ YQISQ+D+PI   G + + +         
Sbjct: 64  AMKAAMALNCTIADVSKFDRKNYFYPDSPKAYQISQYDQPIGENGWIDIEVNG------E 117

Query: 138 TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
           T  +GI R+HLE+DAGK  H      S +D NR G  L+EIV++PD+ S  EAKA+L K+
Sbjct: 118 TKRIGITRLHLEEDAGKLTHVDGGYASLVDFNRVGTPLVEIVSEPDISSPEEAKAYLEKI 177

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           R+I++Y    D  MEEGS+R D N+S+     +  GT+ E+KN+NS R +   +EYE  R
Sbjct: 178 RAIMQYCDVSDVKMEEGSLRCDANISLRPHGQKELGTKAELKNMNSFRGVQRGLEYEQFR 237

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q   L++GG I QETR +D ++ +T S+R KE A DYRYF +PDL+ L IDE++   I+ 
Sbjct: 238 QEQTLDEGGTIVQETRRWDEAQGKTLSMRGKEQAHDYRYFPDPDLVTLHIDEEWKERIRA 297

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLG 375
            IPELPD ++ R+  E+G+  YDA V+ S K +AD FE      +D K V+NW++ DLLG
Sbjct: 298 SIPELPDQRKTRYTSEYGLPEYDAQVITSSKPLADLFEDSLQYTKDAKAVSNWIMGDLLG 357

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            LN +   +    ++   LGE+I L+  GTI+ KIAK +F  + E    P++IVEE GL 
Sbjct: 358 YLNSASVELSQVKLTGRGLGEMIGLLEKGTINSKIAKTVFKEMLESDKLPQQIVEEKGLV 417

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q++D  AI  +V++V+ +NP +V      K   + + VGQVMK + GKANP +  K+L E
Sbjct: 418 QISDEGAILTIVEQVVAANPQSVEDYKAGKQKAIGFLVGQVMKESKGKANPGLANKLLTE 477

Query: 495 KLG 497
            L 
Sbjct: 478 VLN 480


>gi|146279115|ref|YP_001169274.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacter
           sphaeroides ATCC 17025]
 gi|166198813|sp|A4WX55|GATB_RHOS5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|145557356|gb|ABP71969.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 503

 Score =  566 bits (1458), Expect = e-159,   Method: Composition-based stats.
 Identities = 295/509 (57%), Positives = 370/509 (72%), Gaps = 17/509 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+      + +G   DWE+VIG+E+HAQ+S  +KLFSGAS  FGAEPN+ VSF D
Sbjct: 1   MLDL-TYETPKPKVIAGAKHDWELVIGMEIHAQVSSNAKLFSGASTTFGAEPNSNVSFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
            AMPGMLP++N  CV QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  CAMPGMLPVINDFCVAQAVRTGLGLKAQINLVSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +GP  +       V IERIHLEQDAGKSIHD    +S +D NR+GVALMEIV+
Sbjct: 120 EGEVLVEMGPGVA-----RLVRIERIHLEQDAGKSIHDMDPNLSFVDFNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GE 229
           +PD+R   EA A++ KLR ILRYLGTCDGNM+ G++RADVNVSVCRP             
Sbjct: 175 RPDIRGPEEAAAYVAKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGDYERYQATQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIEYEARRQIAILEDGG + QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIEYEARRQIAILEDGGKVVQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPDAK+ RF+ ++G++ YDA+VL ++   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDEIATSMPELPDAKKARFMADYGVTDYDANVLTAELDA 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A +FE +A  RD K  ANWVIN+L G LN+ G +I + P+S  QLG ++DLI  G ISGK
Sbjct: 355 AAFFEAVAKGRDGKQAANWVINELFGRLNKQGLTIAEAPVSAAQLGGVLDLIASGEISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           +AKD+F ILW +GG P E+    G++QVTD  AIE  VDE+I +NP  V +    P L  
Sbjct: 415 MAKDLFEILWTEGGDPAEVAAARGMKQVTDTGAIETAVDEIIAANPAQVEKAKANPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
           WFVGQV+K TGGKANP+ V +++ +KLG+
Sbjct: 475 WFVGQVIKATGGKANPAAVNQIVAQKLGL 503


>gi|77462533|ref|YP_352037.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacter
           sphaeroides 2.4.1]
 gi|109892059|sp|Q3J4Z8|GATB_RHOS4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|77386951|gb|ABA78136.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodobacter sphaeroides 2.4.1]
          Length = 503

 Score =  566 bits (1458), Expect = e-159,   Method: Composition-based stats.
 Identities = 297/509 (58%), Positives = 373/509 (73%), Gaps = 17/509 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+ A    + +G   DWE+VIG+E+HAQ+S  +KLFSGAS  FGAEPN+ VSF D
Sbjct: 1   MLDL-TYEAPKPKVIAGAKHDWELVIGMEIHAQVSSNAKLFSGASTTFGAEPNSNVSFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
            AMPGMLP++N  CV QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  CAMPGMLPVINEFCVAQAVRTGLGLKAQINLVSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V + P  +       V IERIHLEQDAGKSIHD    +S +D NR+GVALMEIV+
Sbjct: 120 EGEVLVELAPGIA-----RLVRIERIHLEQDAGKSIHDMDPNLSFVDFNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A++ KLR ILRYLGTCDGNM+ G++RADVNVSVCRPG+           
Sbjct: 175 RPDIRGPEEAAAYVAKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AI+YEARRQIAILEDGG + QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIDYEARRQIAILEDGGKVVQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPDAK+ RF+ ++G++ YDA+VL ++   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQGWVDEIAASMPELPDAKKARFMADYGVTDYDANVLTAELDA 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE++A  RD K  ANWVIN+L G LN+ G +I DTP+   QLG ++DLI  G ISGK
Sbjct: 355 AAYFEEVARGRDGKQAANWVINELFGRLNKQGLTIADTPVKAGQLGGVLDLIASGEISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           +AKD+F ILW +GG P E+    G++QVTD  AIE  VDE+I +NP  V +    P L  
Sbjct: 415 MAKDLFEILWTEGGDPAEVAAARGMKQVTDTGAIETAVDEIIAANPAQVEKAKANPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
           WFVGQV+K TGGKANP+ V +++ +KLG+
Sbjct: 475 WFVGQVIKATGGKANPAAVNQIVAQKLGL 503


>gi|114798220|ref|YP_760986.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Hyphomonas
           neptunium ATCC 15444]
 gi|114738394|gb|ABI76519.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Hyphomonas
           neptunium ATCC 15444]
          Length = 502

 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 290/502 (57%), Positives = 361/502 (71%), Gaps = 12/502 (2%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
             R+     G TGDWEVV+G+E+HAQ++  +KLFSGAS  FGA+PN  VS  DAAMPGML
Sbjct: 2   TERTPFRIKGETGDWEVVMGLEIHAQVASNAKLFSGASTTFGADPNCNVSLVDAAMPGML 61

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P++N  CV+QA+ TGLGL A IN YS F RKNYFYPDLPQGYQISQ   PIVGEG++ V 
Sbjct: 62  PVINKFCVEQAIRTGLGLKAQINTYSRFDRKNYFYPDLPQGYQISQFAHPIVGEGEIEVD 121

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
           +      +       IER+HLEQDAGKSIHD     + +DLNRSGVALMEIV+KPD+RS 
Sbjct: 122 VEVPGK-EDYAFPCRIERLHLEQDAGKSIHDMDPNSTYVDLNRSGVALMEIVSKPDIRSP 180

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GEAWGTRCE 236
            EA A++ KLR+I+  LGTCDG+ME+G++RADVNVSVC+P            +  GTRCE
Sbjct: 181 AEAAAYVKKLRAIVIALGTCDGDMEKGNLRADVNVSVCKPGQYEKFRETGDFKHLGTRCE 240

Query: 237 VKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYF 296
           +KN+NS RF+  AIEYEA RQI I+E GG + QETRLFDP K ETRS+R+KEDA DYRYF
Sbjct: 241 LKNMNSYRFIQQAIEYEAHRQIEIIEGGGKVDQETRLFDPVKGETRSMRSKEDAHDYRYF 300

Query: 297 SEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL 356
            +PDLLPLE+++ +I  I+  +PELPD KR RF  ++G+S YDA VL SD   A +FE+ 
Sbjct: 301 PDPDLLPLEVEQAWIEEIRASLPELPDQKRARFEKDYGLSRYDAGVLTSDADKAAFFEEA 360

Query: 357 AVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFN 416
           A  RD K+ ANWV  +L G LN+ G  + ++P+S   LG LI+LI + TISGKIAKD+F 
Sbjct: 361 AKGRDAKLTANWVTQELFGYLNKEGLELSESPVSAEALGGLIELISNDTISGKIAKDVFA 420

Query: 417 ILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVM 476
            +    G    IVE+ GL+QVTD  AIEKVVDE+I +NP+ VA++  KP  + WFVGQVM
Sbjct: 421 RMIAGEGEAAAIVEKHGLKQVTDTGAIEKVVDEIIAANPDQVAKVKDKPQTLGWFVGQVM 480

Query: 477 KNTGGKANPSIVQKMLKEKLGI 498
           K +GGKANP  V  +LK KLGI
Sbjct: 481 KASGGKANPKAVNDILKAKLGI 502


>gi|258510691|ref|YP_003184125.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257477417|gb|ACV57736.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 477

 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 216/480 (45%), Positives = 307/480 (63%), Gaps = 9/480 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E +IG+EVH +L   +K+F G   +  +EPNT V       PG LP+LN R ++ AV
Sbjct: 1   MNYETIIGLEVHVELKTDTKIFCGCRNDSKSEPNTNVCPVCLGHPGTLPVLNERALELAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              L L+  IN+ S F RKNYFYPDLP+GYQISQ+DKPI   G + + +         T 
Sbjct: 61  KAALALHCKINQKSKFDRKNYFYPDLPKGYQISQYDKPIGEHGYIEIEVNG------ETK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R+HLE+DAGKS+H    + + +D NR+GV L+EIV++PD+RS  EA+ +L  L+S
Sbjct: 115 RIGITRLHLEEDAGKSMHAADGSHTLVDYNRTGVPLIEIVSEPDIRSPEEARLYLEALKS 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+ Y    D  MEEGS+R D N+S+      A+G + E+KN+NS RF+  A+EYE  RQ 
Sbjct: 175 IMEYCDVSDCKMEEGSLRCDANISLRPVGQTAFGNKVELKNMNSFRFVQRALEYEVERQR 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
              E G  + QETR FD +   T S+RTKE+A DYRYF EPDL+ L+ID+ ++  I+  +
Sbjct: 235 ERYESGEPVIQETRRFDEATQTTVSMRTKEEAHDYRYFPEPDLVDLDIDDAWLERIRASL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVL 377
           PELP AKR R++ E G+  YDA VL SD  +A Y+E  +A   D K  +NWV++D+ G L
Sbjct: 295 PELPSAKRRRYVEELGLPPYDAGVLTSDPKMAAYYEAVIAAGADAKQASNWVMSDVSGAL 354

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N  GK+  D PI P  L  LI  +  G IS K A+++F ++WE G +  EI++E G  Q+
Sbjct: 355 NAEGKTFADCPIPPEHLAGLIGEVASGKISSKQAREVFKLMWETGKSAAEIIKEKGFEQI 414

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D + ++ ++DEV+ +NP +VA     K   ++  VGQVMK T GKANP++V +ML EK+
Sbjct: 415 SDPAQLQPIIDEVVANNPKSVADYKGGKERALAALVGQVMKATRGKANPTLVNEMLIEKI 474


>gi|308070710|ref|YP_003872315.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Paenibacillus polymyxa E681]
 gi|305859989|gb|ADM71777.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Paenibacillus polymyxa E681]
          Length = 481

 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 211/483 (43%), Positives = 298/483 (61%), Gaps = 9/483 (1%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
           TT  +E VIG+EVH +L   SK+F G S +FGA PN+         PG+LP+LN + V  
Sbjct: 4   TTSKYETVIGLEVHVELHTKSKIFCGCSTSFGAPPNSHTCPVCLGHPGVLPVLNRQAVDY 63

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           A+   + LN  I   S F RKNYFYPD P+ YQISQ+D+PI   G + + +         
Sbjct: 64  AMKAAMALNCTIADVSKFDRKNYFYPDSPKAYQISQYDQPIGENGWIDIEVNG------E 117

Query: 138 TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
           T  +GI R+HLE+DAGK  H      S +D NR G  L+EIV++P++ S  EAKA+L K+
Sbjct: 118 TKRIGITRLHLEEDAGKLTHVDGGYASLVDFNRVGTPLVEIVSEPEISSPEEAKAYLEKI 177

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           R+I++Y    D  MEEGS+R D N+S+     +  GT+ E+KN+NS R +   +EYE  R
Sbjct: 178 RAIMQYCDVSDVKMEEGSLRCDANISLRPHGQKELGTKAELKNMNSFRGVQRGLEYEQFR 237

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q   L++GG I QETR +D ++ +T S+R KE A DYRYF +PDL+ L IDE++   I+ 
Sbjct: 238 QEQTLDEGGTIVQETRRWDEAQGKTLSMRGKEQAHDYRYFPDPDLVTLHIDEEWKERIRA 297

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLG 375
            IPELPD ++ R+  E+G+  YDA V+ S K +AD FE      +D K V+NW++ DLLG
Sbjct: 298 SIPELPDQRKARYTSEYGLPEYDAQVITSSKPLADLFEDSLQFTKDAKAVSNWIMGDLLG 357

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            LN +G  +    ++   LGE+I L+  GTI+ KIAK +F  + E    P++IVEE GL 
Sbjct: 358 YLNSAGVELSQVKLTGRGLGEMIGLLEKGTINSKIAKTVFKEMLESDKLPQQIVEEKGLV 417

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q++D  AI  +V++V+ +NP +V      K   + + VGQVMK + GKANP +  K+L E
Sbjct: 418 QISDEGAILTIVEQVVAANPQSVEDYKAGKQKAIGFLVGQVMKESKGKANPGLANKLLTE 477

Query: 495 KLG 497
            L 
Sbjct: 478 VLN 480


>gi|222528768|ref|YP_002572650.1| aspartyl/glutamyl-tRNA amidotransferase subunit B
           [Caldicellulosiruptor bescii DSM 6725]
 gi|254790934|sp|B9MQ85|GATB_ANATD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|222455615|gb|ACM59877.1| glutamyl-tRNA(Gln) amidotransferase, B subunit
           [Caldicellulosiruptor bescii DSM 6725]
          Length = 480

 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 231/483 (47%), Positives = 320/483 (66%), Gaps = 12/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++EVVIG+EVHA+L+  SK+F   +  FG EPNT        MPG+LP+LN + V+ A+
Sbjct: 1   MEYEVVIGLEVHAELATKSKIFCSCTTEFGGEPNTHCCPICTGMPGVLPVLNKKAVEYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           M GL  N  I +YS   RKNYFYPDLP+ YQISQ+D P+   G + + +   K       
Sbjct: 61  MAGLATNCQIARYSKQDRKNYFYPDLPKAYQISQYDLPLCYNGYIDIEVNGQK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI+RIH+E+DAGK +HDQ+   S +D NR GV L+EIVT+PD+RSS E + FL KL++
Sbjct: 115 RIGIKRIHIEEDAGKLLHDQWEEGSLVDFNRCGVPLIEIVTEPDLRSSEETRIFLEKLKA 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL+Y    D  M+EGS+R DVN+SV     + +GTR E+KN+NS R +  AIEYEARRQI
Sbjct: 175 ILQYTEVSDCKMQEGSLRVDVNLSVRPKGSKEFGTRTEMKNLNSFRSVVRAIEYEARRQI 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE GG + QETR +D  K  + S+RTKE+A DYRYF EPDL P+ +D+ +I  I+K+I
Sbjct: 235 EVLESGGVVVQETRRWDDPKGISLSMRTKEEAHDYRYFPEPDLPPIVVDDSWIEEIRKRI 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDLLGVL 377
           PELPD K+ER+I E+G+  YDA VL S K+IA+YFE+        K  +NW++ +++ +L
Sbjct: 295 PELPDQKKERYIKEYGLPEYDAGVLTSSKAIANYFEECIKYTQNIKAASNWMMGEIMRIL 354

Query: 378 NRSG---KSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
           N  G   + I +  I PNQL  LI+L+ + TIS  IAK +F  ++E G  P+ IV+E GL
Sbjct: 355 NDKGLEPEEINNIKIKPNQLASLINLVDNKTISNTIAKQVFEEMFETGKDPEVIVKEKGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            Q+TD + I + V + I +NP +V      K     + VGQVMK T GKANP +V ++L+
Sbjct: 415 VQITDRNVILEAVKQAIANNPKSVEDYKNGKDKAFGFLVGQVMKITKGKANPQLVNEILR 474

Query: 494 EKL 496
           E+L
Sbjct: 475 EEL 477


>gi|298528799|ref|ZP_07016203.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298512451|gb|EFI36353.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 476

 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 236/480 (49%), Positives = 326/480 (67%), Gaps = 9/480 (1%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           D+E VIG+EVHAQL   SK+F   S  FG +PNT        MPG+LP+LN R V+ AV 
Sbjct: 3   DYETVIGLEVHAQLKTRSKIFCSCSTQFGNDPNTNTCPICTGMPGVLPVLNKRAVEFAVK 62

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
             L L+  +N+ SVFARKNYFYPDLP+GYQISQ+D+P+   G + +        Q R  +
Sbjct: 63  MALALDCRVNERSVFARKNYFYPDLPKGYQISQYDQPLAEHGHIKI------LAQNREKD 116

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           VGI RIH+E+DAGKSIH     +S +DLNR+GV LMEIV++PDMRS  EA A+L  LRSI
Sbjct: 117 VGITRIHMEEDAGKSIHSHSEGLSYVDLNRTGVPLMEIVSEPDMRSPEEAAAYLKALRSI 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           LRYL   DGNMEEGS R D NVS+        GTR E+KN+NS R +  A+EYE  RQ+ 
Sbjct: 177 LRYLDISDGNMEEGSFRCDANVSIRPRGKNELGTRTEIKNLNSFRNVQKALEYEVSRQMD 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ILED   + QETRLFDP +  T S+R KE+A DYRYF +PDL+PL +D D+   +KK++P
Sbjct: 237 ILEDKEEVIQETRLFDPDRGITVSMRGKEEAHDYRYFPDPDLVPLLVDRDWTLRLKKELP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVLN 378
           ELP A+  RFI ++ +   D+ VL S++ +AD+FE+   +    K ++NWV+ +LL  LN
Sbjct: 297 ELPMARLARFISQYELPHEDSQVLTSERDLADFFEECTRLYAQPKKISNWVMTELLRELN 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++  SI+++  SP  L +L+ ++ +GTIS KIAK +F  ++  G  P+++V++ GL Q++
Sbjct: 357 QAATSIKESGFSPGLLAKLVRMVDEGTISNKIAKSLFPEVFASGSDPEKLVQDKGLGQIS 416

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D   +E+VVDEVI+ NP+ V +    +  L+S+FVGQVMK T G+ANP +V +++  KLG
Sbjct: 417 DSGELERVVDEVISENPDEVQKYQQGRKKLMSFFVGQVMKKTKGQANPGLVNELINRKLG 476


>gi|288942489|ref|YP_003444729.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Allochromatium
           vinosum DSM 180]
 gi|288897861|gb|ADC63697.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Allochromatium
           vinosum DSM 180]
          Length = 477

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 239/480 (49%), Positives = 327/480 (68%), Gaps = 8/480 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+E+H QL+  SK+FSGA   FGAEPNTQ    D  +PG+LP+LN   V+ AV
Sbjct: 1   MQWETVIGLEIHTQLATQSKIFSGAPTAFGAEPNTQACAIDLGLPGVLPVLNVEAVRLAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             G  ++A I   SVFARKNYFYPDLP+GYQISQ++ P+VG+G+V + +           
Sbjct: 61  RFGKAIDAEIAPRSVFARKNYFYPDLPKGYQISQYELPVVGKGRVEIVLDD-----GTVK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +G+ R HLE+DAGKS+H+ +   + IDLNR+G  L+EIV++PD+RS  EA A+  K+  
Sbjct: 116 TIGVTRAHLEEDAGKSLHEDFHGFTGIDLNRAGTPLLEIVSEPDLRSPAEAVAYAKKIHQ 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RY+G  DGNM+EGS R D NVSV     + +GTR E+KNVNS RFL  AI +E  RQI
Sbjct: 176 IVRYIGISDGNMQEGSFRMDANVSVRPVGQKEFGTRAEIKNVNSFRFLEKAIAFEVERQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++E GG + QETRL+D  K+ETRS+RTKE+A DYRYF +PDLLPLEID+ F+      +
Sbjct: 236 DLIEGGGTVVQETRLYDAVKDETRSMRTKEEANDYRYFPDPDLLPLEIDDAFLTEATADL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVL 377
           PELPDAKR RF  E+G+S YDA++L + + +ADY+E +     + K+ ANWV  +L+  L
Sbjct: 296 PELPDAKRARFQSEYGLSEYDANLLTASRELADYYETVARACGEPKLAANWVSGELMAAL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+S   I  +P+S + L  LI  I DGT+SGK+AK +F  +W  GG    ++E  GL+Q+
Sbjct: 356 NKSECEIGASPVSASALAGLIARIQDGTVSGKLAKQVFEGMWNGGGEADAVIEAQGLKQI 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           TD  AIE +++ ++ +NP  V +    K  +  +FVGQVMK +GGKANP+ V ++LK KL
Sbjct: 416 TDTGAIESMIEAIVAANPEQVEQYRAGKDKVFGFFVGQVMKQSGGKANPAQVNEILKRKL 475


>gi|291568261|dbj|BAI90533.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Arthrospira
           platensis NIES-39]
          Length = 494

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 222/486 (45%), Positives = 311/486 (63%), Gaps = 9/486 (1%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
             ++E VIG+E H QLS  +K+FS +S  FGA+PNT +      +PG+LP+LN + ++ A
Sbjct: 8   KTEYEAVIGLETHCQLSTETKIFSNSSTQFGADPNTNIDPICLGLPGVLPVLNQKVLEYA 67

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           V     LN  I  YS F RK YFYPDLP+ YQISQ D PI   G + + I  + +   R 
Sbjct: 68  VKAASALNCEIAPYSKFDRKQYFYPDLPKNYQISQFDLPIATNGWLEIEIVDENNNPIR- 126

Query: 139 IEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
             +GI R+H+E+DAGK +H        S  S +D NR+G+ L+EIV++PD+RS LEA  +
Sbjct: 127 KRIGITRLHMEEDAGKLVHGGSDRLSGSTYSMVDFNRAGIPLVEIVSEPDIRSGLEAAEY 186

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEY 252
             +LR I+RYLG  DGNM+EGS+R DVN+SV     + +GT+ E+KN+NS   +  AI+Y
Sbjct: 187 AQELRRIVRYLGVSDGNMQEGSLRCDVNISVRPVGQKEFGTKVEIKNMNSFSAIQRAIDY 246

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           E  RQIA LE G  + QETRL++     T S+R+KE + DYRYF EPDL P+++  + ++
Sbjct: 247 EIERQIAALEAGESLIQETRLWEEGSQRTISMRSKEGSSDYRYFPEPDLPPIQVSAEQLK 306

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVIN 371
             K ++PELP  KR R+  + G+S YD  VL  D+++A+YFE   A   D K  ANW++ 
Sbjct: 307 QWKSELPELPAQKRHRYETDLGLSAYDTRVLTDDRTVAEYFEATVAAGADTKQAANWLMG 366

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D+   L     +I D P+ P +L ELI LI D TISGKIAKDI   L  KGG+PK++VE+
Sbjct: 367 DITAYLKNEKLAINDIPLKPAELAELIALIGDNTISGKIAKDILPELLTKGGSPKQLVEK 426

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL Q++D   +E ++DEVI S+P  V +    K  L  +FVGQVMK T G+A+P +  K
Sbjct: 427 KGLIQISDTGELEAIIDEVIASHPQEVEKFKAGKTKLKGFFVGQVMKKTQGRADPQLTNK 486

Query: 491 MLKEKL 496
           ++ +KL
Sbjct: 487 LISQKL 492


>gi|307728163|ref|YP_003905387.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Burkholderia sp.
           CCGE1003]
 gi|307582698|gb|ADN56096.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia sp.
           CCGE1003]
          Length = 491

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 236/489 (48%), Positives = 334/489 (68%), Gaps = 11/489 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  WEVVIG+E HAQLS  SK+FSGA   FGA PNTQ    D A+PG LP++N   V++A
Sbjct: 2   TKQWEVVIGLETHAQLSTQSKIFSGAPTQFGAAPNTQACPVDLALPGTLPVMNRGAVERA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF-- 136
           +  GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G+V++ +  ++      
Sbjct: 62  IQFGLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQVTIQVPGNEKAGTPA 121

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            +  V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   
Sbjct: 122 YSKVVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKT 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L +++ +LG CDGNM+EGS R D NVSV       +GTR E+KN+NS RFL  AI+YE R
Sbjct: 182 LHTLVTWLGICDGNMQEGSFRCDANVSVRPVGQAEFGTRAEIKNLNSFRFLEEAIQYEVR 241

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDL+PL ID  ++  +K
Sbjct: 242 RQIELIEDGGTVVQETRLYDPDRRETRSMRSKEDAHDYRYFPDPDLMPLVIDAAWVERVK 301

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVIND 372
           +++PELP+A ++RF+ ++G++ YDA+VL S K+ A YFE +       + K+ ANWV+ +
Sbjct: 302 REMPELPEAIQQRFVSQYGLTPYDANVLTSSKATAAYFEAVVGKLGAANAKVAANWVMGE 361

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEI 428
           +   LNR G  I + P+S  QL  L+  I DGTIS KIAK+IF  +WE+          I
Sbjct: 362 VSSQLNREGLEIAECPVSSAQLALLLQRIADGTISNKIAKEIFLTIWEEKANDEAAADRI 421

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSI 487
           +E  GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP+ 
Sbjct: 422 IEAKGLKQISDTGALEAIIDEVLAANQKSVEEFRAGKEKAFNALIGQAMKATKGKANPAQ 481

Query: 488 VQKMLKEKL 496
           V ++LK+KL
Sbjct: 482 VNELLKKKL 490


>gi|77165480|ref|YP_344005.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrosococcus
           oceani ATCC 19707]
 gi|254433161|ref|ZP_05046669.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Nitrosococcus oceani AFC27]
 gi|109892040|sp|Q3J9M1|GATB_NITOC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|76883794|gb|ABA58475.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Nitrosococcus oceani ATCC 19707]
 gi|207089494|gb|EDZ66765.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Nitrosococcus oceani AFC27]
          Length = 477

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 250/481 (51%), Positives = 343/481 (71%), Gaps = 9/481 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+E+HAQL+  SK+FSGA+  +GA PNTQ    D  +PG+LP+LN   V+ AV
Sbjct: 1   MQWEPVIGLEIHAQLATKSKIFSGAATAYGAPPNTQACAVDLGLPGVLPVLNQAVVRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I K+SVFARKNYFYPDLP+GYQISQ++ PIV +G V + +           
Sbjct: 61  KFGLAIEAKIAKHSVFARKNYFYPDLPKGYQISQYELPIVADGHVIIELED-----GVEK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + I R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV+ PD+RS+ EA  ++ K+ +
Sbjct: 116 RIEIVRAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSGPDLRSTKEAVTYMKKIHT 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYLG CDGNM+EGS R D N+S+   G+   GTR E+KN+NS RF+  A++YE  RQ 
Sbjct: 176 LVRYLGICDGNMQEGSFRCDANISIRPQGQETLGTRTELKNINSFRFVERALQYEIERQT 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE GG + QETRLFDP+KNETR +RTKE+A DYRYF +PDLLPL +++ FI  +++ +
Sbjct: 236 EVLESGGQVLQETRLFDPAKNETRPMRTKEEATDYRYFPDPDLLPLVLEDSFIDEVRETL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK--LAVNRDKKIVANWVINDLLGV 376
           PELPDAKR+RF+ E+ +S YDASVL + + +ADY+E      + + K+ ANWV+ DL G 
Sbjct: 296 PELPDAKRKRFVMEYALSAYDASVLTASRELADYYEAVVKTADGEAKLSANWVMGDLAGA 355

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN+ GKSI D+P+SP QLG+LI  I D TISGKIAK +F  ++ +GG   EI+   GL+Q
Sbjct: 356 LNKEGKSIADSPVSPEQLGQLIKRIADETISGKIAKTVFETMYAQGGKADEIIARQGLKQ 415

Query: 437 VTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           VTD ++IEK++DEV+ +NP  V +    K  L  +FVGQVMK + GKANP  + ++LK+K
Sbjct: 416 VTDTASIEKLIDEVLAANPQQVTQYQGGKDKLFGFFVGQVMKTSKGKANPQQLNELLKKK 475

Query: 496 L 496
           L
Sbjct: 476 L 476


>gi|83945535|ref|ZP_00957882.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Oceanicaulis
           alexandrii HTCC2633]
 gi|83851111|gb|EAP88969.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Oceanicaulis
           alexandrii HTCC2633]
          Length = 498

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 289/499 (57%), Positives = 366/499 (73%), Gaps = 16/499 (3%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           +    +  G TGDWE+V+G+EVHAQ+   +KLFSGA+  FGAEPNTQVS  DA MPGMLP
Sbjct: 3   SEHTYVIKGATGDWELVMGLEVHAQVKSNAKLFSGAATAFGAEPNTQVSLVDAGMPGMLP 62

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           ++N  CV QAV TGLGLNA IN +S F RKNYFYPDLPQGYQISQ   PIVGEG++    
Sbjct: 63  VINEACVAQAVRTGLGLNAQINAFSRFDRKNYFYPDLPQGYQISQFAHPIVGEGEIECER 122

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
                       VGIER+HLEQDAGKSIHD     + +DLNRSGVALMEIV++P +R+  
Sbjct: 123 DD-----GTLFTVGIERLHLEQDAGKSIHDLDPTATYVDLNRSGVALMEIVSRPHIRTPA 177

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GEAWGTRCEV 237
           +A A++  LR+ILRYL TC G+ME+G +RADVNVSVCRP            E  GTRCE+
Sbjct: 178 DAAAYVRTLRTILRYLDTCGGDMEKGQLRADVNVSVCRPGQYENFIETGSFEHLGTRCEI 237

Query: 238 KNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFS 297
           KNVNS+RF+  AIEYEA+RQ+ ILE+GG I QETRLFD +   TRS+R+KE+A DYRYF 
Sbjct: 238 KNVNSLRFIMQAIEYEAQRQVDILEEGGTIDQETRLFDANAGVTRSMRSKEEAHDYRYFP 297

Query: 298 EPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA 357
           +PDLLPL++++ FI  +K  +PELP  KR+RF+ E G+S YDASVL +DK  ADYFEK+ 
Sbjct: 298 DPDLLPLQLEDSFIADLKANLPELPAEKRKRFVEELGLSEYDASVLAADKDRADYFEKVL 357

Query: 358 VNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNI 417
             RD K+ ANWV N+L G LN+ G  I ++P+SP QLG ++ LI+D TISGKIAKD+F I
Sbjct: 358 EGRDPKLAANWVNNELFGRLNKEGLGITESPVSPEQLGGIVSLIMDKTISGKIAKDVFEI 417

Query: 418 LWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMK 477
           +W +GG P +IV++ G++QVTD  AIEKV+D++I +NP+   ++  KP  + WFVGQVMK
Sbjct: 418 VWAEGGDPAKIVDDRGMKQVTDTGAIEKVIDDLIAANPDQAEKVKEKPKTMGWFVGQVMK 477

Query: 478 NTGGKANPSIVQKMLKEKL 496
             GGKANP  V ++L +KL
Sbjct: 478 EMGGKANPQAVNEILAKKL 496


>gi|126461467|ref|YP_001042581.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacter
           sphaeroides ATCC 17029]
 gi|166198812|sp|A3PHJ3|GATB_RHOS1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|126103131|gb|ABN75809.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 503

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 296/509 (58%), Positives = 372/509 (73%), Gaps = 17/509 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+ A    + +G   DWE+VIG+E+HAQ+S  +KLFSGAS  FGAEPN+ VSF D
Sbjct: 1   MLDL-TYEAPKPKVIAGAKHDWELVIGMEIHAQVSSNAKLFSGASTTFGAEPNSNVSFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
            AMPGMLP++N  CV QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  CAMPGMLPVINEFCVAQAVRTGLGLKAQINLVSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V + P  +       V IERIHLEQDAGKSIHD    +S +D NR+GVALMEIV+
Sbjct: 120 EGEVLVELAPGIA-----RLVRIERIHLEQDAGKSIHDMDPNLSFVDFNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A++ KLR ILRYLGTCDGNM+ G++RADVNVSVCRPG+           
Sbjct: 175 RPDIRGPEEAAAYVAKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AI+YEARRQIAILEDGG + QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIDYEARRQIAILEDGGKVVQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPDAK+ RF+ ++G++ YDA+VL ++   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQGWVDEIAASMPELPDAKKARFMADYGVTDYDANVLTAELDA 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE++A  RD K  ANWVIN+L G LN+ G +I D P+   QLG ++DLI  G ISGK
Sbjct: 355 AAYFEEVARGRDGKQAANWVINELFGRLNKQGLTIADPPVKAGQLGGVLDLIASGEISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           +AKD+F ILW +GG P E+    G++QVTD  AIE  VDE+I +NP  V +    P L  
Sbjct: 415 MAKDLFEILWTEGGDPAEVAAARGMKQVTDTGAIETAVDEIIAANPAQVEKAKANPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
           WFVGQV+K TGGKANP+ V +++ +KLG+
Sbjct: 475 WFVGQVIKATGGKANPAAVNQIVAQKLGL 503


>gi|254476166|ref|ZP_05089552.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ruegeria sp. R11]
 gi|214030409|gb|EEB71244.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ruegeria sp. R11]
          Length = 503

 Score =  565 bits (1455), Expect = e-159,   Method: Composition-based stats.
 Identities = 293/508 (57%), Positives = 371/508 (73%), Gaps = 17/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+      + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDL-TYELPKPKVIAGAKHDWELVIGMEVHAQVSSNAKLFSGASTKFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPVINEYCVEQAVRTGLGLKAEINLWSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +       V +ERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV+
Sbjct: 120 EGEVLVELGDGTA-----RLVRVERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A++ KLR I++YLGTCDGNM+ G++RADVNVS+CRPG+           
Sbjct: 175 RPDIRGPEEAAAYIAKLRQIMQYLGTCDGNMQNGNLRADVNVSICRPGQYEKYQETGDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIE EARRQIAI+E GG + QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIEVEARRQIAIVEAGGTVDQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPD K+ RFI +FG+S YDASVL +D   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAANLPELPDEKKARFINDFGLSDYDASVLTADVES 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A +FE+ A  R  K+ ANWVIN+L G L +   SI ++P+SP QLG +IDLI    ISGK
Sbjct: 355 AAFFEETAKGRSGKLAANWVINELFGRLKKEDHSITESPVSPAQLGGIIDLISSDAISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F I++ +GG P +IVEE G++QVTD  AIE  +DE+I +NP  V +    P L  
Sbjct: 415 IAKDLFEIVYTEGGDPAQIVEERGMKQVTDTGAIEAALDEIIAANPAQVEKAKVNPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           WFVGQVMK TGGKANP  V +++ +KLG
Sbjct: 475 WFVGQVMKATGGKANPKAVNELVAKKLG 502


>gi|56551678|ref|YP_162517.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|241761201|ref|ZP_04759289.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|56543252|gb|AAV89406.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|241374108|gb|EER63605.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 511

 Score =  565 bits (1455), Expect = e-159,   Method: Composition-based stats.
 Identities = 273/492 (55%), Positives = 358/492 (72%), Gaps = 13/492 (2%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
           + +  G TG WE+V+G+EVHAQ+   SKLFSGA+  FGAEPN+QVS  DAAMPGMLP++N
Sbjct: 24  KYILEGATGSWEIVVGLEVHAQVISKSKLFSGAATAFGAEPNSQVSLIDAAMPGMLPVVN 83

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             C++QAV TGL + A IN+ S F RKNYFY DLPQGYQISQ   PIVGEG + + +  +
Sbjct: 84  RECIRQAVRTGLAIGAVINRVSKFDRKNYFYADLPQGYQISQLYHPIVGEGSLLIDVDGE 143

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
           +       E+GIERIH+EQDAGK +HDQ+   S +DLNR+G+ALMEIV+KPD+RS  EA 
Sbjct: 144 E------REIGIERIHVEQDAGKLMHDQHPDKSYVDLNRAGIALMEIVSKPDIRSPAEAG 197

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A++ KLR+ILRY+G+CDGNMEEGSMRADVNVSV + GE +GTRCE+KNVNS+RF+  AIE
Sbjct: 198 AYIRKLRAILRYVGSCDGNMEEGSMRADVNVSVRKAGEPFGTRCEIKNVNSVRFVQAAIE 257

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
           YEARRQI ++EDGG I QETRLFD  K ETRSLR+KEDA DYRYF +PDLLPLE+ E FI
Sbjct: 258 YEARRQIEVIEDGGEIIQETRLFDHDKGETRSLRSKEDAHDYRYFPDPDLLPLELPESFI 317

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN------RDKKIV 365
              ++ +PELPD KR+R+I +  ++ Y ASV+ +D   A +FE +         +     
Sbjct: 318 DECRESLPELPDTKRQRYITQLNLTPYTASVITADHETAAWFEAMLEYFKAPDAKIATAA 377

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ANW+ +DL G L + G+ I D+P+SP Q  EL+ L+ DGT+SG +AK +F I+ E G  P
Sbjct: 378 ANWLTSDLFGALKKLGRDITDSPVSPKQGAELVGLVADGTLSGSLAKQVFEIMLESGQDP 437

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKAN 484
             IVEE GL+Q +D  AIE+V+++++  N + V +    K  L  +FVGQ M+  GGKAN
Sbjct: 438 AVIVEERGLKQTSDTGAIEEVINKILADNQDKVEQYRSGKDKLFGFFVGQTMRAMGGKAN 497

Query: 485 PSIVQKMLKEKL 496
           P++V ++LK+ L
Sbjct: 498 PAVVNEILKKLL 509


>gi|312128131|ref|YP_003993005.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311778150|gb|ADQ07636.1| glutamyl-tRNA(Gln) amidotransferase, B subunit
           [Caldicellulosiruptor hydrothermalis 108]
          Length = 480

 Score =  565 bits (1455), Expect = e-159,   Method: Composition-based stats.
 Identities = 231/483 (47%), Positives = 323/483 (66%), Gaps = 12/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++EVVIG+EVHA+L+  SK+F   +  FG EPNT        MPG+LP+LN + V+ A+
Sbjct: 1   MEYEVVIGLEVHAELATKSKIFCSCTTEFGGEPNTHCCPICTGMPGVLPVLNKKAVEYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           M GL  N  I +YS   RKNYFYPDLP+ YQISQ+D P+   G + + +   K       
Sbjct: 61  MAGLATNCQIARYSKQDRKNYFYPDLPKAYQISQYDLPLCYNGYIDIEVNGQK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI+RIH+E+DAGK +HDQ+   S +D NR GV L+EIVT+PD+RSS E + FL KL++
Sbjct: 115 RIGIKRIHIEEDAGKLLHDQWEEGSLVDFNRCGVPLIEIVTEPDLRSSEETRIFLEKLKA 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL+Y    D  M+EGS+R DVN+SV     + +GTR E+KN+NS R +  AIEYEARRQI
Sbjct: 175 ILQYTEISDCKMQEGSLRVDVNLSVRPKGSKEFGTRTEMKNLNSFRSVVRAIEYEARRQI 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE GG + QETR +D +K  + S+RTKE+A DYRYF EPDL P+ +D+++I  I+K+I
Sbjct: 235 EVLESGGVVVQETRRWDDAKGISLSMRTKEEAHDYRYFPEPDLPPIIVDDNWIEEIRKRI 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDLLGVL 377
           PELPD K+ER+I E+G+  YDA VL S K+IA+YFE+        K  +NW++ +++ +L
Sbjct: 295 PELPDQKKERYIKEYGLPEYDAGVLTSSKAIANYFEECIKYTQNIKAASNWMMGEIMRIL 354

Query: 378 NRSG---KSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
           N  G   + I++  I PNQL  LI+L+ + TIS  IAK +F  ++E G  P+ IV+E GL
Sbjct: 355 NDKGLEPEEIDNIKIKPNQLASLINLVDNKTISNTIAKQVFEEMFETGKDPEVIVKEKGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            Q+TD + I + V + I +NP +V      K     + VGQVMK T GKANP +V ++L+
Sbjct: 415 VQITDRNVILEAVKQAIANNPKSVEDYKNGKDKAFGFLVGQVMKITKGKANPQLVNEILR 474

Query: 494 EKL 496
           E+L
Sbjct: 475 EEL 477


>gi|167465165|ref|ZP_02330254.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Paenibacillus
           larvae subsp. larvae BRL-230010]
 gi|322383062|ref|ZP_08056890.1| aspartyl/glutamyl-tRNA amidotransferase subunit B-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
 gi|321152831|gb|EFX45456.1| aspartyl/glutamyl-tRNA amidotransferase subunit B-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
          Length = 482

 Score =  565 bits (1455), Expect = e-159,   Method: Composition-based stats.
 Identities = 220/485 (45%), Positives = 313/485 (64%), Gaps = 9/485 (1%)

Query: 15  TSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRC 74
            SGT   +E VIG+EVH +L   +K+F G S +FGA PNT         PG+LP+LN + 
Sbjct: 1   MSGTGNKFETVIGLEVHVELHTKTKIFCGCSTSFGAPPNTHTCPVCLGHPGVLPVLNRQA 60

Query: 75  VQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSG 134
           V  A+   + LN  I + + F RKNYFYPD P+ YQISQ+DKPI   G + + +  +   
Sbjct: 61  VDYAIKAAMALNCQIAEETKFDRKNYFYPDSPKAYQISQYDKPIGEHGWIEIEVNGN--- 117

Query: 135 QFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFL 194
              T  +GI R+HLE+DAGK  H +  +VS +D NR G  L+EIV++PD+RS  EA+A+L
Sbjct: 118 ---TKRIGITRLHLEEDAGKLTHVEGGSVSLVDFNRVGTPLIEIVSEPDLRSPEEARAYL 174

Query: 195 TKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYE 253
            KL++I++Y    D  MEEGS+R D N+S+       +GT+ E+KN+NS R +   +EYE
Sbjct: 175 EKLKAIMQYCDVSDVKMEEGSLRCDANISLRPVGQAEFGTKAELKNMNSFRGVQRGLEYE 234

Query: 254 ARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRA 313
             RQ  +LEDG  + QETR +D ++ +T S+R+KE+A DYRYF +PDL+ + IDE++   
Sbjct: 235 VIRQTELLEDGEKVVQETRRWDEAQGKTLSMRSKEEAHDYRYFPDPDLVKVYIDEEWKER 294

Query: 314 IKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVIND 372
           I+  IPELPDA++ R+I ++G+  YDA +L S   +A++FE+      D K+V+NWV+ +
Sbjct: 295 IRNTIPELPDARKARYIRDYGLPSYDAEILTSSLKLAEFFEESLEYTADAKMVSNWVMGE 354

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEEL 432
           LLG LN +   I D  ++   LGE+I LI  GTIS KIAK +F  + E G  P++IVEE 
Sbjct: 355 LLGYLNANNLEITDVKVTGKGLGEMIGLIEKGTISSKIAKTVFKEMIETGKAPQQIVEEK 414

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL Q++D  AI+ VV++VI +NP +VA     K   V + VGQVMK T GKANP +V K+
Sbjct: 415 GLVQISDEGAIQAVVNQVIQNNPQSVADYKAGKEKAVGFLVGQVMKETRGKANPGLVNKL 474

Query: 492 LKEKL 496
           +   L
Sbjct: 475 IVNTL 479


>gi|126726644|ref|ZP_01742484.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacterales
           bacterium HTCC2150]
 gi|126703973|gb|EBA03066.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacterales
           bacterium HTCC2150]
          Length = 504

 Score =  565 bits (1455), Expect = e-159,   Method: Composition-based stats.
 Identities = 294/508 (57%), Positives = 364/508 (71%), Gaps = 18/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L     +   + +G  GDWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDLAYENPKP-KVIAGAKGDWELVIGLEVHAQVATSAKLFSGASTKFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           A MPGMLP++N  CV QAV TGLGLNA IN +S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AGMPGMLPVINEGCVSQAVRTGLGLNAEINLFSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G  ++       V IERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV+
Sbjct: 120 EGEVLVEMGNGQA-----RLVRIERIHLEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GE 229
           +PD+R   EA AF+ KLR ILRYLGTCDGNM+ G+MRADVNVSVC+P             
Sbjct: 175 RPDVRGPEEAAAFVGKLRQILRYLGTCDGNMQNGNMRADVNVSVCKPGDYEKYQATQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AI  EA RQIAILEDGG + QETRL+D  KNETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQAAIMVEANRQIAILEDGGSVDQETRLYDADKNETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF  PDLLPLEI++ ++  IK  +PELPDAK+ RFI +F +S YDASVL ++   
Sbjct: 295 AHDYRYFPCPDLLPLEIEQSWVDDIKADLPELPDAKKARFISDFKLSDYDASVLTAEAEN 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKS-IEDTPISPNQLGELIDLIIDGTISG 408
           A YFE++A   D K+ ANWVIN+L G L +     I ++P++P QL  +I LI  G ISG
Sbjct: 355 AAYFEEVANGNDGKLAANWVINELFGRLKKDDDKGISESPVNPAQLAGIISLITKGDISG 414

Query: 409 KIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLV 468
           KIAKD+F I++ +GG P EIVE  G++QVTD  AIE  VD++I  NP  V +      L 
Sbjct: 415 KIAKDLFEIVYTEGGDPSEIVEARGMKQVTDTGAIESAVDKIIAENPAQVEKAKANLKLA 474

Query: 469 SWFVGQVMKNTGGKANPSIVQKMLKEKL 496
            WFVGQVMK TGGKANP  V +++ +KL
Sbjct: 475 GWFVGQVMKATGGKANPKAVNEIVAKKL 502


>gi|297544114|ref|YP_003676416.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|296841889|gb|ADH60405.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
          Length = 475

 Score =  565 bits (1455), Expect = e-159,   Method: Composition-based stats.
 Identities = 213/480 (44%), Positives = 310/480 (64%), Gaps = 10/480 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             +E VIG+EVHA+L   SK+F   +  FG EPNT V      +PG LP+LN + V+ AV
Sbjct: 1   MKYEAVIGLEVHAELLTESKIFCSCTTKFGGEPNTHVCPVCLGLPGTLPVLNKKVVEYAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  I  +S   RKNYFYPDLP+ YQISQ+D P+   G V + +        +  
Sbjct: 61  RAGLALNCTIANFSKMDRKNYFYPDLPKAYQISQYDLPLCSNGYVEIEVDG------KVK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           ++GI+RIH+E+DAGK +H+     S +D NR+GV L+EIV++PD+ +  EA  +LTKL+S
Sbjct: 115 KIGIKRIHIEEDAGKLLHENTDG-SLVDYNRAGVPLIEIVSEPDISTPEEAYQYLTKLKS 173

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL Y    D  M+EGS+R D NVS+        GT+ E+KN+NS R +  A+EYE +RQ+
Sbjct: 174 ILEYTEVSDCKMQEGSLRVDTNVSMRPVGSTDLGTKIELKNLNSFRAVQKALEYEIKRQM 233

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE+GG I QETR ++ +K  T  +RTKE+A DYRYF EPDL+P+ + +++   I+K +
Sbjct: 234 KVLEEGGTIVQETRRWNEAKGITEPMRTKEEAHDYRYFPEPDLVPIIVTDEWKEEIRKSL 293

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVL 377
           PE+P  KRERFI E+G+  YDA ++ S K +AD+FEK A      K V+NW++ +   ++
Sbjct: 294 PEMPHRKRERFIAEYGLPEYDAKIITSSKKMADFFEKCALEYDSPKTVSNWLMGEFSRLM 353

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N +GK I++ P++P  L +L+ LI +G ISG IAK +F  ++  G  P+ IVEE GL+Q+
Sbjct: 354 NETGKEIDEVPVTPQMLVKLLKLIDNGVISGSIAKTVFEEMFGTGKEPEVIVEEKGLKQI 413

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
            +   + +++ +VI  NP +V      K   + + VGQVMK T GKANP +  ++LKE+L
Sbjct: 414 ANEDELREIIKKVIAENPKSVEDYKNGKEKAMGFLVGQVMKATKGKANPQLTNQILKEEL 473


>gi|241766795|ref|ZP_04764620.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Acidovorax
           delafieldii 2AN]
 gi|241362812|gb|EER58573.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Acidovorax
           delafieldii 2AN]
          Length = 484

 Score =  565 bits (1455), Expect = e-159,   Method: Composition-based stats.
 Identities = 230/492 (46%), Positives = 313/492 (63%), Gaps = 13/492 (2%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
           +  +  L  G    +EVVIG E H QL+  SK+FS A   FGAEPNTQ    D A+PG L
Sbjct: 1   MTTTSKLIHG----YEVVIGFETHTQLATQSKIFSRAPTAFGAEPNTQACAVDLALPGTL 56

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P++N   V  A+  GL L +HI   S+FARKNYFYPDLP+GYQISQ + P+V  G+V   
Sbjct: 57  PVMNREAVACAIKLGLALGSHIAPVSIFARKNYFYPDLPKGYQISQFEIPVVQGGEVEFF 116

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
           +G +K        V + R HLE+DAGKS+H+ +   S IDLNR+G  L+EIVT+PDMRSS
Sbjct: 117 LGDEK------KTVRLVRAHLEEDAGKSLHEDFIGQSGIDLNRAGTPLLEIVTEPDMRSS 170

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLG 247
            EA A+  +L  I+ ++G CDGNM+EGS R D NVSV +PG+  GTR E+KN+NS +F+ 
Sbjct: 171 EEAVAYAKELHKIVTWIGICDGNMQEGSFRCDANVSVRKPGQPLGTRREIKNLNSFKFMQ 230

Query: 248 LAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEID 307
            AI+YE R QI  +EDG  I+Q T LFDP   ETR++RTKEDA DYRYF +PDL PL I 
Sbjct: 231 QAIDYEIRWQIEQIEDGHAIQQATVLFDPDTGETRAMRTKEDAADYRYFPDPDLPPLHIS 290

Query: 308 EDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVA 366
           E +++  +  + ELP A   RF+ ++ +  YDA+ L   K++A YFE +       K+ +
Sbjct: 291 ERWVQEERALMAELPRAMAARFVADYSLPEYDATTLTQSKAMAAYFEAVAKACSQPKLAS 350

Query: 367 NWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKG-GTP 425
           NW++ ++   LN +   +E  P+S  QL  LI  I DGTIS   AK +F+ LW       
Sbjct: 351 NWIMGEVSRRLNMAEIGMEQVPVSAAQLAALIARIADGTISNNAAKQVFDALWNGESADV 410

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKAN 484
             ++E  GL+Q+ D  A+EK+VDEVI +N +NVA+    K    +  VGQ+MK + GKAN
Sbjct: 411 DAVIESKGLKQMNDTGALEKIVDEVIAANADNVAQFRAGKDKAFNALVGQIMKASKGKAN 470

Query: 485 PSIVQKMLKEKL 496
           P  V ++L+ +L
Sbjct: 471 PQQVNELLRARL 482


>gi|294012192|ref|YP_003545652.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Sphingobium japonicum UT26S]
 gi|292675522|dbj|BAI97040.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Sphingobium japonicum UT26S]
          Length = 500

 Score =  564 bits (1454), Expect = e-158,   Method: Composition-based stats.
 Identities = 275/500 (55%), Positives = 363/500 (72%), Gaps = 12/500 (2%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
           +  S     G TG+WEVVIG+EVHAQ++  +KLFSGA+  FGAEPNTQVS  DAAMPGML
Sbjct: 1   MTESTYRIQGATGEWEVVIGLEVHAQVTSQAKLFSGAATAFGAEPNTQVSLVDAAMPGML 60

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P+ N  C++QAV TG+ + A INK+S F RKNYFY DLPQGYQISQ   P+VGEG++ +S
Sbjct: 61  PVPNRECIRQAVRTGMAIKAQINKWSRFDRKNYFYADLPQGYQISQLYHPLVGEGEIEIS 120

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
           +   K+    T ++GIERIH+EQDAGK +HDQ+   S +DLNRSGVALMEIV+KPDMRS 
Sbjct: 121 LDD-KNPDAETKKIGIERIHVEQDAGKLMHDQHPTRSYVDLNRSGVALMEIVSKPDMRSP 179

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLG 247
            EA A+L+KLR+ILRY+G+CDGNM++GSMRADVNVSV +PGE +GTR E KNVNS+RF+ 
Sbjct: 180 AEAGAYLSKLRTILRYVGSCDGNMDQGSMRADVNVSVRKPGEPFGTRTETKNVNSVRFVM 239

Query: 248 LAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEID 307
             +E+EA RQ+ +LE GG + QETRL+DP +NETRS+R+KEDA DYRYF +PDLLPLE+D
Sbjct: 240 AVVEHEANRQVDVLEAGGKVVQETRLYDPDRNETRSMRSKEDAHDYRYFPDPDLLPLELD 299

Query: 308 EDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYF----------EKLA 357
           + F+   ++ +PELPDAKR R+  + G+S Y+A+ L +D   A +F          +K +
Sbjct: 300 DAFLEECRQSLPELPDAKRRRYEKDLGLSAYNAATLTADADTARWFEALLAEGARIQKKS 359

Query: 358 VNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNI 417
                K  ANW++++L G LNR GKS+ED+P+ P +  EL+ LI DGTISG IAK +F I
Sbjct: 360 EGEVAKASANWLLSELYGALNRLGKSLEDSPVGPEEGAELLALIADGTISGTIAKQVFEI 419

Query: 418 LWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVM 476
           + E G +  +IVEE GL+Q +D  AIE  V +V+  N + V +    K  L  +FVGQ M
Sbjct: 420 MLETGDSAPKIVEEKGLKQTSDTGAIEAAVAKVLADNGDKVEQYKAGKEALFGFFVGQTM 479

Query: 477 KNTGGKANPSIVQKMLKEKL 496
           K   GKANP +V +++++ L
Sbjct: 480 KAMQGKANPQVVNELIRKAL 499


>gi|226310282|ref|YP_002770176.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brevibacillus brevis NBRC 100599]
 gi|254790944|sp|C0Z4E5|GATB_BREBN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|226093230|dbj|BAH41672.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Brevibacillus brevis NBRC 100599]
          Length = 478

 Score =  564 bits (1454), Expect = e-158,   Method: Composition-based stats.
 Identities = 216/479 (45%), Positives = 308/479 (64%), Gaps = 9/479 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+EVHA+LS  SK+F G    FGA PNT         PG+LP+ N + V+ A+  
Sbjct: 4   YETVIGLEVHAELSTNSKIFCGCPTEFGAPPNTHTCPICLGHPGVLPVTNKQAVEFAMKA 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
            L LN  I++ + F RKNYFYPD P+ YQISQ D+PI   G + + +         T  +
Sbjct: 64  ALALNCEISRETKFDRKNYFYPDSPKAYQISQFDQPIGYNGWIDIEVNG------ETKRI 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R+HLE+DAGK  H  +   S +D NR GV L+EIV++PD+R+  EA+A+L KL++I+
Sbjct: 118 GITRLHLEEDAGKLTHSDFGGESLVDFNRVGVPLVEIVSEPDIRTPEEARAYLEKLKAII 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           +Y    D  ME+GS+R D NVS+     E +GT+ E+KN+NS R + + +EYE  RQ  +
Sbjct: 178 QYTEVSDVRMEQGSLRCDANVSIRPYGQEEFGTKAELKNMNSFRNVQMGLEYEVLRQTEV 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +  GG + QETR +D +  +T ++R+KE+A DYRYF +PDL+ ++I E++I A++  IPE
Sbjct: 238 VSSGGKVVQETRRWDEANKKTLTMRSKEEAHDYRYFPDPDLVRMQISEEWIEAVRATIPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVLNR 379
           LPDA++ R++ EFG+S  DA V+   K  AD+F++      + K VANW++ DLL  LN 
Sbjct: 298 LPDARQARYVNEFGLSKDDAGVITISKETADFFDETVKTGAEPKSVANWLMVDLLAHLNA 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           +     D  ++P  LGE+I LI DGTIS KIAK +F  + E G  PK+IVEE GL Q++D
Sbjct: 358 NNLVFADVKMTPKGLGEMIKLIEDGTISSKIAKTVFKEMVETGKEPKQIVEEKGLVQISD 417

Query: 440 LSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
             A+ +VV + +NSNP  VA          ++FVGQVMK T GKANP +V K+++E L 
Sbjct: 418 EGALRQVVVDAVNSNPQAVADFKSGNEKAAAFFVGQVMKQTKGKANPGMVNKLIQEVLN 476


>gi|89054357|ref|YP_509808.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Jannaschia sp.
           CCS1]
 gi|109892028|sp|Q28R79|GATB_JANSC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|88863906|gb|ABD54783.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Jannaschia sp. CCS1]
          Length = 503

 Score =  564 bits (1454), Expect = e-158,   Method: Composition-based stats.
 Identities = 298/508 (58%), Positives = 361/508 (71%), Gaps = 17/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+      + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDL-TYDTPKPRVIAGAKQDWELVIGMEVHAQVSTRAKLFSGASTRFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           A MPGMLP++N  CV QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AGMPGMLPVINEACVSQAVRTGLGLKAQINLESAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G           V IERIHLEQDAGKSIHD   A+S +DLNR+GVALMEIV+
Sbjct: 120 EGEVLVELGD-----GLARLVRIERIHLEQDAGKSIHDMDPALSFVDLNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           KPD+RS  EA A++ KLR I+ YLGTCDGNM+ G++RADVNVS+C PG+           
Sbjct: 175 KPDIRSPEEAAAYVVKLRQIMLYLGTCDGNMQNGNLRADVNVSICAPGQYEKYQATQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIE EA+RQIAI+E GG + QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIEVEAKRQIAIIEGGGTVDQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPL  D+ ++ AI   +PELPDAK+ RFI  FG+S YDASVL +D   
Sbjct: 295 AHDYRYFPDPDLLPLTFDQAYVDAIAADLPELPDAKKARFIRGFGLSDYDASVLTADIDA 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE  A     K+ ANWVIN+L G L +  + IED+P++P QL  LI LI   TISGK
Sbjct: 355 AQYFEATATKDTGKLSANWVINELFGRLKKDERQIEDSPVAPAQLASLIALIASDTISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F I +  G  P EIVE  GL+QVTD  AIE  VD++I  NP  VA+    P L  
Sbjct: 415 IAKDVFEISYTTGRDPSEIVETEGLKQVTDTGAIEAAVDQIIADNPAQVAKAQENPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           WFVGQVMK TGGKANP  V +++ +KLG
Sbjct: 475 WFVGQVMKATGGKANPKAVNQIVAQKLG 502


>gi|312622941|ref|YP_004024554.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312203408|gb|ADQ46735.1| glutamyl-tRNA(Gln) amidotransferase, B subunit
           [Caldicellulosiruptor kronotskyensis 2002]
          Length = 480

 Score =  564 bits (1454), Expect = e-158,   Method: Composition-based stats.
 Identities = 230/483 (47%), Positives = 322/483 (66%), Gaps = 12/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++EVVIG+EVHA+L+  SK+F   +  FG EPNT        MPG+LP+LN + V+ A+
Sbjct: 1   MEYEVVIGLEVHAELATKSKIFCSCTTEFGGEPNTHCCPICTGMPGVLPVLNKKAVEYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           M GL  N  I +YS   RKNYFYPDLP+ YQISQ+D P+   G + + +   K       
Sbjct: 61  MAGLATNCQIARYSKQDRKNYFYPDLPKAYQISQYDLPLCYNGYIDIEVNGQK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI+RIH+E+DAGK +HDQ+   S +D NR GV L+EIVT+PD+RSS E + FL KL++
Sbjct: 115 RIGIKRIHIEEDAGKLLHDQWEEGSLVDFNRCGVPLIEIVTEPDLRSSEETRIFLEKLKA 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL+Y    D  M+EGS+R DVN+SV     + +GTR E+KN+NS R +  AIEYEA+RQI
Sbjct: 175 ILQYTEVSDCKMQEGSLRVDVNLSVRPKGSKEFGTRTEMKNLNSFRSVVRAIEYEAKRQI 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE GG + QETR +D +K  + S+R+KE+A DYRYF EPDL P+ +DE++I  I+K+I
Sbjct: 235 EVLESGGVVVQETRRWDDAKGISLSMRSKEEAHDYRYFPEPDLPPIIVDEEWIEEIRKRI 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDLLGVL 377
           PELPD K+ER+I E+G+  YDA VL S K+IA+YFE+        K  +NW++ +++ +L
Sbjct: 295 PELPDQKKERYIKEYGLPEYDAGVLTSSKAIANYFEECIKYTQNIKAASNWMMGEIMRIL 354

Query: 378 NRSG---KSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
           N  G   + I +  I PNQL  LI+L+ + TIS  IAK +F  ++E G  P+ IV+E GL
Sbjct: 355 NDKGLEPEEINNIKIKPNQLASLINLVDNKTISNTIAKQVFEEMFETGKDPEVIVKEKGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            Q+TD + I + V + I +NP +V      K     + VGQVMK T GKANP +V ++L+
Sbjct: 415 VQITDRNVILEAVKQAIANNPKSVEDYKNGKDKAFGFLVGQVMKITKGKANPQLVNEILR 474

Query: 494 EKL 496
           E+L
Sbjct: 475 EEL 477


>gi|302871354|ref|YP_003839990.1| glutamyl-tRNA(Gln) amidotransferase, B subunit
           [Caldicellulosiruptor obsidiansis OB47]
 gi|302574213|gb|ADL42004.1| glutamyl-tRNA(Gln) amidotransferase, B subunit
           [Caldicellulosiruptor obsidiansis OB47]
          Length = 480

 Score =  564 bits (1454), Expect = e-158,   Method: Composition-based stats.
 Identities = 229/483 (47%), Positives = 320/483 (66%), Gaps = 12/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++EVVIG+EVHA+L+  SK+F   +  FG EPNT        MPG+LP+LN + V+  +
Sbjct: 1   MEYEVVIGLEVHAELATKSKIFCSCTTEFGGEPNTHCCPICTGMPGVLPVLNKKAVEYVI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           M GL  N  I +YS   RKNYFYPDLP+ YQISQ+D P+   G + + +   K       
Sbjct: 61  MAGLATNCQIARYSKQDRKNYFYPDLPKAYQISQYDLPLCYNGYIDIEVNGQK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI+RIH+E+DAGK +HDQ+   S +D NR GV L+EIVT+PD+RSS E + FL KL++
Sbjct: 115 RIGIKRIHIEEDAGKLLHDQWEEGSLVDFNRCGVPLIEIVTEPDLRSSEETRVFLEKLKA 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL+Y    D  M+EGS+R DVN+SV     + +GTR E+KN+NS R +  AIEYEARRQI
Sbjct: 175 ILQYTEVSDCKMQEGSLRVDVNLSVRPKGSKEFGTRTEMKNLNSFRSVVRAIEYEARRQI 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE GG + QETR +D +K  + S+RTKE+A DYRYF EPDL P+ +D+ +I  I+K+I
Sbjct: 235 EVLESGGVVVQETRRWDDAKGISLSMRTKEEAHDYRYFPEPDLPPIVVDDSWIEEIRKRI 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDLLGVL 377
           PELPD K+ER+I E+G+  YDA VL S K+IA +FE+        K  +NW++ +++ +L
Sbjct: 295 PELPDQKKERYIREYGLPEYDAGVLTSSKAIASFFEECIKYTQNIKAASNWMMGEIMRIL 354

Query: 378 NRSG---KSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
           N  G   + I++  I PNQL  LI+L+ + TIS  IAK +F  +++ G  P+ IV+E GL
Sbjct: 355 NDKGLEPEEIDNIKIKPNQLASLINLVDNKTISNTIAKQVFEEMFDTGKDPEVIVKEKGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            Q+TD + I + V + I +NP +V      K     + VGQVMK T GKANP +V ++LK
Sbjct: 415 VQITDRNVILEAVKQAIANNPKSVEDYKNGKDKAFGFLVGQVMKITKGKANPQLVNEILK 474

Query: 494 EKL 496
           E+L
Sbjct: 475 EEL 477


>gi|170079130|ref|YP_001735768.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Synechococcus
           sp. PCC 7002]
 gi|229487446|sp|B1XKN8|GATB_SYNP2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|169886799|gb|ACB00513.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Synechococcus sp. PCC 7002]
          Length = 496

 Score =  564 bits (1454), Expect = e-158,   Method: Composition-based stats.
 Identities = 222/492 (45%), Positives = 312/492 (63%), Gaps = 9/492 (1%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           + +    ++E +IG+E H QL+  SK+F   S  F ++PN+ V       PG+LP+LN +
Sbjct: 3   VAAPRKTEYEAIIGLETHCQLNTASKIFCHCSTKFDSDPNSNVCPVCLGYPGVLPVLNEK 62

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
            ++ AV  GL L A I+ YS F RK YFYPDLP+ YQISQ D PIV  G + + I    S
Sbjct: 63  VLESAVKMGLALKAKISPYSKFDRKQYFYPDLPKNYQISQFDLPIVEHGHLEIEIADKPS 122

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
                  +G+ R+H+E+DAGK +H        S  S +D NR+G+ L+EIV++PD+RS  
Sbjct: 123 DPPVKKTIGVTRLHMEEDAGKLVHAGSDRLAGSTYSKVDFNRTGIPLLEIVSEPDIRSGK 182

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLG 247
           EA  +  +LR ++RYLG  DGNM+EGS+R DVN+S+     E +GT+ E+KN+NS   + 
Sbjct: 183 EAAEYAQELRRLVRYLGIGDGNMQEGSLRCDVNISIRPVGQEEFGTKVEIKNMNSFSAIQ 242

Query: 248 LAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEID 307
            AI+YE  RQI  +E G  I QETRL+D S   T S+R KE + DYRYF EPDL P+E+ 
Sbjct: 243 KAIDYEIERQIKAVETGEPIYQETRLWDESSQRTFSMRKKEGSSDYRYFPEPDLPPIEVT 302

Query: 308 EDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVA 366
              +     ++PE P  KRER+  E+G+S YD  VL  D+ +A+YFE  +A   D K V 
Sbjct: 303 PAQLEKWAAELPETPAQKRERYETEYGLSSYDTRVLTDDRDVAEYFEAAVAAGADPKQVT 362

Query: 367 NWVINDLLGVLNRS-GKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           NWV  D+   LN++ G +I + P+   QL EL++LI DGTISGKIAK+I   L E+GG+P
Sbjct: 363 NWVTQDIAAHLNKNVGLTIVELPLKATQLAELVNLIHDGTISGKIAKEILPELLEQGGSP 422

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKAN 484
           K IVE  GL Q++D  A+E +VDEV+ +NP  V +    K  L  +FVGQ+MK T G+A+
Sbjct: 423 KAIVESRGLTQISDTGALEAMVDEVLAANPEKVEQFRAGKTKLQGFFVGQLMKKTSGRAD 482

Query: 485 PSIVQKMLKEKL 496
           P ++ ++L +KL
Sbjct: 483 PKLLNQILAQKL 494


>gi|307292657|ref|ZP_07572503.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sphingobium
           chlorophenolicum L-1]
 gi|306880723|gb|EFN11939.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sphingobium
           chlorophenolicum L-1]
          Length = 500

 Score =  564 bits (1454), Expect = e-158,   Method: Composition-based stats.
 Identities = 276/501 (55%), Positives = 361/501 (72%), Gaps = 12/501 (2%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
           +  S     G TG+WEVVIG+EVHAQ++  +KLFSGA+  FGAEPNTQVS  DAAMPGML
Sbjct: 1   MTESTYRIQGATGEWEVVIGLEVHAQVTSEAKLFSGAATAFGAEPNTQVSLVDAAMPGML 60

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P+ N  C++QAV TG+ + A INK+S F RKNYFY DLPQGYQISQ   P+VGEG + +S
Sbjct: 61  PVPNRECIRQAVRTGMAIEAQINKWSRFDRKNYFYADLPQGYQISQLYHPLVGEGAIEIS 120

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
           +   K+    T  +GIERIH+EQDAGK +HDQ+   S +DLNRSGVALMEIV+KPDMRS 
Sbjct: 121 LDD-KNPDAVTKRIGIERIHVEQDAGKLMHDQHPTRSYVDLNRSGVALMEIVSKPDMRSP 179

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLG 247
            EA A+L+KLR+ILRY+G+CDGNM++GSMRADVNVSV +PGE +GTR E KNVNS+RF+ 
Sbjct: 180 AEAGAYLSKLRTILRYVGSCDGNMDQGSMRADVNVSVRKPGEEFGTRTETKNVNSVRFVM 239

Query: 248 LAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEID 307
             +E+EA RQ+ +LE GG + QETRL+DP +NETRS+R+KEDA DYRYF +PDLLPLE+D
Sbjct: 240 AVVEHEANRQVDVLEAGGKVVQETRLYDPDRNETRSMRSKEDAHDYRYFPDPDLLPLELD 299

Query: 308 EDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK----- 362
           + F+   ++ +PELPDAKR R+  + G+S Y+A+ L +D   A +FE L     +     
Sbjct: 300 DAFLEECRQSLPELPDAKRRRYEQDLGLSAYNAATLTADADTARWFEALLAEGARIQKKS 359

Query: 363 -----KIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNI 417
                K  ANW++++L G LNR GKS+ED+P+ P +  EL+ LI DGTISG IAK +F I
Sbjct: 360 ESEVAKASANWLLSELYGALNRLGKSLEDSPVGPEEGAELLALIADGTISGTIAKQVFEI 419

Query: 418 LWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVM 476
           + E G    ++VEE GL+Q +D  AIE  V +V+  N + V +    K  L  +FVGQ M
Sbjct: 420 MLETGERAPKVVEEKGLKQTSDTGAIEAAVAKVLADNGDKVEQYKAGKEALFGFFVGQTM 479

Query: 477 KNTGGKANPSIVQKMLKEKLG 497
           K   GKANP +V +++++ LG
Sbjct: 480 KAMQGKANPQVVNELIRKALG 500


>gi|160895800|ref|YP_001561382.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Delftia acidovorans
           SPH-1]
 gi|160361384|gb|ABX32997.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Delftia acidovorans
           SPH-1]
          Length = 481

 Score =  564 bits (1453), Expect = e-158,   Method: Composition-based stats.
 Identities = 232/487 (47%), Positives = 313/487 (64%), Gaps = 13/487 (2%)

Query: 13  SLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNG 72
            L  G    +EVVIG E HAQL+  SK+FS AS  FGAEPNTQ    D A+PG LP++N 
Sbjct: 4   KLIQG----YEVVIGFETHAQLATQSKIFSRASTAFGAEPNTQACAVDMALPGTLPVMNK 59

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
           + V+ A+  GL L +HI   S+FARKNYFYPDLP+GYQISQ + P+V  G+VS  +G +K
Sbjct: 60  KAVECAIRLGLALGSHIAPRSIFARKNYFYPDLPKGYQISQFEIPVVQGGEVSFFLGDEK 119

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKA 192
                   + + R HLE+DAGKS+H+ +   S IDLNR+G  L+EIVT+PD+RS+ EA A
Sbjct: 120 ------KTIRLVRAHLEEDAGKSLHEDFIGQSGIDLNRAGTPLLEIVTEPDIRSTEEAVA 173

Query: 193 FLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEY 252
           +   L  I+ ++G CDGNM+EGS R D NVSV +PG+  GTR E+KN+NS + + LAI+Y
Sbjct: 174 YAKTLHQIVTWIGICDGNMQEGSFRCDANVSVRKPGQPLGTRREIKNLNSFKNMQLAIDY 233

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           E R QI  +EDG  I+Q T LFDP   ETRS+RTKEDA DYRYF +PDL PL +  +++ 
Sbjct: 234 EIRWQIEEIEDGRRIQQATVLFDPDTGETRSMRTKEDAADYRYFPDPDLPPLVVAPEWVE 293

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVIN 371
            ++  +PELP A   RF+ ++ +  YDA+ L   +++A YFE         K+ +NW++ 
Sbjct: 294 QVRADMPELPRAMAARFVEQYALPEYDATTLTQSQAMAAYFEDTARACNAPKLASNWIMG 353

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG-TPKEIVE 430
           ++   LN     +E   +S  QL  LI  I DGTIS   AK +F  LW   G     I+E
Sbjct: 354 EISRRLNTEEIGMEAAKVSSAQLAALIQRIGDGTISNNAAKQVFEALWSGEGSDVDAIIE 413

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GL+Q+ D  A+EK++DEVI +NP NV +    K    +  VGQVMK + GKANP+ V 
Sbjct: 414 AKGLKQMNDTGAMEKIIDEVIAANPANVEQYRAGKDKAFNALVGQVMKASKGKANPAQVN 473

Query: 490 KMLKEKL 496
           ++LK KL
Sbjct: 474 ELLKAKL 480


>gi|258543590|ref|YP_003189023.1| aspartyl/glutamyl-tRNA amidotransferase subunit beta [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256634668|dbj|BAI00644.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256637724|dbj|BAI03693.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256640778|dbj|BAI06740.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643833|dbj|BAI09788.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646888|dbj|BAI12836.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649941|dbj|BAI15882.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652931|dbj|BAI18865.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256655985|dbj|BAI21912.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 484

 Score =  564 bits (1453), Expect = e-158,   Method: Composition-based stats.
 Identities = 277/487 (56%), Positives = 356/487 (73%), Gaps = 6/487 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
             +  G TG WE+V+G+EVHAQ+   SKLFSGAS  FG +PNTQVS  DAA PGMLP++N
Sbjct: 2   SYVIEGKTGPWEIVVGLEVHAQVISQSKLFSGASTKFGGDPNTQVSLVDAAFPGMLPVIN 61

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QA+ TGLGLNA IN +S F RKNYFY DLPQGYQISQ + PI+G+G + + +   
Sbjct: 62  KECVAQAIRTGLGLNAQINLFSRFDRKNYFYADLPQGYQISQFEHPIIGKGSIEIEL--- 118

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
                 T ++GI R+HLEQDAGK +HDQ    S +DLNR+GVALMEIV++PD+R   EA 
Sbjct: 119 --QSGETRQIGITRLHLEQDAGKLLHDQDPTKSFVDLNRAGVALMEIVSEPDIREPEEAG 176

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A+L KLR ILRYLGTCDGNMEEGSMRADVNVSV + GE + TRCE+KNVNSIRF+  AIE
Sbjct: 177 AYLRKLRQILRYLGTCDGNMEEGSMRADVNVSVRKAGEPFRTRCEIKNVNSIRFVMQAIE 236

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
            EA RQI I E+GG + QETRLFDP + ETR++R+KEDA DYRYF +PDLLPL +++ ++
Sbjct: 237 VEATRQIEIWENGGEVDQETRLFDPGRGETRTMRSKEDAHDYRYFPDPDLLPLVVEQAWV 296

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
             +K ++PELPDAKR RF  ++GI  YDA VLV+++++AD++E +A  RD K+ A+WVI 
Sbjct: 297 DELKSKLPELPDAKRARFQKDYGIPSYDAGVLVAEQAVADFYETVAKGRDGKLAASWVIG 356

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           DL   LNR+  +IE +P+S   LG+++DLI DGTI+GKIAK++F  + E G +P  IVE 
Sbjct: 357 DLFAALNRTSNTIETSPVSAASLGKMLDLIADGTINGKIAKEVFEDMVETGDSPDAIVER 416

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GLRQVTD   I+  +  ++  + + VA     K  L  +FVGQVMK T GKANP++V  
Sbjct: 417 KGLRQVTDTGVIDAAIAAILEKHADKVAEYRGGKDKLFGFFVGQVMKETKGKANPALVNS 476

Query: 491 MLKEKLG 497
            LK +L 
Sbjct: 477 ALKAQLD 483


>gi|302382953|ref|YP_003818776.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193581|gb|ADL01153.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 500

 Score =  563 bits (1452), Expect = e-158,   Method: Composition-based stats.
 Identities = 288/504 (57%), Positives = 361/504 (71%), Gaps = 16/504 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T    + +L  G TG WE+V+G+E+HAQ++  +KLFSGA+V FGA PN QVS  DA  PG
Sbjct: 2   TDTIDTSNLIQGRTGAWEIVMGLEIHAQVASKAKLFSGAAVGFGAGPNEQVSLIDAGFPG 61

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP LN  CV+QAV TGLGLNA INK S F RKNYFYPDLPQGYQISQ   PIVGEG + 
Sbjct: 62  MLPTLNAHCVEQAVKTGLGLNATINKRSQFDRKNYFYPDLPQGYQISQLYFPIVGEGVIE 121

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V              VGIER+HLEQDAGK IHD     S +DLNR+G ALMEIV++PD+R
Sbjct: 122 VEAED-----GSFFNVGIERLHLEQDAGKLIHDLSPTESYVDLNRAGTALMEIVSRPDIR 176

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCR-----------PGEAWGTR 234
           S  EA A++ K+R+IL YLGTCDG+ME+G++RADVNVSVCR                GTR
Sbjct: 177 SPEEAVAYVKKIRTILIYLGTCDGDMEKGNLRADVNVSVCREGQYAKFKATGDFSHLGTR 236

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KNVNS RF+  AI YEARRQI ILEDGG I QETRL+DP+  ETRS+R+KE+A DYR
Sbjct: 237 CEIKNVNSFRFISQAINYEARRQIEILEDGGKIVQETRLYDPTAGETRSMRSKEEANDYR 296

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPLE+++ +I AIK  +PELPD KR R + ++G+S YDA VL S+++ ADYFE
Sbjct: 297 YFPDPDLLPLELEQAWIDAIKANLPELPDDKRRRLMADYGLSQYDAVVLTSEQAKADYFE 356

Query: 355 KLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDI 414
           + A+ RD K+VANWV N+L   L   G+   ++P+    +GEL+ LI +G IS KIAK++
Sbjct: 357 EAAMGRDAKLVANWVTNELSARLAADGRDFSESPLPAAHVGELVALIEEGVISSKIAKEV 416

Query: 415 FNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQ 474
           F+ +W   G+P+ +VE  GL QV D  AIEK VDE+I +NP+  A +A KP  + WFVGQ
Sbjct: 417 FDHVWNGEGSPRAVVEARGLVQVNDTGAIEKAVDEIIAANPDKAAAVAEKPQAIGWFVGQ 476

Query: 475 VMKNTGGKANPSIVQKMLKEKLGI 498
           VMK TGGKANP+   ++LK KLG+
Sbjct: 477 VMKATGGKANPAAANEILKAKLGL 500


>gi|82701457|ref|YP_411023.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrosospira
           multiformis ATCC 25196]
 gi|109892039|sp|Q2YC90|GATB_NITMU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|82409522|gb|ABB73631.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Nitrosospira multiformis ATCC 25196]
          Length = 496

 Score =  563 bits (1452), Expect = e-158,   Method: Composition-based stats.
 Identities = 248/496 (50%), Positives = 338/496 (68%), Gaps = 21/496 (4%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+EVHAQLS  SK+FSGAS  FGA PN +    D A+PG+LP+LN   V++A+
Sbjct: 1   MQWETVIGLEVHAQLSTESKIFSGASTAFGAAPNAEACAVDLALPGVLPVLNRGAVERAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A IN  S+FARKNYFYPDLP+GYQISQ++ P+V  G + + +   + G+ +  
Sbjct: 61  RFGLAVGAKINSPSIFARKNYFYPDLPKGYQISQYELPVVEGGHIQLQV--VQDGKEQEK 118

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PDMRSS EA A+   L +
Sbjct: 119 TVRLVRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDMRSSAEAVAYAKTLHT 178

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++R++G CDGNM+EGS R D NVSV     +  GTRCE+KN+NS RFL  AI+YE RRQ+
Sbjct: 179 LVRWIGICDGNMQEGSFRCDANVSVRPRGSDKLGTRCEIKNLNSFRFLEKAIDYEVRRQV 238

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ILEDGG I+Q+TRLFDP K ETR++R+KEDA DYRYF +PDLLPLEI  ++I  +KK +
Sbjct: 239 EILEDGGSIQQQTRLFDPEKGETRAMRSKEDAQDYRYFPDPDLLPLEISGNWIEEVKKGL 298

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN--RDKKIVANWVINDLLGV 376
           PELP   R RF  ++G+S+YDA +L  D+ I++Y+E +      D K+ ANWV+ ++   
Sbjct: 299 PELPQQIRTRFEHDYGLSMYDALLLTGDRDISEYYEAVVGKLPSDPKLCANWVMGEVSAY 358

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT------------ 424
           LN  GKS +  P+SP QL +L+  I DGTISGKIAKD+F  +W + GT            
Sbjct: 359 LNNEGKSFDVCPLSPAQLAQLLLRIKDGTISGKIAKDVFRQMWAQAGTESISWRNSEGVD 418

Query: 425 ---PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTG 480
                 I++  GLRQ++D SA+E +V EV+ +NP +V      K    +  +GQVMK   
Sbjct: 419 EGLADRIIDSQGLRQISDSSALENLVHEVLAANPKSVEEFKAGKEKAFNALMGQVMKAAR 478

Query: 481 GKANPSIVQKMLKEKL 496
           GKANP+ V ++L++KL
Sbjct: 479 GKANPAQVNEILRKKL 494


>gi|326388347|ref|ZP_08209943.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326207079|gb|EGD57900.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 497

 Score =  563 bits (1452), Expect = e-158,   Method: Composition-based stats.
 Identities = 279/493 (56%), Positives = 355/493 (72%), Gaps = 13/493 (2%)

Query: 15  TSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRC 74
             G TG+WEVVIG+EVHAQ++  +KLFSGA+  FGAEPNTQVS  DAAMPGMLP+ N  C
Sbjct: 6   IQGATGEWEVVIGLEVHAQVTSSAKLFSGAATAFGAEPNTQVSLIDAAMPGMLPVPNREC 65

Query: 75  VQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSG 134
           ++QAV TG+ +NA INK+S F RKNYFY DLPQGYQISQ   P+VGEG V +++   K  
Sbjct: 66  IRQAVRTGIAINAQINKWSRFDRKNYFYADLPQGYQISQLYHPLVGEGSVEIAVDEKKPD 125

Query: 135 QFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFL 194
           +  T  +G+ERIH+EQDAGK +HDQ+  +S +DLNRSGVALMEIV++PDMRS  EA A+L
Sbjct: 126 E--TKTIGVERIHVEQDAGKLMHDQHPTMSYVDLNRSGVALMEIVSRPDMRSPAEAGAYL 183

Query: 195 TKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEA 254
           +KLR+ILRY+G+CDGNM++GSMRADVNVSV RPGE +GTR E KNVNS+RF+  AIEYEA
Sbjct: 184 SKLRTILRYVGSCDGNMDQGSMRADVNVSVRRPGEPFGTRTETKNVNSVRFVMQAIEYEA 243

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
            RQ+ +LE GG I QETRLFDP    TRS+R+KEDA DYRYF +PDLLPLE+ + FI   
Sbjct: 244 NRQVDVLEGGGKIVQETRLFDPDSGTTRSMRSKEDAHDYRYFPDPDLLPLELTDAFIEDC 303

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK----------KI 364
           +  +PELPDAKR R+    G+S Y+A VL ++   A +FEKL     +          + 
Sbjct: 304 RASLPELPDAKRHRYETVLGLSSYNAGVLTAEVETARWFEKLLAESARRQGKSESDVARQ 363

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
            +NW+ ++L GVLN+ GK++ED+P+SP    EL+ L+ DGTISG IAK +   + E G  
Sbjct: 364 ASNWLTSELFGVLNKLGKNLEDSPVSPEAGAELLALVGDGTISGSIAKQVLEKMLETGDA 423

Query: 425 PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKA 483
           P  IVE  GL+Q TD  AIE  VD V+ +N + VA+    K  L  +FVGQ MK   GK 
Sbjct: 424 PGSIVEREGLKQTTDTGAIEAAVDAVLAANADKVAQYKGGKEALFGFFVGQTMKAMQGKG 483

Query: 484 NPSIVQKMLKEKL 496
           NP +V ++LK+KL
Sbjct: 484 NPQLVNQVLKDKL 496


>gi|300692937|ref|YP_003753932.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (asp/glu-ADT subunit B) [Ralstonia solanacearum PSI07]
 gi|299079997|emb|CBJ52672.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Ralstonia solanacearum PSI07]
          Length = 488

 Score =  563 bits (1452), Expect = e-158,   Method: Composition-based stats.
 Identities = 244/487 (50%), Positives = 327/487 (67%), Gaps = 8/487 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E HAQLS  SK+FSGAS  FGA PNTQ +  D A+PG+LP+LN   V++A+
Sbjct: 1   MQWEVVIGLETHAQLSTASKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +           
Sbjct: 61  RFGLAIGATIAPKSIFARKNYFYPDLPKGYQISQYEIPVVQGGTLTIQVEGRNGQPGYEK 120

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L +
Sbjct: 121 TVHLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKALHA 180

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV R P   +GTRCE+KN+NS RFL  AI YE RRQI
Sbjct: 181 LVVWLGICDGNMQEGSFRCDANVSVRRGPDAPFGTRCEIKNLNSFRFLEEAINYEVRRQI 240

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPL I  D++ A++  +
Sbjct: 241 ELIEDGGSVVQETRLYDPDRKETRSMRSKEDAHDYRYFPDPDLLPLMIGSDWVDAVRATL 300

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A   RF   +G+  YDAS+L + K+ A YFE     A   + K   NW++ ++  
Sbjct: 301 PELPVAMAARFESAYGLPRYDASILTATKATAAYFEAVVAAAGAANAKAATNWIMGEVAS 360

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEEL 432
            LNR+G  I+  P+SP QL +L+  I DGTIS   A KD+F  LW  E GG    I+ E 
Sbjct: 361 NLNRAGLEIDAAPVSPEQLAKLLARIADGTISNNTAKKDVFPALWAGEHGGDADAIIAEK 420

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q++D   +EK++DEV+ +N  +V      K    +  VGQ MK T GKANPS V ++
Sbjct: 421 GLKQMSDSGELEKIIDEVLAANAKSVEEFRAGKEKAFNALVGQAMKATRGKANPSQVNEL 480

Query: 492 LKEKLGI 498
           LK+KL  
Sbjct: 481 LKKKLDA 487


>gi|260576332|ref|ZP_05844323.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Rhodobacter sp.
           SW2]
 gi|259021403|gb|EEW24708.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Rhodobacter sp.
           SW2]
          Length = 503

 Score =  563 bits (1452), Expect = e-158,   Method: Composition-based stats.
 Identities = 299/509 (58%), Positives = 373/509 (73%), Gaps = 17/509 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L TH A    + +G   DWE+VIG+E+HAQ+S  +KLFSGAS   GAEPN+ V+F D
Sbjct: 1   MLDL-THTAPKPKVIAGAKHDWELVIGMEIHAQVSSNAKLFSGASTAVGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPVINDYCVEQAVRTGLGLKAQINLVSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
            G+V V + P          V IERIHLEQDAGKSIHD   A+S +D NR+GVALMEIV+
Sbjct: 120 AGEVLVEMAP-----GIARLVRIERIHLEQDAGKSIHDMDPAMSFVDFNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A++ KLR ILRYLGTCDG+M+ G++RADVNVSVCRPG+           
Sbjct: 175 RPDIRGPEEAAAYVVKLRQILRYLGTCDGDMQHGNLRADVNVSVCRPGQYEKYQASQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+ LAI+YEARRQIAILEDGG I+QETRL+DP +NETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQLAIDYEARRQIAILEDGGVIKQETRLYDPDRNETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPL+I++ ++ AI   +PELPDAK+ RFI +FG++ YDASVL +D   
Sbjct: 295 AHDYRYFPDPDLLPLQIEQAWVDAIAASMPELPDAKKARFINDFGLTDYDASVLTADLES 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE +A  RD K  ANWVIN+L G LN+ G  I D+P+S  QLG ++DLI  G ISGK
Sbjct: 355 AGYFEAVAQGRDGKQAANWVINELFGRLNKQGLGIADSPVSSAQLGGILDLIAAGDISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           +AKD+F ++W  GG P E+    G++QVTD  AIE  VDE+I +NP  V +    P L  
Sbjct: 415 MAKDLFELVWTDGGDPAEVAAAHGMKQVTDTGAIEAAVDEIIAANPAQVEKARANPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
           WFVGQV+K +GGKANP +V  ++  KLG+
Sbjct: 475 WFVGQVIKASGGKANPVVVNDLVMRKLGL 503


>gi|260752740|ref|YP_003225633.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
 gi|109892078|sp|Q5NPF4|GATB_ZYMMO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|258552103|gb|ACV75049.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 490

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 273/492 (55%), Positives = 358/492 (72%), Gaps = 13/492 (2%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
           + +  G TG WE+V+G+EVHAQ+   SKLFSGA+  FGAEPN+QVS  DAAMPGMLP++N
Sbjct: 3   KYILEGATGSWEIVVGLEVHAQVISKSKLFSGAATAFGAEPNSQVSLIDAAMPGMLPVVN 62

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             C++QAV TGL + A IN+ S F RKNYFY DLPQGYQISQ   PIVGEG + + +  +
Sbjct: 63  RECIRQAVRTGLAIGAVINRVSKFDRKNYFYADLPQGYQISQLYHPIVGEGSLLIDVDGE 122

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
           +       E+GIERIH+EQDAGK +HDQ+   S +DLNR+G+ALMEIV+KPD+RS  EA 
Sbjct: 123 E------REIGIERIHVEQDAGKLMHDQHPDKSYVDLNRAGIALMEIVSKPDIRSPAEAG 176

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A++ KLR+ILRY+G+CDGNMEEGSMRADVNVSV + GE +GTRCE+KNVNS+RF+  AIE
Sbjct: 177 AYIRKLRAILRYVGSCDGNMEEGSMRADVNVSVRKAGEPFGTRCEIKNVNSVRFVQAAIE 236

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
           YEARRQI ++EDGG I QETRLFD  K ETRSLR+KEDA DYRYF +PDLLPLE+ E FI
Sbjct: 237 YEARRQIEVIEDGGEIIQETRLFDHDKGETRSLRSKEDAHDYRYFPDPDLLPLELPESFI 296

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN------RDKKIV 365
              ++ +PELPD KR+R+I +  ++ Y ASV+ +D   A +FE +         +     
Sbjct: 297 DECRESLPELPDTKRQRYITQLNLTPYTASVITADHETAAWFEAMLEYFKAPDAKIATAA 356

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ANW+ +DL G L + G+ I D+P+SP Q  EL+ L+ DGT+SG +AK +F I+ E G  P
Sbjct: 357 ANWLTSDLFGALKKLGRDITDSPVSPKQGAELVGLVADGTLSGSLAKQVFEIMLESGQDP 416

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKAN 484
             IVEE GL+Q +D  AIE+V+++++  N + V +    K  L  +FVGQ M+  GGKAN
Sbjct: 417 AVIVEERGLKQTSDTGAIEEVINKILADNQDKVEQYRSGKDKLFGFFVGQTMRAMGGKAN 476

Query: 485 PSIVQKMLKEKL 496
           P++V ++LK+ L
Sbjct: 477 PAVVNEILKKLL 488


>gi|329113631|ref|ZP_08242409.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acetobacter pomorum DM001]
 gi|326697038|gb|EGE48701.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acetobacter pomorum DM001]
          Length = 484

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 276/487 (56%), Positives = 355/487 (72%), Gaps = 6/487 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
             +  G TG WE+V+G+EVHAQ+   SKLFSGAS  FG +PNTQVS  DAA PGMLP++N
Sbjct: 2   SYVIEGKTGPWEIVVGLEVHAQVISQSKLFSGASTKFGGDPNTQVSLVDAAFPGMLPVIN 61

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QA+ TGLGLNA IN +S F RKNYFY DLPQGYQISQ + PI+G G + + +   
Sbjct: 62  KECVAQAIRTGLGLNAQINLFSRFDRKNYFYADLPQGYQISQFEHPIIGTGSIEIEL--- 118

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
                 T ++GI R+HLEQDAGK +HDQ  + S +DLNR+GVALMEIV++PD+    EA 
Sbjct: 119 --QSGETRQIGITRLHLEQDAGKLLHDQDPSKSFVDLNRAGVALMEIVSEPDICEPEEAG 176

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A+L KLR ILRYLGTCDGNMEEGSMRADVNVSV + GE + TRCE+KNVNSIRF+  AIE
Sbjct: 177 AYLRKLRQILRYLGTCDGNMEEGSMRADVNVSVRKAGEPFRTRCEIKNVNSIRFVMQAIE 236

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
            EA RQI I E+GG + QETRLFDP + ETR++R+KEDA DYRYF +PDLLPL +++ ++
Sbjct: 237 VEATRQIEIWENGGEVDQETRLFDPGRGETRTMRSKEDAHDYRYFPDPDLLPLVVEQAWV 296

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
             +K ++PELPDAKR RF  ++GI  YDA VLV+++++AD++E +A  RD K+ A+WVI 
Sbjct: 297 DDLKSKLPELPDAKRARFQKDYGIPSYDAGVLVAEQAVADFYETVAKGRDGKLAASWVIG 356

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           DL   LNR+  +IE +P+S   LG+++DLI DGTI+GKIAK++F  + E G +P  IVE 
Sbjct: 357 DLFAALNRTSNTIETSPVSAASLGKMLDLIADGTINGKIAKEVFEDMVETGDSPDAIVER 416

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GLRQVTD   I+  +  ++  + + VA     K  L  +FVGQVMK T GKANP++V  
Sbjct: 417 KGLRQVTDTGVIDSAIAAILEKHADKVAEYRGGKDKLFGFFVGQVMKETKGKANPALVNS 476

Query: 491 MLKEKLG 497
            LK +L 
Sbjct: 477 ALKAQLD 483


>gi|312794119|ref|YP_004027042.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312876335|ref|ZP_07736320.1| glutamyl-tRNA(Gln) amidotransferase, B subunit
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796829|gb|EFR13173.1| glutamyl-tRNA(Gln) amidotransferase, B subunit
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|312181259|gb|ADQ41429.1| glutamyl-tRNA(Gln) amidotransferase, B subunit
           [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 480

 Score =  563 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 233/483 (48%), Positives = 322/483 (66%), Gaps = 12/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++EVVIG+EVHA+L+  SK+F   +  FG EPNT        MPG+LP+LN + V+ A+
Sbjct: 1   MEYEVVIGLEVHAELATKSKIFCSCTTEFGGEPNTHCCPICTGMPGVLPVLNKKAVEYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           M GL  N  I +YS   RKNYFYPDLP+ YQISQ+D P+   G + + +   K       
Sbjct: 61  MAGLATNCQIARYSKQDRKNYFYPDLPKAYQISQYDLPLCYNGYIDIEVNGQK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI+RIH+E+DAGK +HDQ+   S +D NR GV L+EIVT+PD+RSS E + FL KL++
Sbjct: 115 RIGIKRIHIEEDAGKLLHDQWEEGSLVDFNRCGVPLIEIVTEPDLRSSEETRIFLEKLKA 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL+Y    D  M+EGS+R DVN+SV     + +GTR E+KN+NS R +  AIEYEARRQI
Sbjct: 175 ILQYTEVSDCKMQEGSLRVDVNLSVRPKGSKEFGTRTEMKNLNSFRSVVRAIEYEARRQI 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE GG + QETR +D +K  + S+RTKE+A DYRYF EPDL P+ +DE++I  I+K+I
Sbjct: 235 EVLESGGVVVQETRRWDDAKGISLSMRTKEEAHDYRYFPEPDLPPIIVDEEWIEEIRKRI 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDLLGVL 377
           PELPD K+ER+I E+G+  YDA VL S K+IA +FE+        K  +NWV+ +++ +L
Sbjct: 295 PELPDQKKERYIKEYGLPEYDAGVLTSSKAIASFFEECIKYTQNIKAASNWVMGEIMRIL 354

Query: 378 NRSG---KSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
           N  G   + I++  I PNQL  LI+L+ + TIS  IAK +F  ++E G  P+ IV+E GL
Sbjct: 355 NDKGLEPEEIDNIKIKPNQLASLINLVDNKTISNTIAKQVFEEMFETGKDPEVIVKEKGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            Q+TD + I + V + I +NP +V      K     + VGQVMK T GKANP +V ++LK
Sbjct: 415 VQITDRNVILEAVKQAIVNNPKSVEDYKNGKDKAFGFLVGQVMKITKGKANPQLVNEILK 474

Query: 494 EKL 496
           E+L
Sbjct: 475 EEL 477


>gi|307154277|ref|YP_003889661.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Cyanothece sp. PCC
           7822]
 gi|306984505|gb|ADN16386.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Cyanothece sp. PCC
           7822]
          Length = 495

 Score =  563 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 225/487 (46%), Positives = 309/487 (63%), Gaps = 8/487 (1%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
              ++E VIG+E H QL+  SK+F   S  F   PNT V       PG+LP+LN   +  
Sbjct: 7   AKTEYEAVIGLETHCQLNTKSKIFCNCSTEFDTPPNTNVCPICLGYPGVLPVLNLEVLAS 66

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           AV  GL +N  I  YS F RK YFYPDLP+ YQISQ+D PIV  G + + +   ++ +  
Sbjct: 67  AVKLGLAINGTIAPYSKFDRKQYFYPDLPKNYQISQYDLPIVEHGALEIEVVDKETKEVY 126

Query: 138 TIEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKA 192
              +GI R+H+E+DAGK +H        S  S +D NR+GV L+EIV++PD+R+  EA  
Sbjct: 127 RKTIGITRLHMEEDAGKLVHAGSDRLSGSTYSLVDFNRTGVPLLEIVSEPDLRTGQEAAE 186

Query: 193 FLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIE 251
           +  +LR ++RYLG  DGNM+EGS+R DVN+SV R     +GT+ E+KN+NS   +  AIE
Sbjct: 187 YAQELRRLVRYLGIGDGNMQEGSLRCDVNISVRRKGESKFGTKVEIKNMNSFSAIQKAIE 246

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
           YE  RQI  +E+G  IR ETRL++ +K  T S+R+KE A DYRYF EPDL PLE+  + +
Sbjct: 247 YEIDRQIEAIENGEPIRLETRLWEEAKQRTVSMRSKEGASDYRYFPEPDLPPLEVSAEQL 306

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVI 370
              K QIPELP  KR R+  E G+S YDA VL  ++ +A+YFE       + K+VANWV 
Sbjct: 307 EEWKAQIPELPAQKRHRYEEELGLSAYDARVLTDEREVAEYFETAVASGANAKLVANWVT 366

Query: 371 NDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVE 430
            D+   LN +   I D  + P  LGEL++LI  GTISGKIAKDI   L   GG+PK +VE
Sbjct: 367 QDIAAYLNNNKLKITDIALKPEGLGELVNLIEKGTISGKIAKDILPELLTDGGSPKALVE 426

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQ 489
           + GL Q++D   +EK++DEVI S+P  + +    K NL  +FVGQV+K TGG+A+P +  
Sbjct: 427 KKGLIQISDTKELEKIIDEVIASHPQELEKYRSGKKNLKGFFVGQVLKKTGGRADPKLTN 486

Query: 490 KMLKEKL 496
           +++ +KL
Sbjct: 487 QLIDKKL 493


>gi|126660130|ref|ZP_01731249.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Cyanothece sp.
           CCY0110]
 gi|126618573|gb|EAZ89323.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Cyanothece sp.
           CCY0110]
          Length = 495

 Score =  563 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 228/487 (46%), Positives = 314/487 (64%), Gaps = 8/487 (1%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
             ++E +IG+E H QL+  SK+F   S  F + PNT V       PG+LP+LN + +  A
Sbjct: 8   KTEYEAIIGLETHCQLNTTSKIFCHCSTEFDSPPNTNVCPICLGYPGVLPVLNEQVLASA 67

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           V  GL LNA I  YS F RK YFYPDLP+ YQISQ D PIV  G + + +   K+ +   
Sbjct: 68  VKLGLALNAKIASYSKFDRKQYFYPDLPKNYQISQFDLPIVEHGSLEIELVDKKTKEVTR 127

Query: 139 IEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
             +GI R+H+E+DAGK +H        S  S +D NR+GV L+EIV++PD+R+  EA  +
Sbjct: 128 KTIGITRLHMEEDAGKLVHAGSDRLAGSTHSLVDFNRTGVPLLEIVSEPDIRTGQEAAEY 187

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEY 252
             +LR ++RYLG  DGNM+EGS+R DVN+SV     + +GT+ E+KN+NS   +  AIEY
Sbjct: 188 AQELRRLVRYLGVSDGNMQEGSLRCDVNISVRPVGQKEFGTKVEIKNMNSFSAIQKAIEY 247

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           E  RQI  +E+G  I QETRL+D S  ET S+R KE + DYRYF EPDL PLE+ E  + 
Sbjct: 248 EIERQIEAVENGDPIYQETRLWDESSQETFSMRKKEGSSDYRYFPEPDLPPLEVSEKRLN 307

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVIN 371
           A K+++PELP  KR+R+  E G+S YDA VL  D+ +A+Y+E  +    D K+VANWV  
Sbjct: 308 AWKQELPELPAQKRKRYEEELGLSAYDARVLTDDRDVAEYYETAVKKGADAKLVANWVTQ 367

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D+   LN S  SI +  + P+ LGEL+ LI  GTISGKIAK+I   L EKGG+PK+IVE 
Sbjct: 368 DIAAYLNNSKLSITEIALKPDSLGELVQLIEKGTISGKIAKEILPELLEKGGSPKQIVES 427

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            G+ Q++D   IEKV+  ++ +NP+ V +    K  L  +FVGQVMK TGG+A+P +  +
Sbjct: 428 KGMTQISDPGEIEKVIKALMEANPSEVEKYRGGKKKLKGFFVGQVMKETGGRADPKLTNQ 487

Query: 491 MLKEKLG 497
           + ++ L 
Sbjct: 488 LAEKLLN 494


>gi|107024038|ref|YP_622365.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           cenocepacia AU 1054]
 gi|116691125|ref|YP_836748.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           cenocepacia HI2424]
 gi|170734456|ref|YP_001766403.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           cenocepacia MC0-3]
 gi|254246882|ref|ZP_04940203.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Burkholderia
           cenocepacia PC184]
 gi|123244504|sp|Q1BSL3|GATB_BURCA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|166217738|sp|A0KBH8|GATB_BURCH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|229486047|sp|B1K0H6|GATB_BURCC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|105894227|gb|ABF77392.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Burkholderia cenocepacia AU 1054]
 gi|116649214|gb|ABK09855.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Burkholderia cenocepacia HI2424]
 gi|124871658|gb|EAY63374.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Burkholderia
           cenocepacia PC184]
 gi|169817698|gb|ACA92281.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           cenocepacia MC0-3]
          Length = 491

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 243/487 (49%), Positives = 335/487 (68%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++         
Sbjct: 65  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKPAYEK 124

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 125 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHA 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQI 244

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D++  ++  +
Sbjct: 245 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGRDWVERVQSGM 304

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVINDLLG 375
           PELP A ++RF+ E+G+S YDA VL S K++A YFE +       + KIVANW++ D+  
Sbjct: 305 PELPAAMQQRFVDEYGVSAYDAGVLTSSKAMAAYFESVVAKAGAANAKIVANWLMGDVSS 364

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVEE 431
            LNR G  I+  P+S  QL  L+  I DGTIS KIAK+IF  +W++     G    I++ 
Sbjct: 365 QLNRDGIEIDAIPVSAAQLALLLQRIADGTISNKIAKEIFATIWDEKATDEGAADRIIDA 424

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP  V +
Sbjct: 425 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVNE 484

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 485 LLKKKLG 491


>gi|86137653|ref|ZP_01056230.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter sp.
           MED193]
 gi|85825988|gb|EAQ46186.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter sp.
           MED193]
          Length = 503

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 293/508 (57%), Positives = 369/508 (72%), Gaps = 17/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+      + SG   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ VSF D
Sbjct: 1   MLDL-TYELPKPKVISGAKHDWELVIGMEVHAQVSSNAKLFSGASTKFGAEPNSNVSFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPVINEYCVEQAVRTGLGLKAEINLWSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +       V +ERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV+
Sbjct: 120 EGEVLVELGDGTA-----RTVRVERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A++ K+R IL+YLGTCDGNM+ G++RADVNVSVCRPG+           
Sbjct: 175 RPDIRGPEEAAAYIAKIRQILKYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFG 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIE EARRQIAI+E GG + QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIEIEARRQIAIIEAGGEVDQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPDAK+ RFI +F +S YDASVL +D   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAANLPELPDAKKARFIADFKLSDYDASVLTADVES 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE +A  R+ K+ ANWVIN+L G L      I ++P++P QLG +++LI   TISGK
Sbjct: 355 AAYFEAVAEGRNGKLAANWVINELFGRLKADEADIANSPVTPAQLGGIVELISAETISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F I++  GG P +IVEE G++QVTD  AIE  +D++I  NP  V +    P L  
Sbjct: 415 IAKDLFEIVYTTGGDPAQIVEERGMKQVTDTGAIEAALDQIIADNPAQVEKAKVNPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           WFVGQVMK TGGKANP  V +++ +KLG
Sbjct: 475 WFVGQVMKATGGKANPKAVNQLVAQKLG 502


>gi|91776838|ref|YP_546594.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Methylobacillus
           flagellatus KT]
 gi|122399419|sp|Q1GYD4|GATB_METFK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|91710825|gb|ABE50753.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Methylobacillus flagellatus KT]
          Length = 477

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 246/481 (51%), Positives = 319/481 (66%), Gaps = 10/481 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E H QL+  SK+FSG+S  FGAEPNTQ +  D A+PG+LP+LN   VQ A+
Sbjct: 1   MSWEVVIGLETHVQLNTRSKIFSGSSTAFGAEPNTQANVVDVALPGVLPVLNKEAVQCAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL +NA I   SVFARKNYFYPDLP+GYQISQ++ P+VG+G +++ +G  +       
Sbjct: 61  RFGLAVNAEIAPRSVFARKNYFYPDLPKGYQISQYELPVVGKGALTIQVGDTE------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + I R HLE+DAGKS+H      S IDLNR+G  L+EIVT+PDMRS+ EA A+  KL  
Sbjct: 115 TIRITRAHLEEDAGKSMHGASPGQSGIDLNRAGTPLLEIVTEPDMRSAAEAVAYARKLHE 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           +++++  CDGNM+EGS R DVNVSV R   E  GTR E+KN+NS RF+  AIE+E R QI
Sbjct: 175 LVQWINICDGNMQEGSFRCDVNVSVRRKGQEKLGTRREIKNLNSFRFMQQAIEFETRWQI 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
             LEDGG I Q T LF+P   ETR++RTKE+A DYRYF +PDLLPL I  + I A++  +
Sbjct: 235 ETLEDGGKIEQATVLFNPDTGETRAMRTKEEANDYRYFPDPDLLPLAISTEDIDAVRVTL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV--NRDKKIVANWVINDLLGV 376
           PELP A + RF  ++G+S YDAS L + +S+ADYF         + K+VANWV+  +   
Sbjct: 295 PELPSAMKARFERDYGLSAYDASALTASRSVADYFTATLAEFGGEAKLVANWVMGGISAK 354

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN  G+ I D P+SP  L  L+  I D TIS KIAKD+F  +W   G    I+E  GL+Q
Sbjct: 355 LNEEGREITDAPVSPVLLAGLLKRIADNTISSKIAKDVFEAMWAGEGDADAIIERKGLKQ 414

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           VTD  AIE +VDEV+ +N   V      K    +  VGQ MK + GKANP+ V ++LK K
Sbjct: 415 VTDSGAIEAIVDEVLAANAAMVEEFRAGKEKAFNALVGQTMKASKGKANPAQVNEILKRK 474

Query: 496 L 496
           L
Sbjct: 475 L 475


>gi|254441346|ref|ZP_05054839.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Octadecabacter antarcticus 307]
 gi|198251424|gb|EDY75739.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Octadecabacter antarcticus 307]
          Length = 502

 Score =  562 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 296/507 (58%), Positives = 363/507 (71%), Gaps = 17/507 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+        +G TGDWE+VIG+EVHAQ++  +KLFS AS  FGAEPN+ V+F D
Sbjct: 1   MLDL-TYETPKVKTIAGATGDWELVIGLEVHAQVATKAKLFSSASTQFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           A MPGMLP++N  CV  AV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AGMPGMLPVINEECVAYAVKTGLGLKAQINLNSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
            G+V V +    +       V IERIHLEQDAGKSIHD   A+S +DLNR+GVALMEIV+
Sbjct: 120 TGEVLVEMNDGTA-----RNVRIERIHLEQDAGKSIHDMDPAMSFVDLNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
            PD+R   EA A++ KLR ILRYLGTCDGNM+ G++RADVNVSVCRPG+           
Sbjct: 175 FPDIRGPEEAAAYVVKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGDYEKFQASGDFG 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+ LAI++EARRQIAI+EDGG I QETRL+D  KNETRS+R+KE+
Sbjct: 235 DLGTRCEIKNMNSMRFIQLAIDFEARRQIAIIEDGGKIVQETRLYDADKNETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPDAK+ RFI +FG+S YDASVL +D   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAASLPELPDAKKARFIKDFGLSDYDASVLTADVDN 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A +FE +A   D K+ ANWVIN+L G L +  K I D+PIS  +LG+++ LI    ISGK
Sbjct: 355 AGFFESVAQGNDGKLAANWVINELFGRLKKDDKDISDSPISATRLGQIVALIKSDKISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F I +     P EIV+  G+ QVTD  AIE  VD +I +NP+ VA+    P L  
Sbjct: 415 IAKDVFEIAYTSDRDPIEIVKTEGMEQVTDTGAIEAAVDAIIAANPDQVAKAKENPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKL 496
           WFVGQVMK TGGKANP  V K++ EKL
Sbjct: 475 WFVGQVMKATGGKANPGAVNKLISEKL 501


>gi|103486332|ref|YP_615893.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sphingopyxis
           alaskensis RB2256]
 gi|98976409|gb|ABF52560.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Sphingopyxis alaskensis RB2256]
          Length = 491

 Score =  562 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 276/489 (56%), Positives = 356/489 (72%), Gaps = 4/489 (0%)

Query: 11  SESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPIL 70
           S+    G TG+WEVVIG+EVHAQ++  +KLFSGA+  FGAEPNTQVS  DAAMPGMLP+ 
Sbjct: 5   SDYRVQGETGEWEVVIGLEVHAQITTNAKLFSGAATAFGAEPNTQVSLVDAAMPGMLPVP 64

Query: 71  NGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP 130
           N  C++QAV TG+ + A IN++S F RKNYFY DLPQGYQISQ   P+VGEG ++++   
Sbjct: 65  NRECIRQAVRTGMAIEAQINRWSRFDRKNYFYADLPQGYQISQLYHPLVGEGSLTIA-AD 123

Query: 131 DKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEA 190
           +K+G      +GIERIH+EQDAGK +HDQ+  +S +DLNRSGVALMEIV+KPDMRS  EA
Sbjct: 124 EKAGIPADKVIGIERIHVEQDAGKLMHDQHPTMSYVDLNRSGVALMEIVSKPDMRSPAEA 183

Query: 191 KAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAI 250
            A++ KLRSILRY+G+CDGNMEEGSMRADVNVSV RPGEA+GTR E KNVNS+RF+   I
Sbjct: 184 GAYVRKLRSILRYVGSCDGNMEEGSMRADVNVSVRRPGEAFGTRTETKNVNSVRFVMAVI 243

Query: 251 EYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDF 310
           E EA+RQ+A++E GG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPLE+D+ F
Sbjct: 244 EGEAKRQVALIESGGEVVQETRLYDPDRGETRSMRSKEDAHDYRYFPDPDLLPLELDDAF 303

Query: 311 IRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWV 369
           +   +  +PELPDAKR R++   GIS Y+A VL ++   A +F+  L         ANWV
Sbjct: 304 LEECRASLPELPDAKRARYLA-AGISAYNADVLTAEVEAARWFDALLEAGAKPVAAANWV 362

Query: 370 INDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIV 429
            ++L G LNR G+ I D+P+SP Q  EL+ L+ DGTISG IAK +F  + E G     IV
Sbjct: 363 TSELFGALNRLGRDISDSPVSPAQAAELLGLVADGTISGTIAKQVFEKMLESGDGAAAIV 422

Query: 430 EELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIV 488
           +  GL+Q +D  AIE  + +V+ +N + V +    K  L  +FVGQ MK   GKANP +V
Sbjct: 423 DREGLKQTSDTGAIEAEIAKVLAANADKVEQYKGGKEALFGFFVGQTMKAMQGKANPQVV 482

Query: 489 QKMLKEKLG 497
            ++LK+ LG
Sbjct: 483 NELLKKALG 491


>gi|325980991|ref|YP_004293393.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Nitrosomonas sp.
           AL212]
 gi|325530510|gb|ADZ25231.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Nitrosomonas sp.
           AL212]
          Length = 479

 Score =  562 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 249/481 (51%), Positives = 332/481 (69%), Gaps = 12/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE+VIG+EVHAQLS  SK+FSGAS  +GA PNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 3   WEIVIGLEVHAQLSTQSKIFSGASTAYGAPPNTQACVIDLALPGVLPVLNKGAVERAIRF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A IN  S+FARKNYFYPDLP+GYQISQ++ P+V  G + +     +        +
Sbjct: 63  GLSVGAKINSPSIFARKNYFYPDLPKGYQISQYELPVVQGGNIRIPADGVE------KNI 116

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PDMRSS EA  +   L +++
Sbjct: 117 RLTRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDMRSSAEAVTYAKTLHALV 176

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           R++G CDGNM+EGS R D NVSV     E  GTRCE+KN+NS RFL  AI+YEARRQI I
Sbjct: 177 RWIGICDGNMQEGSFRCDANVSVRPRGIEKLGTRCEIKNLNSFRFLEKAIDYEARRQIEI 236

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LEDGG IRQETRL+D +K+ETR++RTKEDA DYRYF +PDLLPLEI   +I  ++  +PE
Sbjct: 237 LEDGGAIRQETRLYDANKDETRTMRTKEDANDYRYFPDPDLLPLEIPASWIDQVRSALPE 296

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK--LAVNRDKKIVANWVINDLLGVLN 378
           LP  +R+R++ EF +S YDASVL S +  ADYFE     +   +K+ ANW++ ++ G LN
Sbjct: 297 LPQVRRDRYMSEFALSAYDASVLTSSRETADYFESTIRQLPAQEKLCANWIMGEISGQLN 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK--GGTPKEIVEELGLRQ 436
           + G  I   PI+P+QL  L++ I DGTISGK AK +F  +W          I+   GL+Q
Sbjct: 357 KEGLEISACPITPSQLAMLLERISDGTISGKAAKTVFESMWNGELEKNVDAIIAVKGLKQ 416

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           ++D SAIEK+VD+V+ +N   VA     K    +  VGQ+MK T GKANP+ V  +LK+K
Sbjct: 417 ISDDSAIEKLVDQVLAANAQQVADYRNGKEKAFNSLVGQIMKATHGKANPAQVNVILKKK 476

Query: 496 L 496
           L
Sbjct: 477 L 477


>gi|94497361|ref|ZP_01303932.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sphingomonas sp.
           SKA58]
 gi|94423224|gb|EAT08254.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sphingomonas sp.
           SKA58]
          Length = 501

 Score =  562 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 276/500 (55%), Positives = 365/500 (73%), Gaps = 12/500 (2%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
           +  S     G TG+WEVVIG+EVHAQ++  +KLFSGA+  FGAEPNTQVS  DAAMPGML
Sbjct: 1   MTESTYRIQGATGEWEVVIGLEVHAQVTSNAKLFSGAATAFGAEPNTQVSLVDAAMPGML 60

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P+ N  C++QAV TG+ ++A INK+S F RKNYFY DLPQGYQISQ   PIVGEG++ + 
Sbjct: 61  PVPNRECIRQAVRTGMAIDAQINKWSRFDRKNYFYADLPQGYQISQLYHPIVGEGQIEIV 120

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
           +  +K+ +  T  +G+ERIH+EQDAGK +HDQ+   S +DLNRSGVALMEIV+KPDMRS 
Sbjct: 121 L-DEKNPEASTKVIGVERIHVEQDAGKLMHDQHPTSSYVDLNRSGVALMEIVSKPDMRSP 179

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLG 247
            EA A+L+KLR+ILRY+G+CDGNM++GSMRADVNVSV RPGEA+GTR E KNVNS+RF+ 
Sbjct: 180 AEAGAYLSKLRTILRYVGSCDGNMDQGSMRADVNVSVRRPGEAFGTRTETKNVNSVRFVM 239

Query: 248 LAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEID 307
             +E+EA RQ+ +LE GG I QETRL+DP +NETRS+R+KEDA DYRYF +PDLLPLE+D
Sbjct: 240 AVVEHEANRQVDVLEAGGKIVQETRLYDPDRNETRSMRSKEDAHDYRYFPDPDLLPLELD 299

Query: 308 EDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYF----------EKLA 357
           + F+   ++ +PELPDAKR R++ + G+S Y+A+ L +D   A +F          +K +
Sbjct: 300 DAFLEECRQSLPELPDAKRARYVNDLGLSAYNATTLTADADTARWFEALLAQGARIQKKS 359

Query: 358 VNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNI 417
                K  ANW++++L G LNR GKS++++P+ P +  EL+ L+ DGTISG IAK +F I
Sbjct: 360 EGEVAKASANWLLSELYGALNRLGKSLDESPVGPEEGAELLALVADGTISGTIAKQVFEI 419

Query: 418 LWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVM 476
           + E G     IVEE GL+Q +D  AIE  V +V+  N + VA+    K  L  +FVGQ M
Sbjct: 420 MLETGARAPAIVEEKGLKQTSDTGAIEAAVAKVLADNADKVAQYKGGKEALFGFFVGQTM 479

Query: 477 KNTGGKANPSIVQKMLKEKL 496
           K   GKANP +V +++K+ L
Sbjct: 480 KAMQGKANPQVVNELVKKGL 499


>gi|85860808|ref|YP_463010.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Syntrophus
           aciditrophicus SB]
 gi|109892003|sp|Q2LXN0|GATB2_SYNAS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B 2; Short=Asp/Glu-ADT subunit B 2
 gi|85723899|gb|ABC78842.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit B
           [Syntrophus aciditrophicus SB]
          Length = 476

 Score =  562 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 230/480 (47%), Positives = 317/480 (66%), Gaps = 9/480 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVHAQL   SK+F G S  FGA PN+        MPG+LP+LN + V+  +
Sbjct: 1   MEYEPVIGLEVHAQLLTESKIFCGCSTKFGAAPNSHTCPVCLGMPGVLPVLNKKVVEFGM 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              L  +  IN+   FARKNYFYPDLP+GYQISQ+  P+   G V + +   K       
Sbjct: 61  KMALATHCRINEECSFARKNYFYPDLPKGYQISQYAYPLAEFGYVDIEVEDGK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +G+ RIH+E+DAGK IHD ++  S +DLNR+GV L+EIV++PDMRS+ EA A+L +L  
Sbjct: 115 RIGLTRIHMEEDAGKLIHDPHNPSSYVDLNRTGVPLIEIVSEPDMRSAEEAAAYLRRLHE 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL YL  CDGNMEEGS R D NVS+       +GTR E+KN+NS R +  A+EYE +RQ 
Sbjct: 175 ILVYLEICDGNMEEGSFRCDANVSLRPRGESEFGTRTELKNMNSFRNVQRALEYEIKRQQ 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ILE GG + QETRL+D S+  T  +R+KE+A DYRYF +PDL+ ++I  D++ A+ ++ 
Sbjct: 235 YILEGGGSVVQETRLWDDSQGVTHPMRSKEEAHDYRYFPDPDLVAVKISADWVEAVLREQ 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVL 377
           PELP  KRERF+ ++GI  YDA VL S + +ADY+E++   + + K  +NWV+ DLL  L
Sbjct: 295 PELPLEKRERFVRDYGIPPYDAGVLSSSRPLADYYEEVARQSGNPKAASNWVMGDLLRFL 354

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N   + I D PIS   LGELI LI  GTISGK+AK+I   ++  G T   +VEE G+ Q+
Sbjct: 355 NEEKREIRDCPISAASLGELIRLIDQGTISGKMAKEIIEEMYRTGKTAPAVVEEKGMVQI 414

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           TD +A+  V+  ++ +NPN +A+    +  L  +FVGQVMK T GKANP ++  +LK+ L
Sbjct: 415 TDEAALSGVITGILEANPNQLAQYRSGRDKLFGYFVGQVMKATRGKANPQVINDLLKKML 474


>gi|261855844|ref|YP_003263127.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Halothiobacillus
           neapolitanus c2]
 gi|261836313|gb|ACX96080.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Halothiobacillus
           neapolitanus c2]
          Length = 492

 Score =  561 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 240/489 (49%), Positives = 327/489 (66%), Gaps = 8/489 (1%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
           +   WE VIG+E+HAQL+  SK+FSGAS  FGAEPN Q    D  +PG+LP+LN   V  
Sbjct: 3   SMNGWETVIGLEIHAQLATKSKIFSGASTAFGAEPNVQACAVDLGLPGVLPVLNAEAVHM 62

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           A + GL + AH+   S F RKNYFYPDLP+GYQISQ  +PIV  G V+++ G  +     
Sbjct: 63  AALFGLAIGAHVAPVSTFDRKNYFYPDLPKGYQISQLAQPIVSGGSVTITTGEGEKAV-- 120

Query: 138 TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
              + + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIV++P+MRSS EA A+  K+
Sbjct: 121 NKTINLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLIEIVSEPEMRSSAEAVAYARKV 180

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
            +I++YLG CDGNM+EGS R D NVSV        GTR E+KNVNS RFL  AI+YE  R
Sbjct: 181 HAIVQYLGICDGNMQEGSFRVDANVSVRPKGETKLGTRTEIKNVNSFRFLERAIDYEITR 240

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI ++EDGG ++Q+TRL+DP K+ETR +RTKE A DYRYF +PDLLP+ ID+  +   K 
Sbjct: 241 QIELIEDGGTVQQQTRLYDPDKDETRMMRTKEAADDYRYFPDPDLLPVVIDQALLAEWKA 300

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK----LAVNRDKKIVANWVIND 372
            +PELPDAK  R+  ++G+S YDA VL S ++IA YFE+    +    D K+ ANWV   
Sbjct: 301 SLPELPDAKAARYQSDYGLSPYDAGVLTSARAIATYFEQTLNSMGAAADAKLCANWVTGA 360

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEEL 432
           L   LN++   IE +P+S + L  L+  + D T+S K+AK++F+ +W   G    I++  
Sbjct: 361 LAAQLNKANLGIEQSPVSSDALAGLLLRVADNTLSNKLAKEVFDAMWAGEGDADSIIDAR 420

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q+TD SAIE +VDE++ +NP  VA     K  L  +FVGQVMK   GKANP  + ++
Sbjct: 421 GLKQITDSSAIEAMVDEILAANPGKVAEYRSGKDKLFGFFVGQVMKAAQGKANPQQLNEV 480

Query: 492 LKEKLGIKE 500
           LK +LG  E
Sbjct: 481 LKARLGPSE 489


>gi|206889686|ref|YP_002248975.1| glu-trnagln amidotransferase suBunit b [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|226709608|sp|B5YL60|GATB_THEYD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|206741624|gb|ACI20681.1| glu-trnagln amidotransferase suBunit b [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 475

 Score =  561 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 238/480 (49%), Positives = 328/480 (68%), Gaps = 10/480 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             +E VIG+EVHAQL   SK+F G S  FGAEPNTQV      MPG+LP+LN + V+  V
Sbjct: 1   MQYEAVIGLEVHAQLLTESKIFCGCSTQFGAEPNTQVCPVCLGMPGVLPVLNKKAVEYTV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
            TGL +N  I  YS FARKNYFYPDLP+GYQISQ++ P+  +G + + +   K       
Sbjct: 61  KTGLAMNCKIAPYSRFARKNYFYPDLPKGYQISQYELPLCEDGYLEIMLNGTK------R 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           ++ I+RIHLE+DAGK+IHD  S  S +D NR+GV LMEIV++PD+RS  EA  ++ KLR+
Sbjct: 115 KIRIKRIHLEEDAGKNIHDP-SGYSFVDFNRTGVPLMEIVSEPDIRSPKEAALYMKKLRA 173

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ILRYLG CDGN+E+GS+R D NVSV       +G + E+KN+NS RF+  A+EYE +RQI
Sbjct: 174 ILRYLGVCDGNLEQGSLRCDANVSVRPVGSTEFGVKTEIKNINSFRFVEKALEYEIKRQI 233

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++E+G  I QETRL+D     T+S+R+KE+A DYRYF EPDL+P+ + ED+I  IKK +
Sbjct: 234 KLIENGEKIIQETRLWDSQTGTTQSMRSKEEAHDYRYFPEPDLVPVVVSEDWIEKIKKDM 293

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELPD K ERFI E+G+  YD+ +L  +K+++++FE+        K VANW++ +LL +L
Sbjct: 294 PELPDQKIERFIKEYGLPQYDSEILTEEKALSEWFEEAVKLGGKPKEVANWIMVELLRLL 353

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N  GK I +  + P QL ELI+LI  GTI+   AK++F  +++ G T + IV E GL Q+
Sbjct: 354 NEEGKDINECSLKPIQLVELIELINKGTINRNTAKEVFEEMYKTGKTAEAIVREKGLTQI 413

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D S I + + EV+N NP  V R    +  L+ +FVGQVMK T GKANP +V +++ + L
Sbjct: 414 SDDSVIIEAIKEVMNKNPKEVERFRNGEEKLIGFFVGQVMKITKGKANPKLVNELIFKIL 473


>gi|115372371|ref|ZP_01459680.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Stigmatella aurantiaca DW4/3-1]
 gi|115370584|gb|EAU69510.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Stigmatella aurantiaca DW4/3-1]
          Length = 530

 Score =  561 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 228/483 (47%), Positives = 315/483 (65%), Gaps = 11/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            D++ VIG+EVHAQL   SKLF G S  FGAEPN        AMPG+LP+ N R  + A+
Sbjct: 53  NDFQPVIGLEVHAQLLTKSKLFCGCSTEFGAEPNQNTCPVCLAMPGVLPVFNQRVAEFAI 112

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
            TGL L   I K SV++RKNYFYPDLP+GYQI+Q+D+PI   G +++     +       
Sbjct: 113 RTGLALGCTIKKTSVWSRKNYFYPDLPKGYQITQYDQPICEWGALTIDTPEGE------K 166

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V I RIH+E+DAGK++HD     S +DLNR+GV L+EIV++PD+RS+ EA  +L  LR 
Sbjct: 167 TVRIRRIHMEEDAGKNVHDAAVGESLVDLNRAGVPLLEIVSEPDLRSADEAVEYLKALRD 226

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSV-CRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           +L YLG  DGNMEEGS R DVNVSV  +    +G RCE+KN+NS RF+  A EYE  R +
Sbjct: 227 VLVYLGVNDGNMEEGSFRCDVNVSVMRKGETQYGQRCELKNINSFRFIKQAAEYEISRHV 286

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE GG I QETRL+D  + ETRS+R+KEDA DYRYF EPDL PL + +  I  + + +
Sbjct: 287 EVLESGGKIDQETRLWDTQRGETRSMRSKEDAHDYRYFPEPDLPPLHLADALIDEVAQGL 346

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVL 377
           PELP  K +RF+ ++GI  YDA +L +++ +A++FE    + +D K ++NW   +L  +L
Sbjct: 347 PELPRTKFKRFMSQYGIPAYDAKLLCAERPLAEFFEACTQHYKDYKKLSNWFQGELARLL 406

Query: 378 NRSGKS--IEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
           N SG +  I     +P Q GEL+  +  GT+S   AKD+F  ++ +G +P+ I+ E GL 
Sbjct: 407 NESGGTVSISTLKFTPAQFGELLSAVEKGTLSNNAAKDVFAEMFREGKSPEAIIAEKGLA 466

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           QV+D  A+E VVD+V+  N     +    K  +  +FVGQVMK   GK NP++V ++LK+
Sbjct: 467 QVSDAGAVEAVVDDVLAKNAGEAEKYRAGKKQIFGFFVGQVMKAMKGKGNPALVNELLKK 526

Query: 495 KLG 497
           KLG
Sbjct: 527 KLG 529


>gi|325519882|gb|EGC99154.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia sp.
           TJI49]
          Length = 491

 Score =  561 bits (1446), Expect = e-158,   Method: Composition-based stats.
 Identities = 240/487 (49%), Positives = 331/487 (67%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +  ++         
Sbjct: 65  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGTITIQVPANEKAGKPAYEK 124

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + + R HLE+DAGKS+H+ Y+ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 125 TINLTRAHLEEDAGKSLHEDYAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQI 244

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP   ET+S+R+KEDA DYRYF +PDL+PL I  D++  ++  +
Sbjct: 245 ELIEDGGEVVQETRLYDPDTRETKSMRSKEDAHDYRYFPDPDLMPLVIGRDWVERVQAGM 304

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVINDLLG 375
           PELP A ++RF+ E+G+S YDA VL S K++A YFE +       + KI ANW++ D+  
Sbjct: 305 PELPAAMQQRFVAEYGVSAYDAGVLTSSKAMAAYFEAVVAKAGVANAKIAANWLMGDVSS 364

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVEE 431
            LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +WE+     G    I++ 
Sbjct: 365 QLNRDGIEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFATIWEEKATDDGAADRIIDA 424

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP  V +
Sbjct: 425 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVNE 484

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 485 LLKKKLG 491


>gi|187930758|ref|YP_001901245.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ralstonia
           pickettii 12J]
 gi|309780246|ref|ZP_07674997.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Ralstonia sp.
           5_7_47FAA]
 gi|229486431|sp|B2U7W0|GATB_RALPJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|187727648|gb|ACD28813.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Ralstonia pickettii
           12J]
 gi|308920949|gb|EFP66595.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Ralstonia sp.
           5_7_47FAA]
          Length = 488

 Score =  561 bits (1446), Expect = e-158,   Method: Composition-based stats.
 Identities = 242/487 (49%), Positives = 327/487 (67%), Gaps = 8/487 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E H QLS VSK+FSGAS  FGA PNTQ +  D A+PG+LP+LN   V++A+
Sbjct: 1   MQWEVVIGLETHTQLSTVSKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           + GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G ++  +           
Sbjct: 61  VFGLAIGAKIAPKSIFARKNYFYPDLPKGYQISQYEIPVVQGGTLTFQVEGKNGQPGYEK 120

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L +
Sbjct: 121 TVQLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKALHA 180

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV R P   +GTRCE+KN+NS RFL  AI YE RRQI
Sbjct: 181 LVMWLGICDGNMQEGSFRCDANVSVRRGPDAPFGTRCEIKNLNSFRFLEEAINYEVRRQI 240

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPL I +D+I  ++  +
Sbjct: 241 ELIEDGGTVVQETRLYDPDRKETRSMRSKEDAQDYRYFPDPDLLPLVIGDDWIERVRATL 300

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK---LAVNRDKKIVANWVINDLLG 375
           PELP A   RF   +G+  YDAS+L + K+ A YFE     A   + K  ANW++ ++  
Sbjct: 301 PELPAAMAARFESAYGLPKYDASILTATKATAAYFEAVVADAGAANAKAAANWIMGEVAS 360

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEEL 432
            LNR+   I+  P+SP QL +L+  I DGTIS   A KD+F  +W  E GG    I+ E 
Sbjct: 361 NLNRADLDIDAAPVSPAQLAKLLARIADGTISNNTAKKDVFPAMWAGEHGGDADAIIAEK 420

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q++D   +EK++D+V+ +N  +V      K    +  VGQ MK T GKANP+ V  +
Sbjct: 421 GLKQMSDSGELEKIIDDVLAANAKSVEEFRAGKEKAFNALVGQAMKATRGKANPAQVNDL 480

Query: 492 LKEKLGI 498
           LK+KLG 
Sbjct: 481 LKKKLGA 487


>gi|225181780|ref|ZP_03735218.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Dethiobacter
           alkaliphilus AHT 1]
 gi|225167554|gb|EEG76367.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Dethiobacter
           alkaliphilus AHT 1]
          Length = 476

 Score =  561 bits (1446), Expect = e-157,   Method: Composition-based stats.
 Identities = 216/479 (45%), Positives = 300/479 (62%), Gaps = 9/479 (1%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           ++E VIG+EVH +L+  +K+F      FG EPNT V       PG LP+LN R V+ A+M
Sbjct: 3   NYETVIGLEVHVELATKTKIFCSCPTEFGKEPNTHVCPVCLGFPGTLPVLNKRVVEYAIM 62

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL LN  I + S F RKNYFYPDL + YQ+SQ D+P+   G + + +         T  
Sbjct: 63  AGLALNCEIPRMSKFDRKNYFYPDLDKAYQVSQFDQPVAVNGYLDIDVDGQ------TKR 116

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           + + R+H+E+DAGK +H  +   S  D NR GV L+EIV++ DMRS  EAKA+L KL+SI
Sbjct: 117 IRVNRVHIEEDAGKLVHSDFGDYSLADYNRGGVPLIEIVSEADMRSPEEAKAYLEKLKSI 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           ++Y G  D  MEEGS+R D NVS+       +GTR E+KN+NS R +   IEYE  R   
Sbjct: 177 IQYTGVSDVKMEEGSLRCDANVSIMPQGSTEFGTRTEIKNMNSFRAVQRGIEYEVERHKD 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           +L  GG + QETR +D  K  T S+R+KE+A DYRYF EPDL+P+ ++E ++  I+  +P
Sbjct: 237 VLATGGKLIQETRRWDEDKGVTYSMRSKEEAHDYRYFPEPDLVPVVVEEQWVEEIRSGLP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVLN 378
           E+PD +R+R++ E G+  YDA V+ + KS+AD+FE      +D K V+NWV+ D+   L 
Sbjct: 297 EMPDERRKRYVAEMGLPEYDAGVITASKSMADFFEAAVAEYKDAKAVSNWVMGDISRSLK 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
             G  I+DT ++P  L  ++ L  DGTISGKIAK +F  ++  G  P +IV+E GL Q+T
Sbjct: 357 AEGLEIQDTKLTPAHLVAMLKLQEDGTISGKIAKTVFEEMFASGKMPADIVKEKGLVQIT 416

Query: 439 DLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           D  AI  +VD+VI  NP  V          + + VGQVMK + GKANP +  K+LKEKL
Sbjct: 417 DEGAIAAIVDQVIADNPKPVDDYKSGNEKAIGFLVGQVMKLSKGKANPGLANKLLKEKL 475


>gi|254490363|ref|ZP_05103552.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Methylophaga thiooxidans DMS010]
 gi|224464496|gb|EEF80756.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Methylophaga thiooxydans DMS010]
          Length = 480

 Score =  561 bits (1445), Expect = e-157,   Method: Composition-based stats.
 Identities = 240/482 (49%), Positives = 336/482 (69%), Gaps = 11/482 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +WEVVIG+E+HAQL+  SK+FSGA+  +GA PN+Q    D  +PG+LP+LN   V+ A+
Sbjct: 1   MEWEVVIGLEIHAQLATKSKIFSGAATAYGAAPNSQACAVDLGLPGVLPVLNEEAVKMAL 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL ++A I + SVFARKNYFYPDLP+GYQISQ + P+VG G++S+ +           
Sbjct: 61  KFGLAVDAEIAERSVFARKNYFYPDLPKGYQISQFELPVVGIGQISIEMED-----GTEK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +   + IDLNR+G  L+EIV++PDMRS+ EA A++ K+ S
Sbjct: 116 VIGITRAHLEEDAGKSLHEDFQGQTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYMKKIHS 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYL  CDGNM+EGS R D NVS+     E +GTR E+KN+NS R +  AI  E  RQI
Sbjct: 176 LVRYLEICDGNMQEGSFRCDANVSIRPKGQEEYGTRAELKNINSFRNVERAINIEIERQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++E G  + QETRL+D  KNETRS+R+KE+A DYRYF +PDLLPL I+ + I +++  +
Sbjct: 236 DVIESGDLVVQETRLYDADKNETRSMRSKEEANDYRYFPDPDLLPLVIEPELIESVRATL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV---NRDKKIVANWVINDLLG 375
           PELP+ KR+RF+ + G+SLYDAS+L S + +ADY+E +      +D K  ANWV  +L G
Sbjct: 296 PELPNEKRDRFVNDLGLSLYDASLLTSSRELADYYEAVLAATGGKDPKQCANWVTGELSG 355

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK-GGTPKEIVEELGL 434
            LN++G  I ++P++  QL  ++  I D TISGKIAK +F  LWE  G     ++E  GL
Sbjct: 356 ALNKAGLDINESPVTAEQLAGVLIRISDNTISGKIAKTVFEALWENEGKDADAVIEAKGL 415

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           +QVTD  AIE +VDEV+ +NP+ + +    K  L+ +FVGQVMK + GKANP+ V ++LK
Sbjct: 416 KQVTDTGAIEAMVDEVLANNPDQLQQYREGKEQLLGFFVGQVMKASKGKANPAQVNELLK 475

Query: 494 EK 495
           +K
Sbjct: 476 KK 477


>gi|300705542|ref|YP_003747145.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit B
           [Ralstonia solanacearum CFBP2957]
 gi|299073206|emb|CBJ44564.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Ralstonia solanacearum
           CFBP2957]
          Length = 488

 Score =  561 bits (1445), Expect = e-157,   Method: Composition-based stats.
 Identities = 242/487 (49%), Positives = 326/487 (66%), Gaps = 8/487 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E HAQLS  SK+FSGAS  FGA PNTQ +  D A+PG+LP+LN   V++A+
Sbjct: 1   MQWEVVIGLETHAQLSTASKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ I           
Sbjct: 61  RFGLAIGATIAPKSIFARKNYFYPDLPKGYQISQYEIPVVQGGTLTIQIEGKSGQPGYEK 120

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L +
Sbjct: 121 TVHLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKALHA 180

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV   P    GTRCE+KN+NS RFL  AI YE RRQI
Sbjct: 181 LVVWLGICDGNMQEGSFRCDANVSVRPGPDAPLGTRCEIKNLNSFRFLEEAINYEVRRQI 240

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPL I  D++ A++  +
Sbjct: 241 ELIEDGGTVVQETRLYDPDRKETRSMRSKEDAHDYRYFPDPDLLPLVIGADWVDAVRATL 300

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A   RF   +G+  YDAS+L + K+ A YFE     A   + K  ANW++ ++  
Sbjct: 301 PELPAAMAVRFESAYGLPKYDASILTATKATAAYFEAVVAAAGAANAKAAANWIMGEVAS 360

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEEL 432
            LNR+G  I+  P+SP QL +L+  I DGTIS   A KD+F  +W  E GG    I+ E 
Sbjct: 361 NLNRAGLEIDAAPVSPAQLAKLLARIADGTISNNTAKKDVFPAMWAGEHGGDADTIIAEK 420

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q++D   +EK++D+V+ +N  +V      K    +  VGQ MK T GKANP+ V ++
Sbjct: 421 GLKQMSDSGELEKIIDDVLAANAKSVEEYRAGKEKAFNALVGQAMKATRGKANPAQVNEL 480

Query: 492 LKEKLGI 498
           LK+KL  
Sbjct: 481 LKKKLDA 487


>gi|17544773|ref|NP_518175.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ralstonia
           solanacearum GMI1000]
 gi|24418413|sp|Q8Y3C6|GATB_RALSO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|17427062|emb|CAD13582.1| probable aspartyl/glutamyl-trna(asn/gln) amidotransferase subunit b
           (asp/glu-adt subunit b) protein [Ralstonia solanacearum
           GMI1000]
          Length = 488

 Score =  561 bits (1445), Expect = e-157,   Method: Composition-based stats.
 Identities = 245/487 (50%), Positives = 328/487 (67%), Gaps = 8/487 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E HAQLS  SK+FSGAS  FGA PNTQ +  D A+PG+LP+LN   V++A+
Sbjct: 1   MQWEVVIGLETHAQLSTASKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +           
Sbjct: 61  TFGLAIGAKIASKSIFARKNYFYPDLPKGYQISQYEIPVVQGGTLTIQVEGRNGQPGYEK 120

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L +
Sbjct: 121 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYARALHA 180

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV R P   +GTRCE+KN+NS RFL  AI YE RRQI
Sbjct: 181 LVMWLGICDGNMQEGSFRCDANVSVRRGPDAPFGTRCEIKNLNSFRFLEEAINYEVRRQI 240

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPL I  D++ A++  +
Sbjct: 241 ELIEDGGTVVQETRLYDPDRKETRSMRSKEDAHDYRYFPDPDLLPLMIGADWVDAVRATL 300

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A   RF   +G+  YDAS+L + K+ A YFE     A   + K  ANW++ ++  
Sbjct: 301 PELPAAMAARFESAYGLPRYDASILTATKATAAYFEAVVAAAGAANAKAAANWIMGEVAS 360

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEEL 432
            LNR+G  I+  P+SP QL  L+  I DGTIS   A KD+F  +W  E GG    I+ E 
Sbjct: 361 NLNRAGLEIDAAPVSPVQLAGLLARIADGTISNNTAKKDVFPAMWAGEHGGDADAIIAEK 420

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q++D   +EK++DEV+ +N  +V      K    +  VGQ MK T GKANPS V ++
Sbjct: 421 GLKQMSDSGELEKIIDEVLAANAKSVEEFRAGKDKAFNALVGQAMKATRGKANPSQVNEL 480

Query: 492 LKEKLGI 498
           LK+KLG 
Sbjct: 481 LKKKLGA 487


>gi|119896462|ref|YP_931675.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Azoarcus sp.
           BH72]
 gi|166217732|sp|A1K1T3|GATB_AZOSB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|119668875|emb|CAL92788.1| glutamyl-tRNA(GLN) amidotransferase subunit B [Azoarcus sp. BH72]
          Length = 486

 Score =  561 bits (1445), Expect = e-157,   Method: Composition-based stats.
 Identities = 238/485 (49%), Positives = 325/485 (67%), Gaps = 8/485 (1%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
           +  DWEVVIG+EVHAQL+  SK+FSGAS  FGAEPN Q S  D A+PG+LP+LN   V++
Sbjct: 2   SRSDWEVVIGLEVHAQLNTASKIFSGASTAFGAEPNVQASAVDIALPGVLPVLNRGAVER 61

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           A+  GL + A +   SVFARKNYFYPDLP+GYQISQ + P+V  G +++ +G  +     
Sbjct: 62  AIRFGLAIGATVAPTSVFARKNYFYPDLPKGYQISQFELPVVQGGTITIRVG--EGENAY 119

Query: 138 TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
              V + R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PDMRSS EA A+   L
Sbjct: 120 EKTVNLTRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDMRSSAEAVAYARTL 179

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
            +++R++  CDGNM+EGS R D NVSV +   E +GTR E+KN+NS RFL  AI+YE + 
Sbjct: 180 HALVRWIDICDGNMQEGSFRCDANVSVRKKGAEKFGTRREIKNLNSFRFLQQAIDYEVQW 239

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI  +EDGG I+Q T LFDP   ETR +R+KEDA DYRYF +PDLLPL I  ++   ++ 
Sbjct: 240 QIDTIEDGGTIQQATVLFDPDTGETRMMRSKEDAHDYRYFPDPDLLPLVISPEWKARVQG 299

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRD---KKIVANWVINDL 373
           ++PELP+A + RFI + G+S YDA+ L + K +A Y++           K  ANWV+ DL
Sbjct: 300 EMPELPEAMKARFIEQLGLSAYDATTLTASKEVATYYQATVDAAGAALAKPCANWVMGDL 359

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG-TPKEIVEEL 432
              LN++   I  +P+SP QL  L+  I D TIS  IAK +F  LW   G +  EI+++ 
Sbjct: 360 AARLNKAELDIAVSPVSPAQLAGLVARIADNTISNAIAKKVFEALWNGEGASADEIIDKQ 419

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+QVTD  AIE ++DEV+ +N  +V      K    +  VGQVMK + GKA+P+ V ++
Sbjct: 420 GLKQVTDSGAIEAMIDEVLAANQKSVEEFRAGKDKAFNALVGQVMKASKGKASPAQVNEL 479

Query: 492 LKEKL 496
           LK+KL
Sbjct: 480 LKKKL 484


>gi|239907776|ref|YP_002954517.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Desulfovibrio magneticus RS-1]
 gi|259647231|sp|C4XIR3|GATB_DESMR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|239797642|dbj|BAH76631.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Desulfovibrio magneticus RS-1]
          Length = 476

 Score =  561 bits (1445), Expect = e-157,   Method: Composition-based stats.
 Identities = 228/479 (47%), Positives = 315/479 (65%), Gaps = 9/479 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+EVHAQL   SK+F   S  FG +PN  V    + MPG+LP+LN   V+ A   
Sbjct: 4   YETVIGVEVHAQLKTKSKIFCSCSTRFGVDPNENVCPVCSGMPGVLPVLNATVVEYAAKM 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL     +N  SVFARKNYFYPDLP+GYQ SQ ++PI   G V +++            +
Sbjct: 64  GLATGCVVNPVSVFARKNYFYPDLPKGYQTSQFEQPICEHGHVDITVDGT------AKRI 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI RIH+E+DAGK+IH     +S +DLNR+ V L+EIV++PDMR   E  A+L  LR+IL
Sbjct: 118 GITRIHMEEDAGKNIHSAADNLSYVDLNRACVPLIEIVSEPDMRGPEEVVAYLKALRAIL 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            YL  CDGNMEEGS R D NVS+       +GTR E+KN+NS R +  AIEYE  RQ  I
Sbjct: 178 VYLDVCDGNMEEGSFRCDANVSLRPVGQAEFGTRAELKNLNSFRHVQKAIEYEVERQADI 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           L+DGG + QETRL+D +KN T S+R KE+A DYRYF +PDL+P+ I+   +   + ++PE
Sbjct: 238 LDDGGKVIQETRLYDAAKNTTASMRGKEEAHDYRYFPDPDLVPVRIEAATLDKWRAELPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANWVINDLLGVLNR 379
           LP+A+R RF+ +FG+S YDA VL +++ +A+YFE  +A   D K  ANW+ ++LL  LN+
Sbjct: 298 LPEARRARFVADFGLSDYDAEVLTAERDMAEYFEAAVAAGADPKKAANWMQSELLRELNQ 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           +G +  D  ++P +L  L+ LI  G ISGKIAK IF  L+ +G  P + V + GL Q++D
Sbjct: 358 AGVAARDAKLTPEKLASLVKLIDSGEISGKIAKQIFPDLFAQGLDPADYVRQKGLSQISD 417

Query: 440 LSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
            +A+E  V+ V+ +NP  V      K  L+ +FVGQ+MK T G+ANP +V ++L++KLG
Sbjct: 418 SNALESAVEAVLAANPAEVEAFRGGKTKLMGFFVGQIMKATKGQANPGLVNELLQKKLG 476


>gi|241664948|ref|YP_002983308.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ralstonia
           pickettii 12D]
 gi|240866975|gb|ACS64636.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Ralstonia pickettii
           12D]
          Length = 488

 Score =  561 bits (1445), Expect = e-157,   Method: Composition-based stats.
 Identities = 240/487 (49%), Positives = 325/487 (66%), Gaps = 8/487 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E H QLS VSK+FSGAS  FGA PNTQ +  D A+PG+LP+LN   V++A+
Sbjct: 1   MQWEVVIGLETHTQLSTVSKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           + GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G ++  +           
Sbjct: 61  VFGLAIGAKIAPKSIFARKNYFYPDLPKGYQISQYEIPVVQGGTLTFQVEGKNGQPGYEK 120

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L +
Sbjct: 121 TVQLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKALHA 180

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV   P   +GTRCE+KN+NS RFL  AI YE RRQI
Sbjct: 181 LVMWLGICDGNMQEGSFRCDANVSVRPGPDAPFGTRCEIKNLNSFRFLEEAINYEVRRQI 240

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDLLPL I +D+I  ++  +
Sbjct: 241 ELIEDGGTVVQETRLYDPDRKETRSMRSKEDAQDYRYFPDPDLLPLVIGDDWIERVRATL 300

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK---LAVNRDKKIVANWVINDLLG 375
           PELP A   RF   +G+  YDAS+L + K+ A YFE     A   + K  ANW++ ++  
Sbjct: 301 PELPAAMAARFESAYGLPKYDASILTATKATAAYFEAVVADAGAANAKAAANWIMGEVAS 360

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEEL 432
            LNR+   I+  P+ P QL +L+  I DGTIS   A KD+F  +W  E GG    I+ E 
Sbjct: 361 NLNRADLDIDAAPVKPAQLAKLLARIADGTISNNTAKKDVFPAMWAGEHGGDADAIIAEK 420

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q++D   +EK++D+V+ +N  +V      K    +  VGQ MK T GKANP+ V  +
Sbjct: 421 GLKQMSDSGELEKIIDDVLAANAKSVEEFRAGKEKAFNALVGQAMKATRGKANPAQVNDL 480

Query: 492 LKEKLGI 498
           LK+KLG 
Sbjct: 481 LKKKLGA 487


>gi|172036589|ref|YP_001803090.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Cyanothece sp.
           ATCC 51142]
 gi|226779777|sp|B1WYK7|GATB_CYAA5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|171698043|gb|ACB51024.1| glutamyl-tRNA (Gln) amidotransferase subunit B [Cyanothece sp. ATCC
           51142]
          Length = 495

 Score =  560 bits (1444), Expect = e-157,   Method: Composition-based stats.
 Identities = 229/487 (47%), Positives = 315/487 (64%), Gaps = 8/487 (1%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
             ++E +IG+E H QL+  SK+F   S  F + PNT V       PG+LP+LN   +  A
Sbjct: 8   KTEYEAIIGLETHCQLNTTSKIFCNCSTEFDSPPNTNVCPICLGYPGVLPVLNEEVLASA 67

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           V  GL LNA I  YS F RK YFYPDLP+ YQISQ D PIV  G + + +   KS +   
Sbjct: 68  VKLGLALNAKIAPYSKFDRKQYFYPDLPKNYQISQFDLPIVEHGSLEIELVDKKSKEVTR 127

Query: 139 IEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
             +GI R+H+E+DAGK +H        S  S +D NR+GV L+EIV++PD+RS  EA  +
Sbjct: 128 KTIGITRLHMEEDAGKLVHAGSDRLAGSTHSLVDFNRTGVPLLEIVSEPDIRSGQEAAEY 187

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEY 252
             +LR ++RYLG  DGNM+EGS+R DVN+SV     + +GT+ E+KN+NS   +  AIEY
Sbjct: 188 AQELRRLVRYLGISDGNMQEGSLRCDVNISVRPVGQKEFGTKVEIKNMNSFSAIQKAIEY 247

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           E  RQI  +E+G  I QETRL+D S  ET S+R KE + DYRYF EPDL PLE+ E+ + 
Sbjct: 248 EIERQIEAVENGDPIYQETRLWDESNQETISMRKKEGSSDYRYFPEPDLPPLEVSEEKLN 307

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVIN 371
           A K+++PELP  KR+R+    G+S YDA VL  D+ +A+Y+E  +    D K+VANWV  
Sbjct: 308 AWKQELPELPAQKRKRYEEALGLSAYDARVLTDDREVAEYYETAVNTGADAKLVANWVTQ 367

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D+   LN S  SI +  + P+ LGEL+ LI  GTISGKIAK+I   L EKGG+PK+IVE 
Sbjct: 368 DIAAYLNNSKLSIIEIALKPDSLGELVQLIEKGTISGKIAKEILPELLEKGGSPKKIVES 427

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            G+ Q++D + IEKV++ ++ +NP+ V +    K  L  +FVGQVMK TGG+A+P +  +
Sbjct: 428 KGMTQISDPAEIEKVIEALMEANPSEVEKYRGGKKKLKGFFVGQVMKETGGRADPKLTNQ 487

Query: 491 MLKEKLG 497
           + ++ L 
Sbjct: 488 LAEKLLN 494


>gi|260434225|ref|ZP_05788196.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260418053|gb|EEX11312.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 503

 Score =  560 bits (1444), Expect = e-157,   Method: Composition-based stats.
 Identities = 293/508 (57%), Positives = 370/508 (72%), Gaps = 17/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+        +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ VSF D
Sbjct: 1   MLDL-TYELPKPKTIAGAKHDWELVIGMEVHAQVSSNAKLFSGASTKFGAEPNSNVSFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPVINEFCVEQAVRTGLGLKAQINLKSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +       V IERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV+
Sbjct: 120 EGEVLVELGDGTA-----RMVRIERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GE 229
           +PD+R   EA A++ KLR I+RYLGTCDGNM+ G++RADVNVS+CRP             
Sbjct: 175 RPDIRGPEEAAAYIAKLRQIMRYLGTCDGNMQNGNLRADVNVSICRPGDYEKYMETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIE EARRQIAI+E GG + QETRL+DP K ETRS+R+KE+
Sbjct: 235 YLGTRCEIKNMNSMRFIQQAIEVEARRQIAIVEAGGKVEQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I  ++PELPD K+ RFI +FG++ YDASVL ++   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAAKLPELPDEKKARFIKDFGLTDYDASVLTAEVES 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE++A  R+ K+ ANWVIN+L G L +  + I D+P+SP QLG +IDLI    ISGK
Sbjct: 355 AVYFEEVAKGRNGKLAANWVINELFGRLKKDDRDITDSPVSPAQLGGIIDLIASDAISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAK++F I++ +GG P +IVEE G++QVTD  AIE  +DE+I +NP  V +    P L  
Sbjct: 415 IAKELFEIVYTEGGDPAQIVEERGMKQVTDTGAIEAALDEIIAANPAQVEKAKVNPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           WFVGQVMK TGGKANP  V +++ +KLG
Sbjct: 475 WFVGQVMKATGGKANPKAVNQLVAQKLG 502


>gi|300113768|ref|YP_003760343.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Nitrosococcus
           watsonii C-113]
 gi|299539705|gb|ADJ28022.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Nitrosococcus
           watsonii C-113]
          Length = 477

 Score =  560 bits (1444), Expect = e-157,   Method: Composition-based stats.
 Identities = 254/482 (52%), Positives = 344/482 (71%), Gaps = 9/482 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+E+HAQL+  SK+FSGA+  +GA PNTQ    D  +PG+LP+LN   V  AV
Sbjct: 1   MQWEPVIGLEIHAQLATKSKIFSGAATAYGASPNTQACAVDLGLPGVLPVLNQAVVCMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I K+SVFARKNYFYPDLP+GYQISQ++ PIV +G V + +           
Sbjct: 61  KFGLAIEAKITKHSVFARKNYFYPDLPKGYQISQYELPIVADGHVIIELED-----GTEK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + I R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV+ PD+RS+ EA  ++ K+ +
Sbjct: 116 RIEIIRAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSSPDLRSTKEAVIYMKKIHT 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYLG CDGNM+EGS R D NVS+   G+   GTR E+KN+NS RF+  A++YE  RQ 
Sbjct: 176 LVRYLGICDGNMQEGSFRCDANVSIRPQGQETLGTRTELKNINSFRFVERALQYEIERQA 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE G  + QETRLFDP+KNETR +RTKE+A DYRYF +PDLLPL +++ FI  +++ +
Sbjct: 236 EVLESGDKVIQETRLFDPAKNETRPMRTKEEATDYRYFPDPDLLPLVLEDSFIEEVRETL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK--LAVNRDKKIVANWVINDLLGV 376
           PELPDAKR+RF+ E+ +S YDASVL + + +ADY+E      N + K+ ANWV+ DL G 
Sbjct: 296 PELPDAKRKRFMVEYALSAYDASVLTASRELADYYEAVVKTANGEGKLSANWVMGDLAGA 355

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN+ GKSIED+P+SP QLG+LI  I D TISGKIAK +F  ++ +GG   EI+   GL+Q
Sbjct: 356 LNKEGKSIEDSPVSPEQLGQLIKRITDKTISGKIAKTVFETMYAQGGKVDEIIAHQGLKQ 415

Query: 437 VTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           VTD ++IEK++DEV+ +NP  V +  A K  L  +FVGQVMK + GKANP  + ++LK+K
Sbjct: 416 VTDTASIEKLIDEVLAANPQQVMQYQAGKDKLFGFFVGQVMKVSKGKANPQQLNELLKKK 475

Query: 496 LG 497
           LG
Sbjct: 476 LG 477


>gi|218289363|ref|ZP_03493597.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218240469|gb|EED07650.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 477

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 215/480 (44%), Positives = 304/480 (63%), Gaps = 9/480 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E +IG+EVH +L   +K+F G   +  +EPNT V       PG LP+LN R ++ AV
Sbjct: 1   MNYETIIGLEVHVELKTDTKIFCGCRNDSKSEPNTNVCPVCLGHPGTLPVLNERALELAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              L LN  IN+ S F RKNYFYPDLP+GYQISQ+DKPI   G + + +         T 
Sbjct: 61  KAALALNCKINQKSKFDRKNYFYPDLPKGYQISQYDKPIGEHGYIEIEVNG------ETK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R+HLE+DAGKS+H    + + +D NR+GV L+EIV++PD+RS  EA+ +L  L+S
Sbjct: 115 RIGITRLHLEEDAGKSMHAADGSHTLVDYNRTGVPLIEIVSEPDIRSPEEARLYLEALKS 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+ Y    D  MEEGS+R D N+S+      A+G + E+KN+NS RF+  A+EYE  RQ 
Sbjct: 175 IMEYCDVSDCKMEEGSLRCDANISLRPVGQTAFGNKVELKNMNSFRFVQRALEYEVERQR 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
              E G  + QETR FD +   T S+RTKE+A DYRYF EPDL+ L+ID+ ++  I+  +
Sbjct: 235 ERYESGEPVIQETRRFDEATQTTVSMRTKEEAHDYRYFPEPDLVDLDIDDAWLERIRASL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSI-ADYFEKLAVNRDKKIVANWVINDLLGVL 377
           PELP AKR R++ E G+  YDA VL SD  + A Y   +A   D K  +NWV++D+ G L
Sbjct: 295 PELPSAKRRRYVEELGLPPYDAGVLTSDPKMAAYYEAVVAAGADAKQASNWVMSDVSGAL 354

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N  GK+  + PI P  L  LI  I  G IS K A+++F  +WE G +  +I++E G  Q+
Sbjct: 355 NAEGKTFAECPIQPEHLAGLIGEIASGKISSKQAREVFKFMWETGKSAADIIKEKGFEQI 414

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D + ++ ++DEV+ +NP +VA     K   ++  VGQVMK T GKANP++V +ML EK+
Sbjct: 415 SDPAQLQPIIDEVVANNPKSVADYKGGKERALAALVGQVMKATRGKANPTLVNEMLIEKI 474


>gi|209522735|ref|ZP_03271293.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Arthrospira maxima
           CS-328]
 gi|209496784|gb|EDZ97081.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Arthrospira maxima
           CS-328]
          Length = 494

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 219/486 (45%), Positives = 310/486 (63%), Gaps = 9/486 (1%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
             ++E VIG+E H QLS  +K+FS +S  FGA+PNT +      +PG+LP+LN + ++ A
Sbjct: 8   KTEYEAVIGLETHCQLSTQTKIFSNSSTEFGADPNTNIDPICLGLPGVLPVLNQKVLEYA 67

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           V     LN  I  YS F RK YFYPDLP+ YQISQ D PI   G + + I  + +   R 
Sbjct: 68  VKAARALNCEIAPYSKFDRKQYFYPDLPKNYQISQFDLPIATNGWLEIEIVDENNNPIR- 126

Query: 139 IEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
             +GI R+H+E+DAGK +H        S  S +D NR+G+ L+EIV++PD+RS LEA  +
Sbjct: 127 KRIGITRLHMEEDAGKLVHGGSDRLAGSTYSMVDFNRAGIPLVEIVSEPDIRSGLEAAEY 186

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEY 252
             +LR I+RYLG  DGNM+EGS+R DVN+SV     + +GT+ E+KN+NS   +  AI+Y
Sbjct: 187 AQELRRIVRYLGVSDGNMQEGSLRCDVNISVRPVGQKEFGTKVEIKNMNSFSAIQKAIDY 246

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           E  RQIA LE G  + QETRL++     T S+R+KE + DYRYF EPDL P+++  + ++
Sbjct: 247 EIERQIAALEAGQSLIQETRLWEEGSQRTISMRSKEGSSDYRYFPEPDLPPIQVSAEQLK 306

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVIN 371
             + ++PELP  KR R+  + G+S YD  VL  D+++A YFE   A   D K  ANW++ 
Sbjct: 307 QWESELPELPAQKRHRYETDLGLSPYDTRVLTDDRTVAQYFEATVAAGADTKQAANWLMG 366

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D+   L     +I D P+ P +L ELI+LI + TISGKIAKDI   L  KGG+PK++VE+
Sbjct: 367 DITAYLKNEKLAITDIPLKPAELAELINLIGENTISGKIAKDILPELLAKGGSPKQMVEK 426

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL Q++D   +E ++DEVI S+   V +    K  L  +FVGQVMK T G+A+P +  K
Sbjct: 427 KGLIQISDTGELEAIIDEVIASHSQEVEKFKAGKTKLKGFFVGQVMKKTQGRADPQLTNK 486

Query: 491 MLKEKL 496
           ++ +KL
Sbjct: 487 LISQKL 492


>gi|114327617|ref|YP_744774.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Granulibacter
           bethesdensis CGDNIH1]
 gi|122327412|sp|Q0BTK1|GATB_GRABC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|114315791|gb|ABI61851.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Granulibacter bethesdensis CGDNIH1]
          Length = 483

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 291/487 (59%), Positives = 361/487 (74%), Gaps = 6/487 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
                G TG WE+VIG+EVHAQ+   SKLFSGA+  FGAEPN+QVS  DAA+PGMLP+LN
Sbjct: 2   SYTIEGATGAWELVIGLEVHAQVISQSKLFSGAATAFGAEPNSQVSLVDAALPGMLPVLN 61

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QAV TGLGL AHIN  S F RKNYFY DLPQGYQISQ   PIVG G + + +   
Sbjct: 62  RECVAQAVRTGLGLKAHINPVSRFDRKNYFYADLPQGYQISQFAHPIVGSGTIEIELQD- 120

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
                 T ++G+ R+HLEQDAGKS+HDQ    S IDLNRSGVALMEIV++PDMRS  EA 
Sbjct: 121 ----GSTRQIGVTRLHLEQDAGKSLHDQDPTRSFIDLNRSGVALMEIVSEPDMRSPEEAG 176

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A+L KLR+ILRYLGTCDGNMEEGSMRADVNVSV R GE + TRCE+KNVNSIR++  AIE
Sbjct: 177 AYLRKLRTILRYLGTCDGNMEEGSMRADVNVSVRRAGEPFRTRCEIKNVNSIRYVMQAIE 236

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
            EA+RQIAI E+G  + QETRLFDPS+ ETRS+R+KEDA DYRYF +PDLLPL +DED+I
Sbjct: 237 AEAKRQIAIWEEGEEVDQETRLFDPSRGETRSMRSKEDAHDYRYFPDPDLLPLVLDEDWI 296

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
             +K  +PELPD K  RF+ E+G++ YDA VLV++++ A +FE +A  RD ++ AN++  
Sbjct: 297 EGLKASLPELPDEKSARFVSEYGLTRYDAGVLVAEQASAHFFETVAKGRDARLAANYITG 356

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           DL  VLNR+G+SI D+PIS   LG L+DL+ D TI+G+IAK++F  + E G  P +IVE 
Sbjct: 357 DLFAVLNRTGRSITDSPISAEALGGLLDLLADNTINGRIAKEVFEAMAETGEHPADIVEA 416

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GLRQVTD  AI+  V +V+ +NP+ +A     K  L  +FVGQVMK   GK NP++V +
Sbjct: 417 RGLRQVTDTGAIDTAVAQVLEANPDKLAEYRSGKDKLFGFFVGQVMKAMQGKGNPALVNE 476

Query: 491 MLKEKLG 497
            LK+ LG
Sbjct: 477 ALKKALG 483


>gi|330818666|ref|YP_004362371.1| Glutamyl-tRNA [Burkholderia gladioli BSR3]
 gi|327371059|gb|AEA62415.1| Glutamyl-tRNA [Burkholderia gladioli BSR3]
          Length = 491

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 235/487 (48%), Positives = 339/487 (69%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS  SK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTASKIFSGASTQFGAEPNTQACAVDLALPGVLPVLNRGAVERAIRL 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL L + + + S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++    +  + 
Sbjct: 65  GLALGSTVAQRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQLTIQVPANEKAGKEAYSK 124

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 125 TINLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHA 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 185 LVMWLGICDGNMQEGSFRCDANVSVRPLGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQI 244

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+P+ ID  ++  ++ ++
Sbjct: 245 ELIEDGGTVVQETRLYDPDKRETRSMRSKEDAQDYRYFPDPDLMPVVIDPKWVERVRGEM 304

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVINDLLG 375
           PELP A ++RF+ ++G++ YDA VL + K++A YFE +       + K+ ANW++ D+  
Sbjct: 305 PELPAAMQQRFVEQYGVTPYDAVVLTASKAMAAYFEAVVGKAGVANAKVAANWLMGDVSS 364

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVEE 431
           +LNR G  I+ +P+S  QL  ++  I DGTIS KIAK+IF  +W++          I+E 
Sbjct: 365 LLNREGIEIDASPVSAAQLALVLQRIADGTISNKIAKEIFQAIWDEKAGDEAAADRIIEA 424

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  VGQ MK T GKANP+ V +
Sbjct: 425 KGLKQISDSGALEAIIDEVLAANAKSVEEFRAGKEKAFNALVGQAMKATKGKANPAQVNE 484

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 485 LLKKKLG 491


>gi|89093931|ref|ZP_01166876.1| Glu-tRNA(Gln) amidotransferase subunit B [Oceanospirillum sp.
           MED92]
 gi|89081817|gb|EAR61044.1| Glu-tRNA(Gln) amidotransferase subunit B [Oceanospirillum sp.
           MED92]
          Length = 483

 Score =  560 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 249/486 (51%), Positives = 340/486 (69%), Gaps = 12/486 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +WE VIG+E+HAQL+  SK+FSGAS  FGAEPNTQ    D A+PG LP+ N   ++ AV
Sbjct: 1   MEWEAVIGLEIHAQLATKSKIFSGASTAFGAEPNTQACAVDLALPGTLPVFNEEALRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL ++A I + SVF RKNYFYPDLP+GYQ SQ   PIVG G + +++           
Sbjct: 61  KFGLAVDAEIGRKSVFDRKNYFYPDLPKGYQTSQLFHPIVGVGHIDITLED-----GTEK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +G+ R HLE+DAGKS+HD++  +S IDLNR+G  L+EIV++PDMRS+ EA A++ K+ S
Sbjct: 116 RIGVTRAHLEEDAGKSVHDEFPGMSGIDLNRAGTPLLEIVSEPDMRSAEEAVAYVRKIHS 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+  LG CDGNM EGS R D NVSV     E +GTR E KN+NS RF+  AI  E  RQI
Sbjct: 176 IVTSLGICDGNMAEGSFRCDCNVSVRLKGEEEFGTRTETKNINSFRFIEKAITGEIERQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LEDGG + QETRL+D  K+ETRS+R+KE+A DYRYF  PDLLP+ ID+ +I A++  +
Sbjct: 236 DLLEDGGRVVQETRLYDADKDETRSMRSKEEANDYRYFPCPDLLPIVIDDTYIDAVRGSL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVL 377
           PELPDA++ RFI E+ +S YDA VL  D+++A+YFE +   ++D K+ ANWV+ +L  +L
Sbjct: 296 PELPDARKARFIEEYKLSDYDAMVLSGDRTLAEYFETVAKASKDAKLAANWVMGELSKML 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N++   I D+P+S  QLG L++ I D TISGKIAK +F ++W++GG+  EI+E  GL+QV
Sbjct: 356 NQNDTIIADSPVSAEQLGGLLERIKDNTISGKIAKQVFEVMWKEGGSADEIIEAKGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIEK+VD+VI ++   V +        +  ++ +F+GQVMK + GKANP  VQ +L
Sbjct: 416 TDSGAIEKIVDDVIANSSAQVEQYINAEPDKRGKMIGFFMGQVMKASQGKANPGQVQGVL 475

Query: 493 KEKLGI 498
           K+KL  
Sbjct: 476 KKKLDA 481


>gi|300313941|ref|YP_003778033.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase subunit B [Herbaspirillum
           seropedicae SmR1]
 gi|300076726|gb|ADJ66125.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit protein
           [Herbaspirillum seropedicae SmR1]
          Length = 486

 Score =  560 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 240/486 (49%), Positives = 323/486 (66%), Gaps = 11/486 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E H QLS  SK+FSG+   FGAEPNTQ S  D A+PG+LP+LN   V++A+
Sbjct: 1   MQWEVVIGLETHTQLSTQSKIFSGSPTRFGAEPNTQASPVDLALPGVLPVLNKGAVERAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I   S+FARKNYFYPDLP+GYQISQ + P+V  G +S ++   K G+    
Sbjct: 61  QFGLAIGATIAPRSIFARKNYFYPDLPKGYQISQFEIPVVQGGTMSFAVE--KDGKTEIK 118

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + + R HLE+DAGKS+H+ Y  ++ IDLNR+G  L+EIVT+P+MRS+ EA  +   L S
Sbjct: 119 TINLTRAHLEEDAGKSLHEDYQGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVGYAKALHS 178

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTRCE+KN+NS RFL  AI YE RRQI
Sbjct: 179 LVMWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRCEIKNLNSFRFLEEAINYEVRRQI 238

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL PL I +++I  +K  +
Sbjct: 239 ELIEDGGTVVQETRLYDPDKKETRSMRSKEDAQDYRYFPDPDLPPLAISQEWIERVKATM 298

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV---NRDKKIVANWVINDLLG 375
           PELP A RERF+ E+ +  YDA VL   K +A YFE +         K  ANW++ D+  
Sbjct: 299 PELPAAMRERFVAEYALPEYDAMVLTQSKGMASYFEAVVAAAGKEQAKPAANWLMGDVAS 358

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE--KGGT--PKEIVEE 431
            LNR    I D P+   QL  L+  I DGTIS KIAK++F  +WE          +I+E 
Sbjct: 359 TLNREDTDIADAPVKAAQLALLLKRIADGTISNKIAKEVFAGMWEARSDKDSLADDIIEA 418

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E +VD+V+ +N  +VA     K   ++  +GQ MK T GKANP+ + +
Sbjct: 419 KGLKQISDSGALEAIVDQVLAANEKSVAEFRAGKEQAINALIGQAMKATRGKANPAQLTE 478

Query: 491 MLKEKL 496
           +L++KL
Sbjct: 479 LLRKKL 484


>gi|304310261|ref|YP_003809859.1| Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase, subunit B [gamma
           proteobacterium HdN1]
 gi|301795994|emb|CBL44198.1| Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase, subunit B [gamma
           proteobacterium HdN1]
          Length = 482

 Score =  560 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 252/486 (51%), Positives = 332/486 (68%), Gaps = 13/486 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +WE VIG+EVH QLS  SK+FSG+   FGAEPNTQ S  D  MPG LP+LN   + +AV
Sbjct: 1   MEWETVIGLEVHVQLSTRSKIFSGSDTTFGAEPNTQASLIDLGMPGTLPVLNAEAITKAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GLG+ A I   SVF RKNYFYPDLP+GYQISQ  +PIVG+G + +S+        R  
Sbjct: 61  RFGLGIQAEIGHTSVFDRKNYFYPDLPKGYQISQFSRPIVGKGSLEISLED-----GRKK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++P++RS+ EA A+L  L S
Sbjct: 116 TIGITRAHLEEDAGKSLHEDFRGMTGIDLNRAGTPLLEIVSEPEIRSAEEAVAYLKTLHS 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RYL   DGNM EGSMR DVN+S+   G+  +GTR E+KNVNS RF+  AI++E  RQ 
Sbjct: 176 IIRYLDISDGNMAEGSMRCDVNISLRPRGQEAFGTRAEIKNVNSFRFVEKAIQHEMERQA 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE GG + QETRL+D +KNETRS+R+KE+A DYRYF +PDLLP+ +  +FI  ++  +
Sbjct: 236 DLLESGGKVVQETRLYDANKNETRSMRSKEEANDYRYFPDPDLLPVVLTSEFIEQVRATL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL--AVNRDKKIVANWVINDLLGV 376
           PELP  K +RF  E+G+S YDA +L + + +ADYFE +        K+ ANWV  DLLG 
Sbjct: 296 PELPTQKIQRFQAEYGLSEYDARILAASRDLADYFESVTEHSGAGPKVSANWVSGDLLGA 355

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN++   I+ +PIS  QL  L+  I D TISGKIAK IF ILW +GG    I+E  GL+Q
Sbjct: 356 LNKADLDIKQSPISALQLAALLKRIHDNTISGKIAKQIFEILWAEGGEVDAIIEAKGLKQ 415

Query: 437 VTDLSAIEKVVDEVINSNPNNVARI-----ATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
            TD  AIE +VD++I  NP+ VA+        +  L+ +FVGQ+MK + GKANP IV  +
Sbjct: 416 ETDTGAIEAIVDQIIQGNPDQVAQYLAADENKRKKLIGFFVGQIMKASKGKANPQIVNDL 475

Query: 492 LKEKLG 497
           L  KLG
Sbjct: 476 LGAKLG 481


>gi|163741547|ref|ZP_02148938.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Phaeobacter
           gallaeciensis 2.10]
 gi|161385281|gb|EDQ09659.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Phaeobacter
           gallaeciensis 2.10]
          Length = 504

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 293/509 (57%), Positives = 370/509 (72%), Gaps = 18/509 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+      + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDL-TYELPKPKVIAGAKHDWELVIGMEVHAQVSSNAKLFSGASTKFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPVINDYCVEQAVRTGLGLKADINLWSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +       V +ERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV+
Sbjct: 120 EGEVLVELGDGTA-----RNVRVERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A++ KLR I++YLGTCDGNM+ G++RADVNVSVCRPG+           
Sbjct: 175 RPDIRGPEEAAAYIAKLRQIMQYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AI+ EARRQIAI+E GG I QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIDVEARRQIAIIEAGGTIDQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPD K+ RFI +FG+S YDASVL +D   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAANLPELPDEKKARFIKDFGLSDYDASVLTADVES 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLL-GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISG 408
           A +FE+ A  R  K+ ANWVIN+L   +     K I D+P+SP QLG++IDLI    ISG
Sbjct: 355 ATFFEQTAKGRSGKLAANWVINELFGRLKKDEDKQITDSPVSPAQLGDIIDLISSDAISG 414

Query: 409 KIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLV 468
           KIAKD+F I++ +GG P +IVEE G++QVTD  AIE  +DE+I +NP  V +    P L 
Sbjct: 415 KIAKDLFEIVYTEGGDPAQIVEERGMKQVTDTGAIEAALDEIIAANPAQVEKAKVNPKLA 474

Query: 469 SWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
            WFVGQVMK TGGKANP  V +++ +KLG
Sbjct: 475 GWFVGQVMKATGGKANPKAVNELVAKKLG 503


>gi|163738742|ref|ZP_02146156.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Phaeobacter
           gallaeciensis BS107]
 gi|161388070|gb|EDQ12425.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Phaeobacter gallaeciensis BS107]
          Length = 504

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 293/509 (57%), Positives = 369/509 (72%), Gaps = 18/509 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+      + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDL-TYELPKPKVIAGAKHDWELVIGMEVHAQVSSNAKLFSGASTKFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPVINDYCVEQAVRTGLGLKADINLWSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +       V +ERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV+
Sbjct: 120 EGEVLVELGDGTA-----RNVRVERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A++ KLR I++YLGTCDGNM+ G++RADVNVSVCRPG+           
Sbjct: 175 RPDIRGPEEAAAYIAKLRQIMQYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AI+ EARRQIAI+E GG I QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIDVEARRQIAIIEAGGTIDQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPD K+ RFI +FG+S YDASVL +D   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAANLPELPDEKKARFIKDFGLSDYDASVLTADVES 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLL-GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISG 408
           A +FE+ A  R  K+ ANWVIN+L   +     K I D+P+SP QLG +IDLI    ISG
Sbjct: 355 ATFFEQTAKGRSGKLAANWVINELFGRLKKDEDKQITDSPVSPAQLGGIIDLISSDAISG 414

Query: 409 KIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLV 468
           KIAKD+F I++ +GG P +IVEE G++QVTD  AIE  +DE+I +NP  V +    P L 
Sbjct: 415 KIAKDLFEIVYTEGGDPAQIVEERGMKQVTDTGAIEAALDEIIAANPAQVEKAKVNPKLA 474

Query: 469 SWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
            WFVGQVMK TGGKANP  V +++ +KLG
Sbjct: 475 GWFVGQVMKATGGKANPKAVNELVAKKLG 503


>gi|154253284|ref|YP_001414108.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Parvibaculum
           lavamentivorans DS-1]
 gi|154157234|gb|ABS64451.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Parvibaculum
           lavamentivorans DS-1]
          Length = 505

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 314/496 (63%), Positives = 388/496 (78%), Gaps = 5/496 (1%)

Query: 4   LDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAM 63
           +    AR E L  G TGDWE+++G+EVHAQ++  +KLFS +S  FGAE NTQVSF DAAM
Sbjct: 12  MRKREARPEDLIKGQTGDWEIILGLEVHAQVTSNAKLFSASSTKFGAEQNTQVSFVDAAM 71

Query: 64  PGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGK 123
           PGMLP++N  CV+QAV TGLGL A IN  SVF RKNYFYPDLPQGYQISQ+  PIVGEG+
Sbjct: 72  PGMLPVINRYCVEQAVRTGLGLKAQINLRSVFDRKNYFYPDLPQGYQISQYKHPIVGEGE 131

Query: 124 VSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPD 183
           V + +        RT+ VGIER+HLEQDAGKS+HDQ+ A+S +DLNRSGVALMEIV+KPD
Sbjct: 132 VVLDMKD-----GRTVIVGIERLHLEQDAGKSLHDQHPAMSFVDLNRSGVALMEIVSKPD 186

Query: 184 MRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSI 243
           MRS+ EA+A++TKLR+ILRYLGTCDGNMEEGS+RADVNVSV + G   GTRCE+KNVNSI
Sbjct: 187 MRSADEARAYVTKLRTILRYLGTCDGNMEEGSLRADVNVSVRKVGAPLGTRCEIKNVNSI 246

Query: 244 RFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLP 303
           RF+G AIEYEARRQI ILE+GG I QETRLFDP   ETRS+R+KE+A DYRYF +PDLLP
Sbjct: 247 RFIGQAIEYEARRQIEILEEGGKIDQETRLFDPKTGETRSMRSKEEAHDYRYFPDPDLLP 306

Query: 304 LEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKK 363
           LE+ +D + AI+  +PELPD K+ R I ++G+S YDA+VLVS+ + AD+FE +A  RD K
Sbjct: 307 LELLQDDVDAIRTSLPELPDEKKARLISDYGLSPYDATVLVSEGARADFFEAVAKGRDAK 366

Query: 364 IVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG 423
           + ANWV  D  G LNR G SIEDTP++  QLGELIDLI DGTISG+IAK +F+ +++ G 
Sbjct: 367 LAANWVTGDFFGALNREGHSIEDTPVTAKQLGELIDLISDGTISGRIAKQVFDSMYKTGR 426

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKA 483
            P +IVE+ GL+QVTD   IE  +D VI +NP+ V +   KP L +WFVGQ+MK+T GKA
Sbjct: 427 DPAKIVEDEGLQQVTDFGEIEAAIDAVIAANPDKVEQTKVKPQLAAWFVGQIMKSTSGKA 486

Query: 484 NPSIVQKMLKEKLGIK 499
           NP +V ++L  KLG+ 
Sbjct: 487 NPRVVNEILARKLGLS 502


>gi|296161382|ref|ZP_06844189.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia sp.
           Ch1-1]
 gi|295888368|gb|EFG68179.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia sp.
           Ch1-1]
          Length = 491

 Score =  559 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 236/489 (48%), Positives = 333/489 (68%), Gaps = 11/489 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  WEVVIG+E HAQLS  SK+FSGAS  FGA PNTQ    D A+PG LP++N   V++A
Sbjct: 2   TKQWEVVIGLETHAQLSTHSKIFSGASTQFGAAPNTQACPVDLALPGTLPVMNRGAVERA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQF 136
           +  GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G+V++ +  ++      
Sbjct: 62  IQFGLAIGATVASRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQVTIQVPANEKAGSPA 121

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
               V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   
Sbjct: 122 YEKVVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKT 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L +++ +LG CDGNM+EGS R D NVSV       +GTR E+KN+NS RFL  AI+YE R
Sbjct: 182 LHTLVTWLGICDGNMQEGSFRCDANVSVRPVGQAEFGTRAEIKNLNSFRFLEEAIQYEVR 241

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQ+ ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL ID  ++  +K
Sbjct: 242 RQVELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIDAAWVERVK 301

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVIND 372
            ++PELP+A ++RF+ ++G++ YDA+VL S K++A Y+E +       + K  ANW++ +
Sbjct: 302 SEMPELPEAIQQRFVTQYGLTPYDANVLTSSKAMAAYYEAVVSKLGPANAKAAANWLMGE 361

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT----PKEI 428
           +   LNR G  I  +P+S  QL  L+  I DGTIS KIAK+IF  +WE+  T       I
Sbjct: 362 VSSQLNREGLDIAASPVSSAQLALLLQRIADGTISNKIAKEIFLSIWEEKATDEAAADRI 421

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSI 487
           +E  GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP+ 
Sbjct: 422 IEAKGLKQISDTGALEAIIDEVLAANQKSVEEFRAGKEKAFNALIGQAMKATKGKANPAQ 481

Query: 488 VQKMLKEKL 496
           V  +LK+KL
Sbjct: 482 VNDLLKKKL 490


>gi|254447894|ref|ZP_05061359.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [gamma
           proteobacterium HTCC5015]
 gi|198262674|gb|EDY86954.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [gamma
           proteobacterium HTCC5015]
          Length = 495

 Score =  559 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 243/489 (49%), Positives = 340/489 (69%), Gaps = 12/489 (2%)

Query: 16  SGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCV 75
            G    WEVVIG+E+HAQL+  SK+FSGAS  +GA PN+Q    D  +PG+LP+LN   V
Sbjct: 11  RGKKMSWEVVIGLEIHAQLATQSKIFSGASTAYGAAPNSQACAVDLGLPGVLPVLNKSVV 70

Query: 76  QQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQ 135
           + AV  GL ++A I + SVFARKNYFYPDLP+GYQISQ++ PIVG+G + + +   +   
Sbjct: 71  EMAVKFGLAIDAEIGQRSVFARKNYFYPDLPKGYQISQYELPIVGQGYLDIELEDGE--- 127

Query: 136 FRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
             T  +G+ R HLE+DAGKS+H+ + +++ IDLNR+G  L+EIV++PDMRS+ EA A++ 
Sbjct: 128 --TKRIGVTRAHLEEDAGKSVHEGFGSMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYMK 185

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEA 254
           K+ ++++YLG CDGNM+EGS R D NVSV       +GTR E+KN+NS RF+  AI YE 
Sbjct: 186 KMHALVQYLGICDGNMQEGSFRCDANVSVRPVGQAEFGTRAELKNLNSFRFIERAINYEV 245

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
            RQI ++E GG + QETRL+D  K+ETRS+R KEDA DYRYF +PDLLP+ + ++ I  I
Sbjct: 246 ERQIDVIEGGGEVVQETRLYDADKDETRSMRGKEDANDYRYFPDPDLLPVAVTDEDIETI 305

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANWVINDL 373
           +  +PELPDAKR+R++ E G+  YDA VL + K++ADY+E  LA   D K+ ANW+  +L
Sbjct: 306 RSTLPELPDAKRQRYVSELGLPEYDAGVLTASKAVADYYEAALAAGADAKLAANWINGEL 365

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
              LN++  +I+++P++P  L  L+  I D TISGKIAK +F  LW   G+  +I+E  G
Sbjct: 366 AAALNKNELNIDESPVTPVALSGLLSRIADDTISGKIAKQVFEALWNGEGSADDIIEAKG 425

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIV 488
           L+Q+TD SAIE ++DEV+ +N   V          +  ++ +FVGQVMK T GKANP  V
Sbjct: 426 LKQITDTSAIEGIIDEVMANNGEQVDNYRAAPEDKRGKMIGYFVGQVMKATQGKANPGQV 485

Query: 489 QKMLKEKLG 497
            ++LK+KL 
Sbjct: 486 NQLLKQKLD 494


>gi|114765124|ref|ZP_01444269.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pelagibaca
           bermudensis HTCC2601]
 gi|114542528|gb|EAU45554.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseovarius sp.
           HTCC2601]
          Length = 504

 Score =  559 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 295/508 (58%), Positives = 372/508 (73%), Gaps = 18/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L +       + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDL-SFEPPKPKVIAGAKYDWELVIGMEVHAQVSSEAKLFSGASTKFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPVINEYCVEQAVRTGLGLKAEINLKSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V + P          V IERIH+EQDAGKSIHD    +S +DLNR+GVALMEIV+
Sbjct: 120 EGEVIVDMEP-----GIARLVRIERIHIEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A+++KLR ILRYLGTCDGNM+ G++RADVNVSVCRPG+           
Sbjct: 175 RPDIRGPEEAAAYVSKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AI+YEA+RQIAILE GG I QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIDYEAKRQIAILEAGGSIDQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPD K+ RF+ EFG+S YDASVL ++ + 
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAASLPELPDEKKARFVKEFGLSEYDASVLTAEVAN 354

Query: 350 ADYFEKLAVNR-DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISG 408
           A +FEK+A +  D K+ ANWVIN+L G L + G  I ++P+SP QL  ++ LI    ISG
Sbjct: 355 AAFFEKVAGDAGDGKLAANWVINELFGRLKKEGHEITESPVSPAQLAGIVRLIKSDAISG 414

Query: 409 KIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLV 468
           KIAKD+F I++ +GG P++IVEE G++QVTD  AIE  VDE+I +NP  V +    P L 
Sbjct: 415 KIAKDLFEIVYTEGGDPEQIVEERGMKQVTDTGAIETAVDEIIAANPAQVEKAKQNPKLA 474

Query: 469 SWFVGQVMKNTGGKANPSIVQKMLKEKL 496
            WFVGQVMK TGGKANP  V +++ +KL
Sbjct: 475 GWFVGQVMKATGGKANPKAVNEIVAKKL 502


>gi|304317505|ref|YP_003852650.1| glutamyl-tRNA(Gln) amidotransferase subunit beta
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302779007|gb|ADL69566.1| glutamyl-tRNA(Gln) amidotransferase, B subunit
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 476

 Score =  559 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 213/480 (44%), Positives = 317/480 (66%), Gaps = 9/480 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVHA+L   +K+F   +  FG EPNT V      +PG LP+LN + V+ AV
Sbjct: 1   MNYEAVIGLEVHAELLTKTKIFCNCTTEFGGEPNTHVCPVCLGLPGTLPVLNKKVVEYAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  I+K+S   RKNYFYPDLP+ YQISQ+D P+   G V +             
Sbjct: 61  KAGLALNCEISKFSKMDRKNYFYPDLPKAYQISQYDLPLCKNGYVEIETSDGVK-----K 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           ++G+ RIH+E+DAGK +H+     S +D NR+GV L+EIV++PDMR+  EA  +LTKL+S
Sbjct: 116 KIGLTRIHIEEDAGKLMHENIDG-SLVDYNRAGVPLIEIVSEPDMRTPEEAYLYLTKLKS 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           +L Y    D  M+EGS+R D NVSV       +GT+ E+KN+NS + +  A+EYE +RQI
Sbjct: 175 VLEYSEVSDCKMQEGSLRVDTNVSVRPVGSNEFGTKIELKNLNSFKAVQRALEYEIKRQI 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++E+   I QETR ++  K  T S+R+KE+A DYRYF EPDL+P+ + +++   I+K +
Sbjct: 235 KLIENREKIVQETRRWNEQKGVTESMRSKEEAHDYRYFPEPDLVPIIVSDEWKEEIRKSL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVL 377
           PE+P+ K+ERF+ ++GI  YDASV+ S K +AD+FEK A      KI++NW++ +++ +L
Sbjct: 295 PEMPEYKKERFVSQYGIPEYDASVITSSKPLADFFEKCALEYSSAKIISNWIMGEMMRLL 354

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
             +GK I++ PI P+Q+  L++LI +GTI+G IAK +F  ++  G  P+EIVEE GL+Q+
Sbjct: 355 KETGKEIDEVPIKPHQMASLLNLIDNGTITGSIAKTVFEDMFMTGKNPEEIVEEKGLKQL 414

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           ++   + ++  +VI  NP +V      K   + + VGQ+MK T GKANP +  K+LKE+L
Sbjct: 415 SNEDELREIAIKVIKDNPKSVEDYKNGKDKAIGFLVGQMMKATKGKANPQLANKLLKEEL 474


>gi|317127167|ref|YP_004093449.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Bacillus
           cellulosilyticus DSM 2522]
 gi|315472115|gb|ADU28718.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Bacillus
           cellulosilyticus DSM 2522]
          Length = 477

 Score =  559 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 212/481 (44%), Positives = 299/481 (62%), Gaps = 9/481 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             +E ++G+EVH +L   SK+F G S  FGA PNT         PG+LP+LN + V+ A+
Sbjct: 1   MKYETIVGLEVHVELKTKSKIFCGCSTEFGAPPNTHTCPICLGHPGVLPVLNKQAVEFAM 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              + LN  + + + F RKNYFYPD P+ YQISQ DKP+   G + + +         T 
Sbjct: 61  RAAMALNCEVAEVTKFDRKNYFYPDNPKAYQISQFDKPVGEHGWIDIEVNG------ETK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R+HLE+DAGK  H      S +D NR G  L+EIV++PD+R+  EA A+L KL++
Sbjct: 115 RIGITRLHLEEDAGKLTHVDGMGHSLVDFNRVGTPLIEIVSEPDIRTPEEAYAYLEKLKA 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I++Y+   D  MEEGS+R D N+S+     E +GT+ E+KN+NS  F+   + YE  RQ 
Sbjct: 175 IMQYIEVSDCKMEEGSLRCDANISLRPVGQEEFGTKTELKNLNSFAFVQKGLAYEQERQA 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +L  GG I QETR +D   N+T  +R KE + DYRYF +PDL+   ID  +   ++KQI
Sbjct: 235 EVLSSGGEILQETRRWDEKANKTLLMRVKEGSDDYRYFPDPDLVEFHIDAAWREKVEKQI 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVL 377
           PELPDA+R+R+I E  +  YDASVL   KS++D+FE   A     K V+NWV+ ++   L
Sbjct: 295 PELPDARRKRYINELDLPAYDASVLTQQKSVSDFFEACLAEGGPAKPVSNWVMGEVSRYL 354

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N   K IED P++P  L  +I LI  GTIS KIAK +F+ L E GG P+EIV++ GL Q+
Sbjct: 355 NAEEKEIEDIPMTPKSLVNMISLIEKGTISSKIAKQVFSELMENGGDPEEIVKDKGLVQI 414

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D   I K+V++V++ NP +V      K   V + VGQ+MK + GKANP +V KML E++
Sbjct: 415 SDEGEILKMVNDVLDQNPQSVDDFKAGKKKAVGFLVGQIMKASKGKANPQLVNKMLVEEM 474

Query: 497 G 497
            
Sbjct: 475 N 475


>gi|91781451|ref|YP_556657.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           xenovorans LB400]
 gi|123359257|sp|Q146Y4|GATB_BURXL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|91685405|gb|ABE28605.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Burkholderia xenovorans LB400]
          Length = 491

 Score =  559 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 235/489 (48%), Positives = 333/489 (68%), Gaps = 11/489 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  WEVVIG+E HAQLS  SK+FSGAS  FGA PNTQ    D A+PG LP++N   V++A
Sbjct: 2   TKQWEVVIGLETHAQLSTHSKIFSGASTQFGAAPNTQACPVDLALPGTLPVMNRGAVERA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQF-- 136
           +  GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G+V++ +  ++      
Sbjct: 62  IQFGLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQVTIQVPANEKANTPA 121

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
               V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   
Sbjct: 122 YEKVVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKT 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L +++ +LG CDGNM+EGS R D NVSV       +GTR E+KN+NS RFL  AI+YE R
Sbjct: 182 LHTLVTWLGICDGNMQEGSFRCDANVSVRPVGQAEFGTRAEIKNLNSFRFLEEAIQYEVR 241

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL ID  ++  +K
Sbjct: 242 RQIELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIDAAWVERVK 301

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVIND 372
            ++PELP A ++RF+ ++G++ YDA+VL S K++A Y+E +       + K  ANW++ +
Sbjct: 302 SEMPELPVAIQQRFVTQYGLTPYDANVLTSSKAMAAYYEAVVSKLGPANAKAAANWLMGE 361

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKE----I 428
           +   LNR    I  +P+S  QL  L+  I DGTIS KIAK+IF  +WE+  T +     I
Sbjct: 362 VSSQLNREDLDIAASPVSSAQLALLLQRIADGTISHKIAKEIFLSIWEEKATDEAATDRI 421

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSI 487
           +E  GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP+ 
Sbjct: 422 IEAKGLKQISDTGALEAIIDEVLAANQKSVEEFRAGKEKAFNALIGQAMKATKGKANPAQ 481

Query: 488 VQKMLKEKL 496
           V ++L++KL
Sbjct: 482 VNELLRKKL 490


>gi|313202198|ref|YP_004040856.1| glutamyl-tRNA(gln) amidotransferase subunit B [Methylovorus sp.
           MP688]
 gi|312441514|gb|ADQ85620.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylovorus sp.
           MP688]
          Length = 476

 Score =  559 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 243/482 (50%), Positives = 321/482 (66%), Gaps = 9/482 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E H QL   SK+FSG+S+ FGAEPNTQ S  D A+PG+LP+LN   VQ A+
Sbjct: 1   MQWEVVIGLETHTQLQTKSKIFSGSSIAFGAEPNTQASAVDIALPGVLPVLNQEAVQCAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL +NA I   SVFARKNYFYPDLP+GYQISQ++ P+VG+G ++V +G  +       
Sbjct: 61  KFGLAVNAEIAPRSVFARKNYFYPDLPKGYQISQYELPVVGKGSLTVQVGDQE------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + I R HLE+DAGKS+H   + +S IDLNR+G  L+EIVT+PDMRS+ EA A+  KL  
Sbjct: 115 TIRITRAHLEEDAGKSVHGASAGMSGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKKLHE 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           +++++G CDGNM+EGS R DVNVSV     +  GTR E+KN+NS RF+  AIEYE R QI
Sbjct: 175 LVQWIGICDGNMQEGSFRCDVNVSVRPKGSDKLGTRREIKNLNSFRFMQQAIEYETRWQI 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
             LEDGG I+Q T LF+P   ETR++R+KE+A DYRYF +PDLLPL+I  + I  +K  +
Sbjct: 235 ETLEDGGTIQQATVLFNPDTGETRAMRSKEEANDYRYFPDPDLLPLQITVEDIAKVKAVM 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVL 377
           PELP   + RF  E+ +S YDAS L S + IADYF  +     + K+ ANWV+  +   L
Sbjct: 295 PELPGDMKARFEREYSLSAYDASGLTSSRGIADYFTAVVAQVAEPKMAANWVMGSVAAKL 354

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N   + I  +P+SP QL  L+  I D TIS KIAK++F  +W   G    I+E+ GL+QV
Sbjct: 355 NEQDQDISASPVSPLQLAGLLKRIADNTISNKIAKEVFEAMWAGEGDADSIIEKKGLKQV 414

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           TD  AIE ++DEV+ +N   V      K    +  VGQ MK + GKANP+ V ++L+ KL
Sbjct: 415 TDSGAIEAIIDEVLAANAAMVEEFRAGKEKAFNALVGQAMKASKGKANPAQVNEVLRRKL 474

Query: 497 GI 498
           G 
Sbjct: 475 GA 476


>gi|254000231|ref|YP_003052294.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Methylovorus sp.
           SIP3-4]
 gi|253986910|gb|ACT51767.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylovorus sp.
           SIP3-4]
          Length = 476

 Score =  559 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 243/482 (50%), Positives = 321/482 (66%), Gaps = 9/482 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E H QL   SK+FSG+S+ FGAEPNTQ S  D A+PG+LP+LN   VQ A+
Sbjct: 1   MQWEVVIGLETHTQLQTKSKIFSGSSIAFGAEPNTQASAVDIALPGVLPVLNQEAVQCAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL +NA I   SVFARKNYFYPDLP+GYQISQ++ P+VG+G ++V +G  +       
Sbjct: 61  KFGLAVNAEIAPRSVFARKNYFYPDLPKGYQISQYELPVVGKGSLTVQVGDQE------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + I R HLE+DAGKS+H   + +S IDLNR+G  L+EIVT+PDMRS+ EA A+  KL  
Sbjct: 115 TIRITRAHLEEDAGKSVHGASAGMSGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKKLHE 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           +++++G CDGNM+EGS R DVNVSV     +  GTR E+KN+NS RF+  AIEYE R QI
Sbjct: 175 LVQWIGICDGNMQEGSFRCDVNVSVRPKGSDKLGTRREIKNLNSFRFMQQAIEYETRWQI 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
             LEDGG I+Q T LF+P   ETR++R+KE+A DYRYF +PDLLPL+I  + I  +K  +
Sbjct: 235 ETLEDGGTIQQATVLFNPDTGETRAMRSKEEANDYRYFPDPDLLPLQITVEDIAKVKAVM 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVL 377
           PELP   + RF  E+ +S YDAS L S + IADYF  +     + K+ ANWV+  +   L
Sbjct: 295 PELPGDMKARFEREYSLSAYDASGLTSSRGIADYFTAVVAQAAEPKMAANWVMGSVAAKL 354

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N   + I  +P+SP QL  L+  I D TIS KIAK++F  +W   G    I+E+ GL+QV
Sbjct: 355 NEQDQDISASPVSPLQLAGLLKRIADNTISNKIAKEVFEAMWAGEGDADSIIEKKGLKQV 414

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           TD  AIE ++DEV+ +N   V      K    +  VGQ MK + GKANP+ V ++L+ KL
Sbjct: 415 TDSGAIEAIIDEVLAANAAMVEEFRAGKEKAFNALVGQAMKASKGKANPAQVNEVLRRKL 474

Query: 497 GI 498
           G 
Sbjct: 475 GA 476


>gi|323705994|ref|ZP_08117564.1| glutamyl-tRNA(Gln) amidotransferase, B subunit
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534608|gb|EGB24389.1| glutamyl-tRNA(Gln) amidotransferase, B subunit
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 476

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 213/480 (44%), Positives = 315/480 (65%), Gaps = 9/480 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVHA+L   +K+F   +  FG EPNT V      +PG LP+LN + V+ AV
Sbjct: 1   MNYEAVIGLEVHAELLTKTKIFCNCTTEFGGEPNTHVCPVCLGLPGTLPVLNKKVVEYAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  I+K+S   RKNYFYPDLP+ YQISQ+D P+   G V +             
Sbjct: 61  KAGLALNCEISKFSKMDRKNYFYPDLPKAYQISQYDLPLCKNGYVEIETSDGVK-----K 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           ++G+ RIH+E+DAGK +H+     S +D NR+GV L+EIV++PDMR+  EA  +LTKL+S
Sbjct: 116 KIGLTRIHIEEDAGKLMHENVDG-SLVDYNRTGVPLIEIVSEPDMRTPEEAYLYLTKLKS 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           +L Y    D  M+EGS+R D NVSV     + +GT+ E+KN+NS + +  A+EYE +RQI
Sbjct: 175 VLEYSEVSDCKMQEGSLRVDTNVSVRPVGSKEFGTKIELKNLNSFKAVQKALEYEIKRQI 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDG  I QETR ++  K  T S+R+KE+A DYRYF +PDL+P+ + +++   I+K +
Sbjct: 235 RLIEDGEMIVQETRRWNEQKGITESMRSKEEAHDYRYFPDPDLVPIIVSDEWKEEIRKSL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVL 377
           PE+P+ K+ERFI ++GI  YDASV+ S K +AD+FEK        K V+NW++ +++ +L
Sbjct: 295 PEMPEHKKERFITQYGIPEYDASVITSSKPLADFFEKCVLEYSSAKTVSNWIMGEMMRLL 354

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
             +GK +E+  I P+Q+  L++LI +GTI+G IAK +F  ++  G  P+EIVEE GL+Q+
Sbjct: 355 KETGKEVEEVLIKPHQMASLLNLIDNGTITGSIAKTVFEEMFATGKNPEEIVEEKGLKQL 414

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           ++   I ++  +VI  NP +V      K   + + VGQ+MK T GKANP +  K+L E+L
Sbjct: 415 SNEDEIREIALKVIEDNPKSVEDYKNGKDKAIGFLVGQIMKATKGKANPQLANKILLEEL 474


>gi|28871610|ref|NP_794229.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|47115776|sp|Q87WR8|GATB_PSESM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|28854862|gb|AAO57924.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Pseudomonas
           syringae pv. tomato str. DC3000]
          Length = 481

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 245/484 (50%), Positives = 336/484 (69%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ    D  MPG+LP+LN   V+ AV
Sbjct: 1   MQWEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQACLVDLGMPGVLPVLNKEAVRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + + +           
Sbjct: 61  KFGLAVDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDIPLED-----GTVK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            VGI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +
Sbjct: 116 RVGITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RYLG CDGNM EGS+R D NVS+       +GTRCE+KNVNS RF+  AI  E +RQI
Sbjct: 176 IVRYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ FI   +  +
Sbjct: 236 DLIEDGGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFIEETRATL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELP  KRERF  +FG+S YDASVL S +  ADYFEK+   + D K+ ANWV+ +L  +L
Sbjct: 296 PELPPQKRERFQSQFGLSTYDASVLASSREQADYFEKVVSISGDAKLAANWVMVELGSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  I+ +P+S  QLG ++  I D TISGKIAK +F  +    G+  E++E+ GL+QV
Sbjct: 356 NKQGVEIDQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAMANGEGSADEVIEKRGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIE ++DEV+ +N   V +        +  +  +FVGQ MK + GKANP  V ++L
Sbjct: 416 TDSGAIESMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELL 475

Query: 493 KEKL 496
           K KL
Sbjct: 476 KAKL 479


>gi|94308991|ref|YP_582201.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Cupriavidus
           metallidurans CH34]
 gi|166198810|sp|Q1LSE4|GATB_RALME RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|93352843|gb|ABF06932.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Cupriavidus
           metallidurans CH34]
          Length = 484

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 237/486 (48%), Positives = 326/486 (67%), Gaps = 10/486 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E H QLS  SK+FSG S  FGAEPNTQ S  D A+PG+LP+LN   V++A+
Sbjct: 1   MQWEVVIGLETHTQLSTASKIFSGTSTAFGAEPNTQASPVDLALPGVLPVLNRGAVERAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +   +       
Sbjct: 61  QFGLSIGATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVEGKQG--VYEK 118

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRSS EA A+   L S
Sbjct: 119 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSSAEAVAYAKALHS 178

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI+YE + QI
Sbjct: 179 LVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRREIKNLNSFRFLQQAIDYEVQWQI 238

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
           A +EDG  I Q T LFDP   ETR++RTKEDA DYRYF +PDL+PLEID  ++  +K ++
Sbjct: 239 AEIEDGREIVQATVLFDPDTGETRAMRTKEDAHDYRYFPDPDLMPLEIDAAWVERVKSEL 298

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVINDLLG 375
           PELP   + RF+ ++G+S YDAS + + K++A Y+E +  N      K  ANWV+ ++  
Sbjct: 299 PELPATMQARFVSQYGLSAYDASTITATKALAAYYEAVVTNVGAASAKPAANWVMGEIAS 358

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEEL 432
            LNR G SI++ P+ P QL +L+  I DGT+S   A KD+F  +W  E  G    I+   
Sbjct: 359 QLNREGISIDEAPVRPAQLAKLLARITDGTVSNNTAKKDVFPAMWAGESDGDADAIIAAK 418

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q++D   +EK++D+V+ +N  +V      K    +  VGQ MK T GKANP+ V ++
Sbjct: 419 GLKQMSDTGELEKIIDDVLAANAKSVEEFRAGKEKAFNALVGQAMKATKGKANPAQVNEL 478

Query: 492 LKEKLG 497
           LK+KLG
Sbjct: 479 LKKKLG 484


>gi|310819540|ref|YP_003951898.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit b
           [Stigmatella aurantiaca DW4/3-1]
 gi|309392612|gb|ADO70071.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Stigmatella aurantiaca DW4/3-1]
          Length = 481

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 228/483 (47%), Positives = 315/483 (65%), Gaps = 11/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            D++ VIG+EVHAQL   SKLF G S  FGAEPN        AMPG+LP+ N R  + A+
Sbjct: 4   NDFQPVIGLEVHAQLLTKSKLFCGCSTEFGAEPNQNTCPVCLAMPGVLPVFNQRVAEFAI 63

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
            TGL L   I K SV++RKNYFYPDLP+GYQI+Q+D+PI   G +++     +       
Sbjct: 64  RTGLALGCTIKKTSVWSRKNYFYPDLPKGYQITQYDQPICEWGALTIDTPEGE------K 117

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V I RIH+E+DAGK++HD     S +DLNR+GV L+EIV++PD+RS+ EA  +L  LR 
Sbjct: 118 TVRIRRIHMEEDAGKNVHDAAVGESLVDLNRAGVPLLEIVSEPDLRSADEAVEYLKALRD 177

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSV-CRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           +L YLG  DGNMEEGS R DVNVSV  +    +G RCE+KN+NS RF+  A EYE  R +
Sbjct: 178 VLVYLGVNDGNMEEGSFRCDVNVSVMRKGETQYGQRCELKNINSFRFIKQAAEYEISRHV 237

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LE GG I QETRL+D  + ETRS+R+KEDA DYRYF EPDL PL + +  I  + + +
Sbjct: 238 EVLESGGKIDQETRLWDTQRGETRSMRSKEDAHDYRYFPEPDLPPLHLADALIDEVAQGL 297

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVL 377
           PELP  K +RF+ ++GI  YDA +L +++ +A++FE    + +D K ++NW   +L  +L
Sbjct: 298 PELPRTKFKRFMSQYGIPAYDAKLLCAERPLAEFFEACTQHYKDYKKLSNWFQGELARLL 357

Query: 378 NRSGKS--IEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
           N SG +  I     +P Q GEL+  +  GT+S   AKD+F  ++ +G +P+ I+ E GL 
Sbjct: 358 NESGGTVSISTLKFTPAQFGELLSAVEKGTLSNNAAKDVFAEMFREGKSPEAIIAEKGLA 417

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           QV+D  A+E VVD+V+  N     +    K  +  +FVGQVMK   GK NP++V ++LK+
Sbjct: 418 QVSDAGAVEAVVDDVLAKNAGEAEKYRAGKKQIFGFFVGQVMKAMKGKGNPALVNELLKK 477

Query: 495 KLG 497
           KLG
Sbjct: 478 KLG 480


>gi|170703195|ref|ZP_02894002.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           ambifaria IOP40-10]
 gi|170131892|gb|EDT00413.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           ambifaria IOP40-10]
          Length = 490

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 241/487 (49%), Positives = 334/487 (68%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGA   FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGAPTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +   +         
Sbjct: 64  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPASEKAGKPAYEK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKSLHA 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 184 LVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQI 243

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I +D+I  ++  +
Sbjct: 244 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGQDWIERVQAGM 303

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+  
Sbjct: 304 PELPAAIQQRFVEQYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAANAKIAANWLMGDVSS 363

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT----PKEIVEE 431
            LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF+ +W++  T       I++ 
Sbjct: 364 QLNRDGIEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFSAIWDEKATDEAAADRIIDA 423

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP  V +
Sbjct: 424 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVNE 483

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 484 LLKKKLG 490


>gi|218440496|ref|YP_002378825.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Cyanothece sp.
           PCC 7424]
 gi|226709602|sp|B7KGN0|GATB_CYAP7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|218173224|gb|ACK71957.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Cyanothece sp. PCC
           7424]
          Length = 495

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 222/486 (45%), Positives = 311/486 (63%), Gaps = 8/486 (1%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
             ++E +IG+E H QL+  SK+F   S  F + PNT V       PG+LP+LN   +  A
Sbjct: 8   KTEYEAIIGLETHCQLNTHSKIFCNCSTKFDSPPNTNVCPICLGYPGVLPVLNLEVLASA 67

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           V  GL +N  I  YS F RK YFYPDLP+ YQISQ+D PIV +G + + +   ++ +   
Sbjct: 68  VKMGLAINGKIASYSKFDRKQYFYPDLPKNYQISQYDLPIVEQGSLEIEVVDKETKEVTR 127

Query: 139 IEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
             +GI R+H+E+DAGK +H        S  S +D NR+GV L+EIV++PD+RS  EA  +
Sbjct: 128 KTIGITRLHMEEDAGKLVHAGSDRLAGSTYSLVDFNRTGVPLLEIVSEPDLRSGQEAAEY 187

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEY 252
             +LR ++RYLG  DGNM+EGS+R DVN+SV     + +GT+ E+KN+NS   +  AIEY
Sbjct: 188 AQELRRLVRYLGISDGNMQEGSLRCDVNISVRPKGQKKFGTKVEIKNMNSFSAIQKAIEY 247

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           E  RQI  +E+G  IR ETRL++  K  T ++R KE A DYRYF EPDL P+E+ ++ I 
Sbjct: 248 EIERQIEAIENGEPIRLETRLWEEGKQRTVTMRLKEGASDYRYFPEPDLPPIEVSQEQIE 307

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVIN 371
             K QIPELP  KR R+  E G+S YDA VL  ++ +A+YFE       + K+VANWV  
Sbjct: 308 TWKAQIPELPAQKRTRYETELGLSAYDARVLTDEREVAEYFETAVATGANAKLVANWVTQ 367

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D+   LN +  +I +  +    LGEL++LI +GTISGKIAKDI   L   GG+PK +VE+
Sbjct: 368 DIAAYLNNNKLNIGEIALKSEGLGELVNLIEEGTISGKIAKDILPELLTDGGSPKTLVEK 427

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL Q++D   +EK++DEVI S+P  + +    K NL  +FVGQV+K TGG+A+P +  +
Sbjct: 428 KGLIQISDTGELEKIIDEVIASHPKELEKYRSGKKNLKGFFVGQVLKKTGGRADPKLTNQ 487

Query: 491 MLKEKL 496
           +L +KL
Sbjct: 488 LLDKKL 493


>gi|172062085|ref|YP_001809737.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           ambifaria MC40-6]
 gi|229486046|sp|B1YPV7|GATB_BURA4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|171994602|gb|ACB65521.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           ambifaria MC40-6]
          Length = 490

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 241/487 (49%), Positives = 335/487 (68%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGA   FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGAPTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++         
Sbjct: 64  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKPAYEK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKSLHA 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 184 LVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQI 243

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I +D+I  ++  +
Sbjct: 244 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGQDWIERVQAGM 303

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+  
Sbjct: 304 PELPAAMQQRFVEQYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAANAKIAANWLMGDVSS 363

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT----PKEIVEE 431
            LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF+ +W++  T       I++ 
Sbjct: 364 QLNRDGIEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFSAIWDEKATDEAAADRIIDA 423

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP  V +
Sbjct: 424 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVNE 483

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 484 LLKKKLG 490


>gi|78067927|ref|YP_370696.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia sp.
           383]
 gi|109892010|sp|Q39BW4|GATB_BURS3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|77968672|gb|ABB10052.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Burkholderia sp. 383]
          Length = 491

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 240/487 (49%), Positives = 332/487 (68%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++         
Sbjct: 65  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKDAYEK 124

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 125 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI +E RRQI
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSVRPIGQEKFGTRAEIKNLNSFRFLEEAINFEVRRQI 244

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I +D+I  ++  +
Sbjct: 245 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGQDWIERVQSGM 304

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVINDLLG 375
           PELP A ++RF  E+G+S YDA VL S K++A YFE +       + KI ANW++ D+  
Sbjct: 305 PELPAAMQQRFADEYGVSAYDAGVLTSSKAMAAYFEAVVAKAGTANAKIAANWLMGDVSS 364

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT----PKEIVEE 431
            LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++          I++ 
Sbjct: 365 QLNRDGIEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFTTIWDEKADDEGAADRIIDA 424

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP  V +
Sbjct: 425 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVNE 484

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 485 LLKKKLG 491


>gi|297569911|ref|YP_003691255.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296925826|gb|ADH86636.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 479

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 215/481 (44%), Positives = 311/481 (64%), Gaps = 9/481 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            + E VIG+EVHAQL   SK+F G S  FG  PN+        MPG+LP+LN R V+ A+
Sbjct: 1   MELETVIGLEVHAQLKTKSKIFCGCSTEFGRPPNSNTCPVCLGMPGVLPVLNRRVVEFAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              L  +  +N+ ++FARKNYFYPDLP+GYQISQ D+PI   G +++ +    S      
Sbjct: 61  KLALATDCTVNRRNIFARKNYFYPDLPKGYQISQFDRPIAEHGALTIELEGAPS-----R 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI RIH+E+DAGK IHD++   S +DLNR+GV L+EIV++PD+RS  EA A+L KL +
Sbjct: 116 RIGITRIHMEEDAGKLIHDEHEPQSYVDLNRTGVPLLEIVSEPDLRSPAEAAAYLRKLHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RYL  CDGNM+EGS R D N+S+     E +GTR E+KN+NS R +  A+EYE RRQ 
Sbjct: 176 IVRYLDICDGNMQEGSFRCDANISLRPKGQEEFGTRTELKNMNSFRNVQKALEYEERRQR 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +L DG  + Q T L+D  K  ++++R+KE+A DYRYF +PDL+P+EIDE ++  ++  +
Sbjct: 236 DLLLDGREVVQVTLLWDADKGVSQAMRSKEEAHDYRYFPDPDLVPVEIDESWLEEVRAGL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVL 377
           PELP A++ RFI + G+  YDA VL S + +ADYFE+  A     K ++NW++ +L+ V+
Sbjct: 296 PELPLARKTRFIEQLGLPDYDAEVLTSSRELADYFEQALAAYPAAKKLSNWIMTELMRVM 355

Query: 378 N-RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
               G  I   P+SP  L  L+ ++ +G ISGKIAK +F  +   G  P  +V+E  L Q
Sbjct: 356 KGDEGIDIAACPVSPPHLARLLTMVDEGMISGKIAKTVFEEMMSSGADPDTVVKEKNLVQ 415

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           V+D   +  +V E+I +NP  V +    K  ++ +FVGQ+M+ T GKANP +  ++   +
Sbjct: 416 VSDEGELLTIVREIIAANPEQVEQFKGGKSKVMGFFVGQLMQQTKGKANPQLANQLFSRE 475

Query: 496 L 496
           L
Sbjct: 476 L 476


>gi|327398677|ref|YP_004339546.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Hippea
           maritima DSM 10411]
 gi|327181306|gb|AEA33487.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Hippea
           maritima DSM 10411]
          Length = 475

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 242/480 (50%), Positives = 330/480 (68%), Gaps = 11/480 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVH QL   +K+F   S +FGA PNT +      MPG+LP+LN + +  A+
Sbjct: 1   MEFEAVIGLEVHIQLLTNTKIFCSCSTDFGAPPNTHICPVCMGMPGVLPVLNKKVLDYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  INK+S FARKNYFYPDLP+GYQISQ++ PI+  G V + +           
Sbjct: 61  KLGLALNCKINKFSRFARKNYFYPDLPKGYQISQYELPILEGGHVEIFVNG------EYK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           ++G+ERIH+E+DAGK+IH      S +D NR+GV L+EIV+ P M S  EA  +L  LR 
Sbjct: 115 KIGLERIHMEEDAGKTIH--RPDGSYVDFNRAGVPLLEIVSLPVMHSPQEAGEYLRSLRR 172

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RYLG CDGNMEEGS+R D NVS+        GT+ E+KN+NS R +  A+EYE +RQI
Sbjct: 173 IVRYLGICDGNMEEGSLRCDANVSIRPKGQTKLGTKTELKNMNSFRHVEKALEYEIQRQI 232

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG I Q+TRL+D     T+ +R+KE+A +YRYF +PDL+P+ ID+++I  IK ++
Sbjct: 233 EVVEDGGKIIQQTRLWDEKTGMTKPMRSKEEAYEYRYFPDPDLVPIFIDDEWIERIKDEV 292

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVL 377
           PELP  K ERF+ E+G+   DA VLV +KS+ADYFE+ A   +  + +ANW++++LLG L
Sbjct: 293 PELPRQKLERFVEEYGLKEEDARVLVEEKSLADYFEEAAKGYKKPQSIANWILSELLGYL 352

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+  K+IEDT I PN + EL++LI  G ISGKIAK +F  ++E   +PK+IVEE GL Q+
Sbjct: 353 NKENKNIEDTLIKPNHIRELVELIDSGLISGKIAKTVFGKMYETAKSPKQIVEEEGLVQI 412

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           TD S IE +VDEVI +NP  V +    K N + +FVGQVMK T GKANP +V ++L  KL
Sbjct: 413 TDRSQIEGIVDEVIKANPKAVEQYKSGKKNTIGFFVGQVMKKTKGKANPKLVNEILASKL 472


>gi|115353213|ref|YP_775052.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           ambifaria AMMD]
 gi|122321947|sp|Q0BAV5|GATB_BURCM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|115283201|gb|ABI88718.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Burkholderia ambifaria AMMD]
          Length = 491

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 241/487 (49%), Positives = 335/487 (68%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGA   FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGAPTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++         
Sbjct: 65  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKPAYEK 124

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 125 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKSLHA 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQI 244

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I +D+I  ++  +
Sbjct: 245 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGQDWIERVQAGM 304

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+  
Sbjct: 305 PELPAAIQQRFVEQYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAANAKIAANWLMGDVSS 364

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT----PKEIVEE 431
            LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF+ +W++  T       I++ 
Sbjct: 365 QLNRDGIEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFSAIWDEKATDEAAADRIIDA 424

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP  V +
Sbjct: 425 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVNE 484

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 485 LLKKKLG 491


>gi|144899095|emb|CAM75959.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 483

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 288/484 (59%), Positives = 359/484 (74%), Gaps = 7/484 (1%)

Query: 14  LTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGR 73
           +  G TGDWE+VIG+EVHAQ+   SKLFSGA+ +FGAEPN QVSF DA  PGMLP++N +
Sbjct: 2   IIQGDTGDWEIVIGLEVHAQVISKSKLFSGAATDFGAEPNDQVSFVDAGFPGMLPVINEK 61

Query: 74  CVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS 133
           CV+QAV TGLGL A IN  SVFARKNYFY DLPQGYQISQ+D PIVGEG + + +     
Sbjct: 62  CVEQAVRTGLGLKAKINLTSVFARKNYFYADLPQGYQISQYDLPIVGEGTLLIDLAD--- 118

Query: 134 GQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
               +  +GIER+HLEQDAGKSIHD + + S IDLNRSGVALMEIV+KPDMRS  EA A+
Sbjct: 119 --GTSRAIGIERLHLEQDAGKSIHDMHPSKSYIDLNRSGVALMEIVSKPDMRSPEEAGAY 176

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEY 252
           LTKLR+ILRYL TCDGNM+EGSMR D NVSV         TRCE+KNVNSIRF+  AIEY
Sbjct: 177 LTKLRTILRYLETCDGNMQEGSMRCDANVSVRPVGSTELRTRCEIKNVNSIRFVQQAIEY 236

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           EARR I + E+GG I+QETRLFD  K ETRS+R+KE A DYRYF +PDLLPL + +DF+ 
Sbjct: 237 EARRHIDVYENGGEIKQETRLFDSVKGETRSMRSKEHAHDYRYFPDPDLLPLVVAQDFVD 296

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIND 372
            I+  +PELPD K+ RF+ +FG++ YDA VLV++++ AD+FE +A  RD K+ ANW++ D
Sbjct: 297 GIQATLPELPDDKKARFMADFGLNAYDAGVLVAERASADFFEAVAAGRDAKMAANWIMGD 356

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEEL 432
               +N    S E  P+S   LG++IDLI DGTIS ++AKD+F  + E G  P  IVEE 
Sbjct: 357 FFAAMNSGDYSWEKPPVSAQNLGKMIDLIKDGTISTRLAKDVFIFMLESGKDPAIIVEEK 416

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+QVTD  AIEK + EV+ +NP+ VA +   K  L+ WFVGQVMK T GKANP ++ ++
Sbjct: 417 GLKQVTDTGAIEKAIAEVMAANPDKVAEVKAGKDKLIGWFVGQVMKATQGKANPGMLNEL 476

Query: 492 LKEK 495
           + +K
Sbjct: 477 IVKK 480


>gi|254510930|ref|ZP_05122997.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Rhodobacteraceae bacterium
           KLH11]
 gi|221534641|gb|EEE37629.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Rhodobacteraceae bacterium
           KLH11]
          Length = 503

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 290/508 (57%), Positives = 368/508 (72%), Gaps = 17/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L   + + ++  +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDLTYEMPKPKT-IAGAKHDWELVIGMEVHAQVSSNAKLFSGASTQFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 60  AAMPGMLPVINEYCVEQAVRTGLGLKADINLKSAFDRKNYFYPDLPQGYQISQLYQPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +       V IERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV+
Sbjct: 120 EGEVLVEMGDGTA-----RMVRIERIHMEQDAGKSIHDMDPHMSFVDLNRTGVCLMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GE 229
           +PD+R   EA A++ KLR ILRYLGTCDGNM+ G++RADVNVS+C P             
Sbjct: 175 RPDIRGPEEAAAYIAKLRQILRYLGTCDGNMQNGNLRADVNVSICLPGAYEKYQETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIE EARRQIAI+E GG + QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIEVEARRQIAIVEGGGKVDQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I  ++PELPD K+ RFI  FG++ YDASVL ++   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAAKLPELPDDKKARFISVFGLTDYDASVLTAEVES 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE++A  R  K+ ANWVIN+L G L +    I  +P+SP QLG +IDLI    ISGK
Sbjct: 355 AAYFEEVAKGRSGKLAANWVINELFGRLKKDDAEITASPVSPVQLGGIIDLIASDAISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F I++ +GG P +IVE+ G++QVTD  AIE  +DE+I +NP  V +    P L  
Sbjct: 415 IAKDLFEIVYTEGGDPAQIVEDRGMKQVTDTGAIEAALDEIIAANPAQVEKAKVNPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           WFVGQVMK TGGKANP  V +++ +KLG
Sbjct: 475 WFVGQVMKATGGKANPKAVNELVSKKLG 502


>gi|222085631|ref|YP_002544161.1| glutamyl-tRNA amidotransferase subunit B protein [Agrobacterium
           radiobacter K84]
 gi|221723079|gb|ACM26235.1| glutamyl-tRNA amidotransferase subunit B protein [Agrobacterium
           radiobacter K84]
          Length = 474

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 330/473 (69%), Positives = 390/473 (82%)

Query: 28  IEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNA 87
           +EVHAQ+   SKLFSGAS  FG   N+ VS  DAAMPGMLP++N  CV+QAV TGLGL A
Sbjct: 1   MEVHAQVLSKSKLFSGASTEFGKPQNSNVSLVDAAMPGMLPVINEECVKQAVRTGLGLKA 60

Query: 88  HINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIH 147
            IN  S+F RKNYFYPDLPQGYQISQ   PIVGEGK+ +S+GPD+ GQF  IE+GIER+H
Sbjct: 61  QINNRSIFDRKNYFYPDLPQGYQISQFKDPIVGEGKIVISLGPDRQGQFEDIEIGIERLH 120

Query: 148 LEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTC 207
           LEQDAGKS+HDQ++ +S +DLNRSGVALMEIV+KPDMRSS EAKA++TKLRSI+RYLGTC
Sbjct: 121 LEQDAGKSLHDQHATMSYVDLNRSGVALMEIVSKPDMRSSDEAKAYMTKLRSIVRYLGTC 180

Query: 208 DGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHI 267
           DGNM+EGSMRADVNVSV RPG  +GTRCE+KNVNSIRF+G AIEYEARRQIAILEDGG I
Sbjct: 181 DGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNVNSIRFIGQAIEYEARRQIAILEDGGSI 240

Query: 268 RQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRE 327
            QETRLFDP K ETRS+R+KEDA DYRYF +PDLLPLE D+ F+  +   +PELPD K+E
Sbjct: 241 DQETRLFDPGKGETRSMRSKEDAHDYRYFPDPDLLPLEFDDAFVTELAAHLPELPDDKKE 300

Query: 328 RFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDT 387
           RF+ + G+S+YDASVLVS+K+IADYFE +A  RD K+ ANWVINDLLG LNR+GK IE+T
Sbjct: 301 RFVRDLGLSIYDASVLVSEKAIADYFETVAAGRDGKMAANWVINDLLGALNRTGKDIEET 360

Query: 388 PISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVV 447
           P+S  QLG +IDLI   TISGKIAKD+F I+  +GG P EIVE  G++QVTD  AIEK V
Sbjct: 361 PVSSAQLGAIIDLIKAETISGKIAKDLFEIVLTEGGDPTEIVEARGMKQVTDTGAIEKAV 420

Query: 448 DEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLGIKE 500
           DE+I +NP+ VA++  KP L  WFVGQVMK+TGGKANP  VQ ++K KLGI+E
Sbjct: 421 DEIIAANPDQVAKVKAKPTLAGWFVGQVMKSTGGKANPQAVQALVKAKLGIEE 473


>gi|16330901|ref|NP_441629.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Synechocystis
           sp. PCC 6803]
 gi|1653395|dbj|BAA18309.1| PET112 protein [Synechocystis sp. PCC 6803]
          Length = 519

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 219/486 (45%), Positives = 300/486 (61%), Gaps = 8/486 (1%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
             D+E +IG+E H QL+  SK+F   S +F + PNT V       PG+LP+LN   +  A
Sbjct: 31  KTDYEAIIGLETHCQLNTASKIFCNCSTDFDSPPNTNVCPVCLGYPGVLPVLNEEVLAAA 90

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           V  GL +N  I  YS F RK YFYPDLP+ YQISQ D PIV  G + + +   K+ +   
Sbjct: 91  VKLGLAINGQIAPYSKFDRKQYFYPDLPKNYQISQFDLPIVEHGSLEIELVDKKTKEITR 150

Query: 139 IEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
             +GI R+H+E+DAGK +H        S  S +D NR+GV L+EIV++PD+R+  EA  +
Sbjct: 151 KTIGITRLHMEEDAGKLVHAGSDRLAGSTHSLVDFNRTGVPLLEIVSEPDLRTGQEAAEY 210

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEY 252
              LR ++RYLG  DGNM+EGS+R DVN+SV     + +GT+ E+KN+NS   +  AIEY
Sbjct: 211 AQSLRQLVRYLGISDGNMQEGSLRCDVNISVRPVGQKEFGTKVEIKNMNSFSAIQKAIEY 270

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           E  RQI  + DG  I QETRL++     T S+R KE + DYRYF EPDL PLE+ E   +
Sbjct: 271 EIERQIKAIADGEEIYQETRLWEEGSQRTISMRKKEGSSDYRYFPEPDLPPLEVSEQQKQ 330

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVIN 371
                +PELP AKR R+  + G+S YDA VL  D+ +A YFE+ +    D K VANWV  
Sbjct: 331 TWFATLPELPSAKRARYEQKLGLSAYDARVLTEDRDVALYFEEAVNAGADPKAVANWVTQ 390

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D+   LN +  +I    + P+ L ELIDLI  GTISGKIAKDI   L EKGG+P++I+E 
Sbjct: 391 DIAAYLNNNRLTISGLALKPSALAELIDLITKGTISGKIAKDILPELLEKGGSPQKIIEA 450

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL Q++D   +  ++  VI  +P  + +    K N+  +FVGQVMK TGGKA+P +  +
Sbjct: 451 RGLVQISDPDELTAIIQAVIADHPKELEKFRSGKGNMQGFFVGQVMKRTGGKADPKLTNQ 510

Query: 491 MLKEKL 496
           ++ + L
Sbjct: 511 LIGKLL 516


>gi|126740324|ref|ZP_01756012.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter sp.
           SK209-2-6]
 gi|126718460|gb|EBA15174.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter sp.
           SK209-2-6]
          Length = 504

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 294/509 (57%), Positives = 368/509 (72%), Gaps = 18/509 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+      + +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FG EPN+ VSF D
Sbjct: 1   MLDL-TYELPKPKVIAGAKHDWELVIGMEVHAQVSSKAKLFSGASTKFGNEPNSNVSFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPVINEYCVEQAVRTGLGLKAEINLWSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +       V +ERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV+
Sbjct: 120 EGEVLVELGDGTA-----RNVRVERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GE 229
           +PD+R   EA A++ KLR I+RYLGTCDGNM+ G++RADVNVS+C P             
Sbjct: 175 RPDIRGPEEAAAYIAKLRQIMRYLGTCDGNMQNGNLRADVNVSICLPGAYEKYQETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIE EARRQIAI+E GG + QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIEVEARRQIAIVEGGGKVDQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++D++  I   +PELPD K+ RFIG+FG+S YDASVL +D   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQDWVDGIAASLPELPDEKKARFIGDFGLSDYDASVLTADVES 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLL-GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISG 408
           A YFE +A  R+ K+ ANWVIN+L   +     K+I D+P+SP QLG +IDLI    ISG
Sbjct: 355 AAYFEAVAEGRNGKLAANWVINELFGRLKKDEDKTITDSPVSPVQLGGIIDLISSDAISG 414

Query: 409 KIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLV 468
           KIAKD+F I++ +GG P EIVE  G++QVTD  AIE  +DE+I +NP  V +    P L 
Sbjct: 415 KIAKDLFEIVYTEGGDPAEIVEARGMKQVTDTGAIETALDEIIAANPAQVEKAKVNPKLA 474

Query: 469 SWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
            WFVGQVMK TGGKANP  V +++ +KLG
Sbjct: 475 GWFVGQVMKATGGKANPKAVNELVAKKLG 503


>gi|24418853|sp|P74215|GATB_SYNY3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
          Length = 495

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 219/486 (45%), Positives = 300/486 (61%), Gaps = 8/486 (1%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
             D+E +IG+E H QL+  SK+F   S +F + PNT V       PG+LP+LN   +  A
Sbjct: 7   KTDYEAIIGLETHCQLNTASKIFCNCSTDFDSPPNTNVCPVCLGYPGVLPVLNEEVLAAA 66

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           V  GL +N  I  YS F RK YFYPDLP+ YQISQ D PIV  G + + +   K+ +   
Sbjct: 67  VKLGLAINGQIAPYSKFDRKQYFYPDLPKNYQISQFDLPIVEHGSLEIELVDKKTKEITR 126

Query: 139 IEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
             +GI R+H+E+DAGK +H        S  S +D NR+GV L+EIV++PD+R+  EA  +
Sbjct: 127 KTIGITRLHMEEDAGKLVHAGSDRLAGSTHSLVDFNRTGVPLLEIVSEPDLRTGQEAAEY 186

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEY 252
              LR ++RYLG  DGNM+EGS+R DVN+SV     + +GT+ E+KN+NS   +  AIEY
Sbjct: 187 AQSLRQLVRYLGISDGNMQEGSLRCDVNISVRPVGQKEFGTKVEIKNMNSFSAIQKAIEY 246

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           E  RQI  + DG  I QETRL++     T S+R KE + DYRYF EPDL PLE+ E   +
Sbjct: 247 EIERQIKAIADGEEIYQETRLWEEGSQRTISMRKKEGSSDYRYFPEPDLPPLEVSEQQKQ 306

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVIN 371
                +PELP AKR R+  + G+S YDA VL  D+ +A YFE+ +    D K VANWV  
Sbjct: 307 TWFATLPELPSAKRARYEQKLGLSAYDARVLTEDRDVALYFEEAVNAGADPKAVANWVTQ 366

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D+   LN +  +I    + P+ L ELIDLI  GTISGKIAKDI   L EKGG+P++I+E 
Sbjct: 367 DIAAYLNNNRLTISGLALKPSALAELIDLITKGTISGKIAKDILPELLEKGGSPQKIIEA 426

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL Q++D   +  ++  VI  +P  + +    K N+  +FVGQVMK TGGKA+P +  +
Sbjct: 427 RGLVQISDPDELTAIIQAVIADHPKELEKFRSGKGNMQGFFVGQVMKRTGGKADPKLTNQ 486

Query: 491 MLKEKL 496
           ++ + L
Sbjct: 487 LIGKLL 492


>gi|163746154|ref|ZP_02153513.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Oceanibulbus
           indolifex HEL-45]
 gi|161380899|gb|EDQ05309.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Oceanibulbus
           indolifex HEL-45]
          Length = 504

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 292/507 (57%), Positives = 367/507 (72%), Gaps = 17/507 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L ++      + +G   DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ V+F D
Sbjct: 1   MLDL-SYDTPKPRVIAGAKHDWELVIGMEVHAQVASNAKLFSGASTQFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  C++QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ  +PIVG
Sbjct: 60  AAMPGMLPVINEYCIEQAVRTGLGLKAEINLKSAFDRKNYFYPDLPQGYQISQLYEPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +       V IERIH+EQDAGKSIHD    +S +DLNR+GV LMEIV+
Sbjct: 120 EGEVLVELGDGTA-----RLVRIERIHMEQDAGKSIHDMDPNMSFVDLNRTGVCLMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSV-----------CRPGE 229
           +PD+R   EA A+L+KLR ILRYLGTC+G+M+ G+MRADVNVS+            +   
Sbjct: 175 RPDIRGPEEAAAYLSKLRQILRYLGTCNGDMQSGAMRADVNVSICRVGQYEKYQETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIE EA+RQIAI+E GG + QETRLFDP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIEVEAKRQIAIVEAGGEVVQETRLFDPDKQETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPD K+ RFIG+FG+S YDASVL +D   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDEIAANLPELPDQKKARFIGDFGLSDYDASVLTADLDS 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE +A  RD K+ ANWVIN+L G L +  K+I D+P+SP QLG ++DLI    ISGK
Sbjct: 355 AGYFEAVAQGRDGKMAANWVINELFGRLKKDDKNITDSPVSPAQLGAIVDLIASDAISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAK++F I +  G  P EIVE  GL+QVTD  AIE  VDE+I +NP+ VA+    P L  
Sbjct: 415 IAKEVFEITYTTGRDPAEIVETEGLKQVTDTGAIETAVDEIIAANPDQVAKAQQNPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKL 496
           WFVGQVMK TGGKANP  V +++  KL
Sbjct: 475 WFVGQVMKATGGKANPKAVNEIVSRKL 501


>gi|302879995|ref|YP_003848559.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Gallionella
           capsiferriformans ES-2]
 gi|302582784|gb|ADL56795.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Gallionella
           capsiferriformans ES-2]
          Length = 482

 Score =  558 bits (1437), Expect = e-157,   Method: Composition-based stats.
 Identities = 232/478 (48%), Positives = 327/478 (68%), Gaps = 3/478 (0%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE+VIG+EVH QLS  +K+FSGAS  +GAEPNTQ      A+PG+LP+LN   V++AV  
Sbjct: 3   WEIVIGLEVHTQLSTRTKIFSGASTTYGAEPNTQADAVSIALPGVLPVLNKGAVERAVKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP-DKSGQFRTIE 140
           GL + AHI   SVFARKNYFYPDLP+GYQISQ D P+VG G +++ + P   + +     
Sbjct: 63  GLAVGAHIAPRSVFARKNYFYPDLPKGYQISQFDLPVVGMGALTIQVEPLSGNAKPYEKV 122

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           V I R HLE+DAGKS+H     ++ +DLNR+G  L+EIV++PDM S+ EA A+   L ++
Sbjct: 123 VRITRAHLEEDAGKSVHGASQGMTGVDLNRAGTPLLEIVSEPDMCSAAEAVAYAKTLHNL 182

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           +R++G  DGNM+EGS R DVNVSV +PGE  GTR E+KN+NS +++  AI++E + QI  
Sbjct: 183 VRWIGISDGNMQEGSFRCDVNVSVRKPGEELGTRREIKNLNSFKYMQQAIDFEVQWQIDT 242

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +E+GG I Q T LF+P   ETR++R+KEDA DYRYF +PDLLPL+I  + + A++ ++PE
Sbjct: 243 IENGGKIHQATILFNPDTGETRAMRSKEDAHDYRYFPDPDLLPLDITPEMLEAMRAELPE 302

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVLNR 379
           LP+A+R R++ E G+S YDA+ L S + +ADYF+    +  + K+ ANW+I +L   LNR
Sbjct: 303 LPEARRTRYVSELGLSAYDANSLTSSREMADYFDTCVTSVGNAKLCANWLIGELSAQLNR 362

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G  +   P+SP Q+  ++  I D T+S   AK++F  LW  GG    I+E  GL+QV+D
Sbjct: 363 DGLDMAQCPVSPQQMSGMLVRIADNTLSNAGAKEVFRTLWSDGGDADTIIEARGLKQVSD 422

Query: 440 LSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
             AIE +VDE+I +N + VA     K  L  +FVG  MK + GKANP+ + ++L +KL
Sbjct: 423 SGAIEALVDEIITANADKVAEYRSGKDKLFGFFVGLAMKASKGKANPAQLNEVLLKKL 480


>gi|146281398|ref|YP_001171551.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           stutzeri A1501]
 gi|166198809|sp|A4VIA8|GATB_PSEU5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|145569603|gb|ABP78709.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas stutzeri
           A1501]
          Length = 481

 Score =  558 bits (1437), Expect = e-157,   Method: Composition-based stats.
 Identities = 247/484 (51%), Positives = 337/484 (69%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+E+HAQLS  SK+FSG++  FGAEPNTQ S  D  MPG LP+LN   V+ A 
Sbjct: 1   MQWETVIGLEIHAQLSTQSKIFSGSATTFGAEPNTQASLVDLGMPGTLPVLNAEAVRMAC 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL ++A I + +VFARKNYFYPDLP+GYQ SQ D PIVG+G + +++         T 
Sbjct: 61  KFGLAIDAEIAEKNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITLED-----GSTR 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RS+ EA A++  + +
Sbjct: 116 RIGITRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYLG CDGNM EGS+R D NVSV       +GTR E+KNVNS RF+  AI +E +RQI
Sbjct: 176 LVRYLGICDGNMAEGSLRCDCNVSVRPKGQAEFGTRAEIKNVNSFRFIEKAINHEVQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP+K+ETRS+R+KE+A DYRYF  PDLLP+ I++ F+  ++  +
Sbjct: 236 ELIEDGGKVVQETRLYDPNKDETRSMRSKEEANDYRYFPCPDLLPVVIEQSFLDEVRASL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELP  KRERF  EFG+S YDASVL + + +ADYFE++     D K+ ANWV+ +L  +L
Sbjct: 296 PELPGQKRERFEREFGLSTYDASVLSASREMADYFEQVNATCGDAKLAANWVMGELSSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  IE +P++  QLG +I  I D TISGKIAK +F  +    G+  EI+E+ GL+QV
Sbjct: 356 NKEGLDIEQSPVTAEQLGGMILRIKDDTISGKIAKMVFEAMAAGEGSADEIIEKKGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIE ++DEV+ +N   V +        +  +  +FVGQ MK + GKANP  V ++L
Sbjct: 416 TDSGAIEAMLDEVLAANAEQVEQYRASDEAKRGKMFGFFVGQAMKASKGKANPGQVNQLL 475

Query: 493 KEKL 496
           K+KL
Sbjct: 476 KKKL 479


>gi|217968689|ref|YP_002353923.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Thauera sp.
           MZ1T]
 gi|217506016|gb|ACK53027.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thauera sp. MZ1T]
          Length = 486

 Score =  558 bits (1437), Expect = e-156,   Method: Composition-based stats.
 Identities = 237/487 (48%), Positives = 324/487 (66%), Gaps = 8/487 (1%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
           +  DWEVVIG+EVHAQL   SK+FSGAS  FGAEPN Q S  D A+PG+LP+LN   V++
Sbjct: 2   SRSDWEVVIGLEVHAQLDTASKIFSGASTAFGAEPNRQASAVDIALPGVLPVLNRGAVER 61

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           A+  GL + AH+ + SVFARKNYFYPDLP+GYQISQ D P+V  G +++ +G  +     
Sbjct: 62  AIRFGLAIGAHVAEKSVFARKNYFYPDLPKGYQISQMDLPVVVGGTITIRVG--EGESAY 119

Query: 138 TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
              V + R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRSS EA A+   L
Sbjct: 120 EKTVRLTRAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSEPDMRSSAEAVAYARTL 179

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
            +++R++  CDGNM+EGS R D NVSV R     +GTR E+KN+NS RFL  AI+YE + 
Sbjct: 180 HALVRWIDICDGNMQEGSFRCDANVSVRRKGATEFGTRREIKNLNSFRFLQQAIDYEVQW 239

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           QI  LEDGG I Q T LFDP   ETR +R+KEDA DYRYF +PDLLPL I  ++   ++ 
Sbjct: 240 QIDTLEDGGRIEQATVLFDPDTGETRMMRSKEDAHDYRYFPDPDLLPLMIAPEWKARVQA 299

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRD---KKIVANWVINDL 373
           ++PELP A + RF+ ++G+S YDA+ L + K +AD+++           K  ANWV+ +L
Sbjct: 300 EMPELPGAMKGRFMDDWGLSAYDATTLTASKEVADFYQATVSAAGAALAKPCANWVMGEL 359

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG-TPKEIVEEL 432
              LN++   +  +P+SP QL  L+  I D TIS  IA+ +F  LW   G T  E++++ 
Sbjct: 360 AARLNKAELDVAASPVSPAQLAGLVARIADNTISNAIARKVFEALWNGEGATADEVIDKQ 419

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GLRQVTD  AIE ++DEV+ +N  +V      K    +  VGQVMK + GKA P+ V  +
Sbjct: 420 GLRQVTDTGAIEAMIDEVLAANQKSVEEFRAGKEKAFNALVGQVMKASKGKAGPAQVNAL 479

Query: 492 LKEKLGI 498
           L++KLG 
Sbjct: 480 LRKKLGA 486


>gi|167561087|ref|ZP_02354003.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           oklahomensis EO147]
 gi|167568305|ref|ZP_02361179.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           oklahomensis C6786]
          Length = 495

 Score =  558 bits (1437), Expect = e-156,   Method: Composition-based stats.
 Identities = 244/492 (49%), Positives = 336/492 (68%), Gaps = 16/492 (3%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++    +  + 
Sbjct: 64  GLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGRITIQVPANEKAGKEAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 184 LVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQI 243

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D++  +K ++
Sbjct: 244 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWVERVKGEM 303

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE--------KLAVNRDKKIVANWVI 370
           PELP A ++RF+ ++G+S YDA VL S K++A YFE          A   + KI ANW++
Sbjct: 304 PELPAAMQQRFVEQYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAAGADGANAKIAANWLM 363

Query: 371 NDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPK 426
            D+   LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G   
Sbjct: 364 GDVSSQLNRDGIDIDACPVSAAQLALVLRRIADGTISNKIAKEIFVTIWDEKAADEGAAD 423

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANP 485
            I+E  GL+Q++D  A+E ++DEV+ +N  +V      K    +  VGQ MK T GKANP
Sbjct: 424 RIIEAKGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALVGQAMKATKGKANP 483

Query: 486 SIVQKMLKEKLG 497
             V ++LK+KLG
Sbjct: 484 QQVNELLKKKLG 495


>gi|297717788|gb|ADI50037.1| aspartyl/glutamyl-tRNA amidotransferase subunit b [Candidatus
           Odyssella thessalonicensis L13]
          Length = 492

 Score =  558 bits (1437), Expect = e-156,   Method: Composition-based stats.
 Identities = 281/497 (56%), Positives = 364/497 (73%), Gaps = 13/497 (2%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
           ++ +++L  G TG WEVVIG+EVHAQ    +KLF G S +FGAEPNTQV FF AAMPGML
Sbjct: 1   MSENKNLIEGRTGLWEVVIGLEVHAQTISKAKLFDGCSTDFGAEPNTQVGFFTAAMPGML 60

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P+LN  CV+QA+ TGLGLNA +NK+SVF RKNYFY DLP GYQISQ   PIV  G + + 
Sbjct: 61  PVLNQFCVEQAIKTGLGLNATVNKFSVFDRKNYFYADLPCGYQISQFSHPIVTGGYLDID 120

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
           +   +S       + I R+H+E DAGKSIHD +   + IDLNRSG+ALMEIV++P+MRSS
Sbjct: 121 LEGGES-----KRINITRLHMEMDAGKSIHDLHPTKTYIDLNRSGIALMEIVSEPEMRSS 175

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLG 247
            EA A++ KLRSILRYLGTCDGNME+GS+R D N+S+ RPG+ +GTR E+KNVNSIRFLG
Sbjct: 176 SEAMAYVKKLRSILRYLGTCDGNMEQGSLRVDANISLRRPGDPFGTRAEIKNVNSIRFLG 235

Query: 248 LAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEID 307
            AIEYE +RQ+ ILEDGG + QETRLFDP+K ETRS+R+KEDA DYRYF +PDLLPL + 
Sbjct: 236 QAIEYEIQRQLDILEDGGQVIQETRLFDPNKGETRSMRSKEDAHDYRYFPDPDLLPLRLS 295

Query: 308 EDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-------KLAVNR 360
           ++ I  ++  +PELPDAKR+R I EFG+ LYDA+V+V+++  ADY+E            +
Sbjct: 296 DERIENVRITMPELPDAKRQRLIAEFGLPLYDATVIVTERETADYYERAVAALKAKDKAQ 355

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
             K++ANW++ D+   +N+  K++E  P++   L  LIDLI+D TISGKIAKD+F  +W+
Sbjct: 356 GAKLIANWLMGDVFAAMNKDNKTVETMPVTAENLAGLIDLILDNTISGKIAKDVFTKMWD 415

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNT 479
            G  P  +VEELGL+Q+TD S IE+ VD V+  + + VA     K  L  +FVGQVMK T
Sbjct: 416 SGKAPSLLVEELGLKQITDTSVIEQAVDTVLAQHADKVAEYKSGKEALFGFFVGQVMKAT 475

Query: 480 GGKANPSIVQKMLKEKL 496
            GKANP +V  ++K KL
Sbjct: 476 QGKANPGLVNDLIKNKL 492


>gi|332705004|ref|ZP_08425089.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Lyngbya
           majuscula 3L]
 gi|332356181|gb|EGJ35636.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Lyngbya
           majuscula 3L]
          Length = 495

 Score =  558 bits (1437), Expect = e-156,   Method: Composition-based stats.
 Identities = 218/492 (44%), Positives = 308/492 (62%), Gaps = 9/492 (1%)

Query: 13  SLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNG 72
           +  +     +E +IG+E H QLS  +K+FS +S  FGA PNT +      MPG+LP+LN 
Sbjct: 2   TTAAPAKTQYEAIIGLETHCQLSTETKIFSNSSTKFGATPNTNIDPICMGMPGVLPVLNQ 61

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
           + ++ AV  GL LN  I  YS F RK YFYPDLP+ YQISQ+D PI   G + + +    
Sbjct: 62  KVLEYAVKAGLALNCQIAPYSKFDRKQYFYPDLPKNYQISQYDLPIAEHGSLEIEVSD-D 120

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSS 187
            G      +GI R+H+E+DAGK +H        S  S +D NR+GV L+EIV++PD+RS 
Sbjct: 121 DGNPIRKTIGITRLHMEEDAGKLVHAGSDRLAGSTYSLVDFNRAGVPLIEIVSEPDLRSG 180

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFL 246
            EA  +  +LR I+RY+G  DGNM+EGS+R DVN+SV     + +GT+ E+KN+NS   +
Sbjct: 181 QEAAEYAQELRRIVRYIGVSDGNMQEGSLRCDVNISVRPVGQKEFGTKVEIKNMNSFNAI 240

Query: 247 GLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEI 306
             AIEYE  RQIA +E G  I QETRL++     T S+RTKE + DYRYF EPDL P+E+
Sbjct: 241 QKAIEYEIDRQIAAVEAGKSIIQETRLWEEGSQRTISMRTKEGSSDYRYFPEPDLPPIEV 300

Query: 307 DEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIV 365
             + +   + ++ ELP  KR R+  E G+S YDA VL  D+ +A+YFE  +A N + K  
Sbjct: 301 STEQLEQWRSELAELPAQKRHRYESELGLSAYDARVLTDDRQVAEYFETSVAANANPKQA 360

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ANWV+ D+   L     +I +  + PN L ELI+LI D TISGKIAK+I   L  +GG+ 
Sbjct: 361 ANWVMGDIAAYLKTEKLAITEIALKPNTLAELINLIDDDTISGKIAKEILPELLSQGGSA 420

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKAN 484
           +E+VE  GL +++D   +  ++DEV+ +NP  + +    K  L  +FVGQVMK T G+A+
Sbjct: 421 RELVERKGLIKISDPDQLSTIIDEVLAANPKKLEQYRNGKTKLQGFFVGQVMKKTSGRAD 480

Query: 485 PSIVQKMLKEKL 496
           P +  ++L +KL
Sbjct: 481 PKLTNQILGKKL 492


>gi|304405106|ref|ZP_07386766.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Paenibacillus
           curdlanolyticus YK9]
 gi|304345985|gb|EFM11819.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Paenibacillus
           curdlanolyticus YK9]
          Length = 479

 Score =  557 bits (1436), Expect = e-156,   Method: Composition-based stats.
 Identities = 207/478 (43%), Positives = 301/478 (62%), Gaps = 9/478 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E V+G+EVH +L   SK+F G S  FGA PNT         PG+LP+LN + V+ A+  
Sbjct: 5   YETVVGLEVHVELHTNSKIFCGCSTAFGAPPNTHTCPICLGHPGVLPVLNRQAVEYAMKA 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
            + LN  +   S F RKNYFYPD P+ YQISQ+D+PI   G + + +         T  +
Sbjct: 65  SMALNCQVADVSKFDRKNYFYPDSPKAYQISQYDQPIGEHGWIDIEVNG------ETKRI 118

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R+HLE+DAGK  H      S +D NR G  L+EIV++PD+R+  EAKA+L K+R+I+
Sbjct: 119 GITRVHLEEDAGKLTHVDGGYASLVDFNRVGTPLIEIVSEPDIRTPEEAKAYLEKIRAIM 178

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            Y    D  MEEGSMR D N+S+   G+  +G R E+KN+N+ R +   +EYE  RQ  I
Sbjct: 179 LYCDVSDVKMEEGSMRCDANISLRPYGQEQFGIRAELKNMNTFRGVQRGLEYEQWRQAEI 238

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           L  GG + QETR +D ++ +T S+R KE+A DYRYF +PDL+ L ID ++   ++  IPE
Sbjct: 239 LNSGGTVVQETRRWDEAQGKTLSMRGKEEAHDYRYFPDPDLVRLNIDAEWKERVRASIPE 298

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVLNR 379
           LPDA++ R++ E+ +  YDA VL S   +A++FE+     +D K V+NW++ DLLG LN 
Sbjct: 299 LPDARKARYVAEYELPSYDAEVLTSSIKMANFFEESLQYTKDAKAVSNWIMGDLLGYLNA 358

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           +    +   ++   LGE+I L+  GTI+ KIAK +F  + E G  P++IVEE GL Q++D
Sbjct: 359 NSLEFDQIKLTAQGLGEMIGLLDKGTINSKIAKTVFKSMLESGKLPQQIVEEQGLVQISD 418

Query: 440 LSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
             AI+ +V++++ +NP +VA     K   V + VGQVMK + GKANP++  K+L + L
Sbjct: 419 EGAIKAIVEQIVEANPQSVADYKAGKEKAVGFLVGQVMKASKGKANPALANKLLVDVL 476


>gi|294676398|ref|YP_003577013.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Rhodobacter
           capsulatus SB 1003]
 gi|294475218|gb|ADE84606.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Rhodobacter
           capsulatus SB 1003]
          Length = 505

 Score =  557 bits (1436), Expect = e-156,   Method: Composition-based stats.
 Identities = 291/510 (57%), Positives = 366/510 (71%), Gaps = 17/510 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+      A    + +G   DWE+VIG+EVHAQ++  +KLFSGAS  FG EPN  V+F D
Sbjct: 1   MLDHLAFTAPEPKVIAGAKSDWELVIGMEVHAQVASNAKLFSGASTMFGNEPNANVAFVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV QAV TGL L A IN  S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEFCVAQAVRTGLALKAGINLRSAFDRKNYFYPDLPQGYQISQLYHPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG++ V +GP  +      +V IERIHLEQDAGKSIHD    +S +D NR+GVALMEIV+
Sbjct: 121 EGEIIVDMGPGVA-----RKVRIERIHLEQDAGKSIHDMDPTMSFVDFNRTGVALMEIVS 175

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A++ KLR ILRY+GTCDGNM+ G++RADVNVSVCRPG+           
Sbjct: 176 RPDIRGPEEAAAYIAKLRQILRYIGTCDGNMQNGNLRADVNVSVCRPGQYEKYQATQDFS 235

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AI+YEARRQIAILEDGG I QETRL+DP K ETRS+R+KE+
Sbjct: 236 HLGTRCEIKNMNSMRFIQQAIDYEARRQIAILEDGGSIVQETRLYDPDKGETRSMRSKEE 295

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF  PDLLPLEI++ ++  I   +PELPD K+ RF+ + G+S YDASVL ++ + 
Sbjct: 296 AHDYRYFPCPDLLPLEIEQAWVDDIGATMPELPDEKKARFVKDLGLSEYDASVLTAEVAD 355

Query: 350 ADYFEKLAVNRDK-KIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISG 408
           A+YFE +    +  K+ ANWVIN+L G L + G  I  +P+SP QLG +I LI  G ISG
Sbjct: 356 AEYFEAVVAVAEDGKLAANWVINELFGRLKKEGHEIGQSPVSPVQLGGIIKLIRSGDISG 415

Query: 409 KIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLV 468
           KIAKD+F I++ +GG P  IVE  G++QVTDL AIE  VDE+I +NP  V +    P L 
Sbjct: 416 KIAKDLFEIVYTEGGDPAAIVEARGMKQVTDLGAIEAAVDEIIAANPAQVEKAKANPKLA 475

Query: 469 SWFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
            WFVGQV+K +GGKANP+ V +++  KLG+
Sbjct: 476 GWFVGQVIKASGGKANPAAVNEIVARKLGL 505


>gi|187922336|ref|YP_001893978.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           phytofirmans PsJN]
 gi|229486050|sp|B2T1M5|GATB_BURPP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|187713530|gb|ACD14754.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           phytofirmans PsJN]
          Length = 491

 Score =  557 bits (1436), Expect = e-156,   Method: Composition-based stats.
 Identities = 236/486 (48%), Positives = 334/486 (68%), Gaps = 11/486 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS  SK+FSG +  FGA PNTQ S  D A+PG LP++N   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTQSKIFSGTATQFGAAPNTQASPVDLALPGTLPVMNRGAVERAIQF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G+V++ +  ++    +    
Sbjct: 65  GLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQVTIQVPANEKAGKEAYEK 124

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 125 VVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKTLHT 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV       +GTR E+KN+NS RFL  AI+YE RRQI
Sbjct: 185 LVTWLGICDGNMQEGSFRCDANVSVRPVGQAEFGTRAEIKNLNSFRFLEEAIQYEVRRQI 244

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL ID  +I  +K ++
Sbjct: 245 ELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIDAAWIERVKAEM 304

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVINDLLG 375
            ELP A ++RF+ ++G++ YDA+VL S K++A Y+E +       + K+ ANW++ ++  
Sbjct: 305 TELPVAIQQRFVSQYGLTPYDANVLTSSKAMAAYYEAVVSKVGPANAKVAANWLMGEVSS 364

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT----PKEIVEE 431
            LNR G  I + P+S  QL  L+  I DGTIS KIAK+IF  +WE+  T       I+E 
Sbjct: 365 QLNREGLDIAENPVSSAQLALLLQRIADGTISNKIAKEIFLAIWEEKATDESAADRIIEA 424

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +NP +V      K    +  +GQ MK T GKANP+ V +
Sbjct: 425 KGLKQISDTGALEAIIDEVLAANPKSVEEFRAGKEKAFNALIGQAMKATKGKANPAQVNE 484

Query: 491 MLKEKL 496
           +LK+KL
Sbjct: 485 LLKKKL 490


>gi|114565930|ref|YP_753084.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
 gi|114336865|gb|ABI67713.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
          Length = 480

 Score =  557 bits (1436), Expect = e-156,   Method: Composition-based stats.
 Identities = 221/484 (45%), Positives = 312/484 (64%), Gaps = 12/484 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           + ++E VIG+EVHA+L   SK+F   S  FGAEPN+QV  F A  PG LP+LN + ++ A
Sbjct: 2   SKEFETVIGLEVHAELKTESKIFCSCSTAFGAEPNSQVCPFCAGFPGALPVLNEKVLELA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           + TG+ LN  I +Y  F RKNYFYPDLP  YQISQ+D+P+   G + + +          
Sbjct: 62  IRTGIALNCEIPEYCKFDRKNYFYPDLPAAYQISQYDQPVCINGYLEIDLDG------EI 115

Query: 139 IEVGIERIHLEQDAGKSIHDQY---SAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
             + I R H+E+DAGK +H      +  S +DLNR G+ L+EIV++PDMRS+ EA+A+L 
Sbjct: 116 KRIRINRAHMEEDAGKLVHQGDITTTPFSLVDLNRCGIGLLEIVSEPDMRSAREARAYLE 175

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEA 254
           KLRSIL + G  D  M+EGS+R D N+SV     E  GTR E+KN+NS R L  AIEYEA
Sbjct: 176 KLRSILLFAGVSDCKMQEGSLRCDANISVRPAGQEELGTRTEIKNLNSFRSLERAIEYEA 235

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           RR +  +EDG  + QETR +D  K  TRS+R+KE+A DYRYF +PDL PL I  + I  +
Sbjct: 236 RRHVEAIEDGEELLQETRTWDEEKQVTRSMRSKEEADDYRYFPDPDLPPLRISRERIEEV 295

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDL 373
           ++Q+PELPD  +ER +  +G+  YDA++L +     ++F+++     D K+VANW++++L
Sbjct: 296 RRQMPELPDVAQERLVETYGLPHYDATILTTTPDYLEFFDRVIKIYPDAKVVANWMMSEL 355

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
              LN+S   I D  I P  L E++ LI DGTISGK+AK +F  ++  G    E+V E G
Sbjct: 356 NKYLNQSNLEISDCLIKPENLVEMLQLIDDGTISGKMAKTVFAEMFNSGKRAPEVVREKG 415

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           + Q++D  A+  +++ ++N NP  V      K     +FVGQVMK T G+ANP++V K+L
Sbjct: 416 MVQISDEKALSAIIESIVNGNPKVVEDYRNGKEKAFGFFVGQVMKATRGQANPAVVNKLL 475

Query: 493 KEKL 496
           KEKL
Sbjct: 476 KEKL 479


>gi|34580853|ref|ZP_00142333.1| glutamyl-tRNA amidotransferase subunit B [Rickettsia sibirica 246]
 gi|28262238|gb|EAA25742.1| glutamyl-tRNA amidotransferase subunit B [Rickettsia sibirica 246]
          Length = 483

 Score =  557 bits (1436), Expect = e-156,   Method: Composition-based stats.
 Identities = 270/483 (55%), Positives = 346/483 (71%), Gaps = 6/483 (1%)

Query: 15  TSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRC 74
             G TG WE VIG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  C
Sbjct: 4   IEGNTGKWEYVIGLEIHAQISSKSKLFSGSSTIFAANPNSQVSYVDAAMPGMLPVLNKHC 63

Query: 75  VQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSG 134
           V QA+ TGLGL A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +        
Sbjct: 64  VHQAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEIPT-----S 118

Query: 135 QFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFL 194
                 + I R+HLEQDAGKSIHDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+
Sbjct: 119 TGDLKTIRINRLHLEQDAGKSIHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPEEAAEFV 178

Query: 195 TKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEA 254
            KLR++LRY+G+CDG+ME+GSMR D N+SV R GE  GTRCE+KN+NSIR +  AIE+EA
Sbjct: 179 KKLRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIIKAIEFEA 238

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           +RQ+ +LE G  I QETRLF+    ETR++R KE+ALDYRYF +PDLLPL I ++ I  +
Sbjct: 239 KRQVDLLESGEEIIQETRLFNADSGETRTMRLKEEALDYRYFPDPDLLPLVISDELINEL 298

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLL 374
           K  +PELPD K E++  EF +S YDA V+V+D+S+A+YFEK A   + K++ NW+ ++L 
Sbjct: 299 KANLPELPDQKIEKYTKEFSLSKYDAEVIVADESVAEYFEKAANECNPKMLTNWLTSELF 358

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
           G LN++   I +  I+P+   +L+ LI + TISGKIAK +F I++E G  P +IVEE GL
Sbjct: 359 GQLNKASIGINECKITPSNFAKLVKLIENDTISGKIAKTVFEIMFETGKAPDKIVEEKGL 418

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            QV+D + +  V+DEVI  NP +V      K  L  +FVGQVMK TGGKANP++V ++LK
Sbjct: 419 VQVSDNNVLNTVIDEVIAENPESVEGYRSGKDKLFGFFVGQVMKKTGGKANPTLVNQLLK 478

Query: 494 EKL 496
           EKL
Sbjct: 479 EKL 481


>gi|251795126|ref|YP_003009857.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Paenibacillus sp.
           JDR-2]
 gi|247542752|gb|ACS99770.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Paenibacillus sp.
           JDR-2]
          Length = 480

 Score =  557 bits (1436), Expect = e-156,   Method: Composition-based stats.
 Identities = 212/482 (43%), Positives = 301/482 (62%), Gaps = 9/482 (1%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
            +  +E V+G+EVH +L   SK+F G S  FGA  NT         PG+LP+LN + V+ 
Sbjct: 3   ESTQYETVVGLEVHVELHTNSKIFCGCSTAFGAPANTHTCPVCLGHPGVLPVLNKQAVEY 62

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           A+   + LN  I   S F RKNYFYPD P+ YQISQ D+PI   G + + +         
Sbjct: 63  AMKAAMALNCEIADISKFDRKNYFYPDSPKAYQISQFDQPIGENGWIDIEVNG------E 116

Query: 138 TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
           T  +GI R+HLE+DAGK  H      S +D NR G  L+EIV++PD+R+  EAKA+L KL
Sbjct: 117 TKRIGITRLHLEEDAGKLTHVDGGYASLVDFNRVGTPLVEIVSEPDIRTPEEAKAYLEKL 176

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           ++I+ Y    D  MEEGS+R D N+S+     E  GTR E+KN+NS R +   +EYE  R
Sbjct: 177 KAIMLYCEVSDVKMEEGSLRCDANISLRPYGQEKLGTRAELKNMNSFRGVQRGLEYEQIR 236

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q  IL +GG + QETR FD +  +T S+R KE++ DYRYF +PDL+ L I +++   ++ 
Sbjct: 237 QAEILNEGGLVVQETRRFDDTLGKTFSMRGKEESHDYRYFPDPDLVRLNISQEWKDRVRA 296

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLG 375
            IPELPDA++ R+  ++G+  YDA V+ S K +AD+FE+     +D K V+NW++ DLLG
Sbjct: 297 SIPELPDARKARYTSDYGLPSYDAEVITSSKKLADFFEESLNYTKDAKAVSNWIMGDLLG 356

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            LN +   + +  I+   LGE+I L+  GTIS KIAK +F  + E G  P++IVEE GL 
Sbjct: 357 YLNANSLELSEVKITGQGLGEMIGLLEKGTISSKIAKTVFKAMLESGKLPQQIVEEQGLV 416

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q++D  A+  VVD++I +NP +V      K   + + VGQ+MK T GKANP++V K+L E
Sbjct: 417 QISDEGALVAVVDQIIQANPQSVEDFKAGKDKAIGFLVGQIMKETKGKANPALVNKLLLE 476

Query: 495 KL 496
           +L
Sbjct: 477 RL 478


>gi|218246014|ref|YP_002371385.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Cyanothece sp.
           PCC 8801]
 gi|226709603|sp|B7K293|GATB_CYAP8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|218166492|gb|ACK65229.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Cyanothece sp. PCC
           8801]
          Length = 495

 Score =  557 bits (1436), Expect = e-156,   Method: Composition-based stats.
 Identities = 223/487 (45%), Positives = 312/487 (64%), Gaps = 8/487 (1%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
               +E +IG+E H QL+  SK+F   S NF + PNT +       PG+LP+LN   +  
Sbjct: 7   AKTKYEAIIGLETHCQLNTNSKIFCACSTNFDSPPNTNICPICLGYPGVLPVLNEEVLAS 66

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           AV  GL +N  I  YS F RK YFY DLP+ YQISQ+D PIV  G + + +   K+ +  
Sbjct: 67  AVKLGLAINGKIASYSKFDRKQYFYADLPKNYQISQYDLPIVEHGFLEIELVDKKTKEVT 126

Query: 138 TIEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKA 192
              +GI R+H+E+DAGK +H        S  S +D NR+GV L+EIV++PD+RS  EA  
Sbjct: 127 RKTIGITRLHMEEDAGKLVHAGSDRLAGSTHSLVDFNRTGVPLLEIVSEPDLRSGQEAAE 186

Query: 193 FLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIE 251
           +  +LR ++RYLG  DGNM+EGS+R DVN+S+     + +GT+ E+KN+NS   +  AIE
Sbjct: 187 YAQELRRLVRYLGISDGNMQEGSLRCDVNISIRPVGQKEFGTKVEIKNMNSFSAIQKAIE 246

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
           YE  RQI  LE+   I QETRL++     T S+R KE + DYRYF EPDL PLE+  + +
Sbjct: 247 YEIERQIEALENNEPIYQETRLWEEKTQCTVSMRKKEGSSDYRYFPEPDLPPLEVSPEQL 306

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANWVI 370
              K Q+PELP  KR R+  EFG+S YDA VL  D+ +A+Y+E  +A   D K+VANWV 
Sbjct: 307 EHWKHQLPELPAQKRSRYEAEFGLSAYDARVLTDDRDVANYYEAAVAAGADAKLVANWVT 366

Query: 371 NDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVE 430
            D+   LN +  +I +  ++P  LGEL+ LI  GTISGKIAK+I   L EKGG+PKE+V 
Sbjct: 367 QDIAAYLNNNKLAIAEIVLTPQSLGELVQLIETGTISGKIAKEILPELLEKGGSPKELVA 426

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQ 489
           + G+ Q++DL  +EK++DE+I +NP  + +    K NL  +FVGQVMK TGG+A+P +  
Sbjct: 427 KKGMTQISDLGELEKIIDEIIAANPKELEKFRSGKTNLKGFFVGQVMKQTGGRADPKLTN 486

Query: 490 KMLKEKL 496
           +++ +KL
Sbjct: 487 QLVDQKL 493


>gi|256828112|ref|YP_003156840.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Desulfomicrobium
           baculatum DSM 4028]
 gi|256577288|gb|ACU88424.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfomicrobium
           baculatum DSM 4028]
          Length = 476

 Score =  557 bits (1436), Expect = e-156,   Method: Composition-based stats.
 Identities = 233/480 (48%), Positives = 315/480 (65%), Gaps = 9/480 (1%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           D+EVVIG+EVHAQL   SK+F   S  FGA PN         MPGMLP+LN R V+ AV 
Sbjct: 3   DYEVVIGLEVHAQLKTKSKIFCSCSTQFGAGPNENTCPVCTGMPGMLPVLNARAVEYAVK 62

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
             + ++  +N+ S+FARKNYFYPDLP GYQISQ + P+   G + +        +     
Sbjct: 63  MAMAVDCTVNRRSLFARKNYFYPDLPMGYQISQFELPVAEHGHIVIHT------EKGEKR 116

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           +GI RIH+E DAGK+IH      S +DLNR+GV L+EIV++PDMRS+ EA A+L  LR+I
Sbjct: 117 IGITRIHMENDAGKNIHSATDNASYVDLNRAGVPLIEIVSEPDMRSAEEAVAYLKSLRAI 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           L YLG CDGN+EEGS R D NVS+     E +GTR E+KN+NS R +  AIEYE  RQI 
Sbjct: 177 LVYLGICDGNLEEGSFRCDANVSIRPRGQEEFGTRAELKNMNSFRNIQRAIEYEVERQID 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++EDG  + QETRLFD +K  TRS+R KE+A DYRYF +PDLLPL I E+ +   + ++P
Sbjct: 237 LVEDGEQVVQETRLFDTAKGVTRSMRGKEEAHDYRYFPDPDLLPLIIKEEQMVKWRGELP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR-DKKIVANWVINDLLGVLN 378
           ELP+A+  RF  E G+  YD+ VL ++K +ADYFE       + K ++NWV+ +++  LN
Sbjct: 297 ELPEARCRRFQEELGLPGYDSLVLTAEKEVADYFETALATYTEPKKISNWVMGEVMRELN 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
             G ++ +  +    L  L+ L+ DG +SG IAK++F  L+E GG P+  V+  GL Q++
Sbjct: 357 DRGATLAECKLRAQDLARLVKLVDDGLVSGTIAKNVFKELFETGGDPEAYVKAKGLVQIS 416

Query: 439 DLSAIEKVVDEVINSNPNNVARIATKP-NLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D SAIE +VDEV+  NP+ V R       L  +FVGQVMK + GKANP +V ++L +KLG
Sbjct: 417 DTSAIEGLVDEVLAENPSEVERYKGGDKKLTGFFVGQVMKKSKGKANPGLVNQLLAKKLG 476


>gi|332525708|ref|ZP_08401857.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rubrivivax benzoatilyticus JA2]
 gi|332109267|gb|EGJ10190.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rubrivivax benzoatilyticus JA2]
          Length = 483

 Score =  557 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 227/479 (47%), Positives = 308/479 (64%), Gaps = 9/479 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +EVVIG E HAQLS  SK+FSGAS  FGAEPNTQ    D A+PG LP+ N   V++A+  
Sbjct: 10  YEVVIGFETHAQLSTESKIFSGASTRFGAEPNTQACPVDLALPGTLPVANRGAVERAIRF 69

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G VS  +  +K        V
Sbjct: 70  GLAVGAKVAPLSIFARKNYFYPDLPKGYQISQYEIPVVQGGSVSFLLDGEK------RSV 123

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS+H+ Y   S IDLNR+G  L+EIV++PD+RSS EA  +   L +++
Sbjct: 124 RLTRAHLEEDAGKSLHEDYHGQSGIDLNRAGTPLLEIVSEPDLRSSAEAVEYAKALHALV 183

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
            +LG CDGNM+EGS R D NVSV RPGE +GTR E+KN+NS RFL  AI++E + QI  L
Sbjct: 184 VWLGICDGNMQEGSFRCDANVSVRRPGEPFGTRREIKNLNSFRFLQQAIDFEVQWQIDRL 243

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           EDG  I Q T LF+P   ETR++R+KEDA DYRYF +PDL PL I  D++  ++  +PEL
Sbjct: 244 EDGLAIEQATVLFNPDTGETRAMRSKEDAHDYRYFPDPDLPPLVIAPDWVERVRAAMPEL 303

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR-DKKIVANWVINDLLGVLNRS 380
           P    ERF  + G+  YDA+++    + A Y+E         K+VANW++ ++   LN  
Sbjct: 304 PAVMAERFQRDDGLPAYDAAMMTQSLAFARYYEAARDGCGQPKLVANWLMGEVSKRLNAE 363

Query: 381 GKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG-TPKEIVEELGLRQVTD 439
           G +I+  P+ P  L  LI  I DGT+S   A+ +F+ LW         ++E  GL+Q+ D
Sbjct: 364 GGAIDAAPVGPQTLAALIGRIADGTVSNNGARQVFDALWNGEASDVDAVIEAKGLKQMND 423

Query: 440 LSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
             A+EK+VDEV+ +N  +V      K    +  VGQVMK + GKANP+   ++L+ KLG
Sbjct: 424 SGALEKIVDEVLAANTKSVEEFRAGKDKAFNALVGQVMKASKGKANPAQASELLRRKLG 482


>gi|330950290|gb|EGH50550.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae Cit 7]
          Length = 481

 Score =  557 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 245/484 (50%), Positives = 337/484 (69%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV
Sbjct: 1   MQWEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL +NA I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + + +           
Sbjct: 61  KFGLAVNAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDIPLED-----GTVK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +
Sbjct: 116 RIGITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RYLG CDGNM EGS+R D NVS+       +GTRCE+KNVNS RF+  AI  E +RQI
Sbjct: 176 IVRYLGICDGNMAEGSLRCDCNVSIRPKGQAEFGTRCEIKNVNSFRFIEKAINSEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ F+   +  +
Sbjct: 236 DLIEDGGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFLEETRATL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELP  KRERF  +FG+S YDASVL S +  ADYFE++   + D K+ ANWV+ +L  +L
Sbjct: 296 PELPPQKRERFQSQFGLSTYDASVLASSREQADYFEQVVSISGDAKLAANWVMVELGSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  I+ +P+S  QLG ++  I D TISGKIAK +F  +    G+  EI+E+ GL+QV
Sbjct: 356 NKQGLEIDQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAMANGEGSADEIIEKRGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIE ++DEV+ +N   V +        +  +  +FVGQ MK + GKANP  V ++L
Sbjct: 416 TDSGAIESMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELL 475

Query: 493 KEKL 496
           K KL
Sbjct: 476 KTKL 479


>gi|157964218|ref|YP_001499042.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           massiliae MTU5]
 gi|157843994|gb|ABV84495.1| Glutamyl-tRNA amidotransferase subunit B [Rickettsia massiliae
           MTU5]
          Length = 495

 Score =  557 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 270/485 (55%), Positives = 348/485 (71%), Gaps = 6/485 (1%)

Query: 13  SLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNG 72
           +   G TG WE VIG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN 
Sbjct: 3   TYIEGNTGKWEYVIGLEIHAQISSKSKLFSGSSTIFAASPNSQVSYIDAAMPGMLPVLNK 62

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
            CV QA+ TGLGL A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +      
Sbjct: 63  HCVHQAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEIPT---- 118

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKA 192
                   + I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  
Sbjct: 119 -STGNLKTIRINRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPAEAAE 177

Query: 193 FLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEY 252
           F+ KLR++LRY+G+CDG+ME+GSMR D N+SV R GE  GTRCE+KN+NSIR +  AIE+
Sbjct: 178 FVKKLRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIIKAIEF 237

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           EA+RQ+ +LE G  I QETRLF+    ETR++R KE+ALDYRYF +PDLLPL I ++ I 
Sbjct: 238 EAKRQVDLLESGEEIIQETRLFNADSGETRTMRLKEEALDYRYFPDPDLLPLVISDELIN 297

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIND 372
            +K  +PELPD K E++  EF +S YDA V+V+D+S+A+YFEK A   + K++ANW+ ++
Sbjct: 298 ELKANLPELPDQKIEKYTKEFSLSQYDAEVIVADESVAEYFEKAANECNPKMLANWLTSE 357

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEEL 432
           L G LN++   I +  I+P+   +L+ LI + TISGKIAK +F I++E G  P +IVEE 
Sbjct: 358 LFGQLNKTSIGINECKITPSNFAKLVKLIENDTISGKIAKTVFEIMFETGKAPDKIVEEK 417

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL QV+D + +  V+DEVI  NP +V      K  L  +FVGQVMK TGGKANP++V ++
Sbjct: 418 GLVQVSDNNVLNTVIDEVIAENPESVEGYSNGKDKLFGFFVGQVMKKTGGKANPTLVNQL 477

Query: 492 LKEKL 496
           LKEKL
Sbjct: 478 LKEKL 482


>gi|323697488|ref|ZP_08109400.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfovibrio sp.
           ND132]
 gi|323457420|gb|EGB13285.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfovibrio
           desulfuricans ND132]
          Length = 477

 Score =  557 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 229/479 (47%), Positives = 313/479 (65%), Gaps = 10/479 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+EVHAQL   SK+F   S  FG +PN  V    + MPG+LP+ N +  + A   
Sbjct: 4   YETVIGLEVHAQLKTESKIFCSCSTKFGNDPNENVCAVCSGMPGVLPVFNEKVAEYATKA 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL  +  IN  SVFARKNYFYPDLP+GYQISQ ++PI   G V + +            V
Sbjct: 64  GLATDCVINLKSVFARKNYFYPDLPKGYQISQFEQPICEHGHVDIEVDG------ERKRV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           G+ RIH+E+DAGK+IH     VS +DLNR+GV L+EIV++PDMRS+ EA A+L +LRS+L
Sbjct: 118 GLTRIHMEEDAGKNIHSAADNVSFVDLNRTGVPLIEIVSEPDMRSAEEAVAYLKELRSVL 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            YLG CDGNMEEGS R D NVS+   G+  +GTR E+KN+NS + +  AIEYE  RQI +
Sbjct: 178 LYLGICDGNMEEGSFRCDANVSIRPYGQEAFGTRAELKNLNSFKHIQKAIEYEVERQIDL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +EDG  + QETRL++  K  T S+R KE+A DYRYF +PDL+PL +D+ ++   + ++PE
Sbjct: 238 VEDGEQVIQETRLYNVEKGTTHSMRGKEEAHDYRYFPDPDLVPLVLDQAWVDKWRSELPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK--LAVNRDKKIVANWVINDLLGVLN 378
           LP AKR RF+ E+ ++ YDA+++  D ++ADYFE    A   D K V NWV+ +LL   +
Sbjct: 298 LPSAKRARFMAEYDLADYDAALITGDLAVADYFEAAVKAYAGDPKKVTNWVVGELLPFCH 357

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
            SG       ++P++L  L+ L+ DGTIS KI KDIF  L   G  P   VE  GL QV+
Sbjct: 358 ESGTEACGVRLTPDKLAALLALVDDGTISVKIGKDIFRDLCATGDDPAAYVEAKGLVQVS 417

Query: 439 DLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           D S +E +VD+VI  NP+ V      K  L+ +F+GQVM+ + G+ANP +V ++  +KL
Sbjct: 418 DTSELEAMVDKVIADNPSEVEAYKGGKTKLMGFFMGQVMRLSKGQANPGVVTQLFTKKL 476


>gi|307823388|ref|ZP_07653617.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacter
           tundripaludum SV96]
 gi|307735373|gb|EFO06221.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Methylobacter
           tundripaludum SV96]
          Length = 478

 Score =  557 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 246/479 (51%), Positives = 329/479 (68%), Gaps = 10/479 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE VIG+E+HAQL+  SK+FSGAS  +GAEPNTQ    D  +PG+LP+LN   V+ AV+ 
Sbjct: 5   WETVIGLEIHAQLATKSKIFSGASTAYGAEPNTQACAVDLGLPGVLPVLNEEAVRMAVIF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           G+ + AHI  YSVFARKNYFYPDLP+GYQISQ D PIVG G + + +         +  +
Sbjct: 65  GMAIEAHIAPYSVFARKNYFYPDLPKGYQISQMDLPIVGVGHLDIDVDGV------SKRI 118

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H  +  ++ IDLNR+G  L+EIV++P+M S+ EA A++ K+  ++
Sbjct: 119 GITRAHLEEDAGKSLHGSFHGLTGIDLNRAGTPLLEIVSEPEMSSAKEAVAYMRKMHELV 178

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYLG CDGNM+EGS R D NVSV     + +GTR E+KN+NS +F+  AI +E  RQI +
Sbjct: 179 RYLGICDGNMQEGSFRCDANVSVRPKGQKEFGTRAEIKNINSFKFVEKAINHEIERQIEV 238

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           +E GG + QETRL+D  K+ETRS+R+KE+A DYRYF +PDLLP+ IDEDF   IK Q+PE
Sbjct: 239 IESGGTVVQETRLYDSDKDETRSMRSKEEANDYRYFPDPDLLPVLIDEDFKAQIKAQLPE 298

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK--LAVNRDKKIVANWVINDLLGVLN 378
           LP AK++RF  ++ +   +A++L S +S+ADYFE        + K+ ANWV  DLL  LN
Sbjct: 299 LPQAKKQRFKDDYVLDEENATILTSSRSLADYFETVVKESGCEAKMCANWVTGDLLAALN 358

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           R+   I D+P+S  +L  L+  I D TISGKIAK +F  LW+   T  EI+E  GL+Q+T
Sbjct: 359 RADLEITDSPVSHERLAGLLKRISDDTISGKIAKQVFEELWQSTATADEIIEAKGLKQIT 418

Query: 439 DLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           D  AIE ++D++I  N + V +    K  +  +FVGQVMK   GKANP  V KMLK KL
Sbjct: 419 DTGAIEAIIDKIIADNQDQVEQYRSGKDKVFGFFVGQVMKEMQGKANPGEVNKMLKAKL 477


>gi|161526273|ref|YP_001581285.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           multivorans ATCC 17616]
 gi|189349013|ref|YP_001944641.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           multivorans ATCC 17616]
 gi|221214690|ref|ZP_03587660.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia multivorans CGD1]
 gi|226709600|sp|A9AC50|GATB_BURM1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|160343702|gb|ABX16788.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           multivorans ATCC 17616]
 gi|189333035|dbj|BAG42105.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B
           [Burkholderia multivorans ATCC 17616]
 gi|221165580|gb|EED98056.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia multivorans CGD1]
          Length = 491

 Score =  557 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 244/487 (50%), Positives = 333/487 (68%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +  ++         
Sbjct: 65  GLAIGATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGAITIQVPANEKAGKPAYEK 124

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 125 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHA 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQI 244

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D++  ++  +
Sbjct: 245 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGRDWVERVQAGM 304

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+  
Sbjct: 305 PELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAAYFEAVVAKAGAANAKIAANWLMGDVSS 364

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVEE 431
            LNR G  I+  P+S  QL  L+  I DGTIS KIAK++F  +WE+     G    I+E 
Sbjct: 365 QLNRDGIEIDAIPVSAAQLALLLQRIADGTISNKIAKEVFATMWEEKASDDGAADRIIEA 424

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP  V +
Sbjct: 425 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVNE 484

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 485 LLKKKLG 491


>gi|66047393|ref|YP_237234.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. syringae B728a]
 gi|289676048|ref|ZP_06496938.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. syringae FF5]
 gi|75500716|sp|Q4ZNS6|GATB_PSEU2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|63258100|gb|AAY39196.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Pseudomonas syringae
           pv. syringae B728a]
 gi|330895291|gb|EGH27629.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. japonica str. M301072PT]
 gi|330937961|gb|EGH41748.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. pisi str. 1704B]
 gi|330969666|gb|EGH69732.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. aceris str. M302273PT]
          Length = 481

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 243/484 (50%), Positives = 337/484 (69%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV
Sbjct: 1   MQWEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL +NA I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + + +           
Sbjct: 61  KFGLAVNAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDIPLED-----GTVK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMR++ EA A++  + +
Sbjct: 116 RIGITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRNAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RYLG CDGNM EGS+R D NVS+       +GTRCE+KNVNS RF+  AI  E +RQI
Sbjct: 176 IVRYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ F+   +  +
Sbjct: 236 DLIEDGGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFLEETRATL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELP  KRERF  +FG+S YDASVL S +  ADYFE++   + D K+ ANWV+ +L  +L
Sbjct: 296 PELPPQKRERFQSQFGLSTYDASVLASSREQADYFEQVVSISGDAKLAANWVMVELGSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  I+ +P+S  QLG ++  I D TISGKIAK +F  +    G+  E++E+ GL+QV
Sbjct: 356 NKQGLEIDQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAMANGEGSADEVIEKRGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIE ++DEV+ +N   V +        +  +  +FVGQ MK + GKANP  V ++L
Sbjct: 416 TDSGAIESMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELL 475

Query: 493 KEKL 496
           K KL
Sbjct: 476 KAKL 479


>gi|238650362|ref|YP_002916214.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           peacockii str. Rustic]
 gi|259647239|sp|C4K0R5|GATB_RICPU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|238624460|gb|ACR47166.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           peacockii str. Rustic]
          Length = 483

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 268/483 (55%), Positives = 346/483 (71%), Gaps = 6/483 (1%)

Query: 15  TSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRC 74
             G TG WE VIG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  C
Sbjct: 4   IEGDTGKWEYVIGLEIHAQISSKSKLFSGSSTIFAANPNSQVSYVDAAMPGMLPVLNKHC 63

Query: 75  VQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSG 134
           V QA+ TGLGL A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +        
Sbjct: 64  VHQAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEIPT-----S 118

Query: 135 QFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFL 194
                 + I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+
Sbjct: 119 TGDLKTIRINRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPEEAAEFV 178

Query: 195 TKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEA 254
            KLR++LRY+G+CDG+ME+GSMR D N+SV R GE  GTRCE+KN+NSIR +  AIE+EA
Sbjct: 179 KKLRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIIKAIEFEA 238

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           +RQ+ +LE G  I QETRLF+    ETR++R KE+ALDYRYF +PDLLPL I ++ I  +
Sbjct: 239 KRQVDLLESGEEIIQETRLFNADSGETRTMRLKEEALDYRYFPDPDLLPLVISDELINEL 298

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLL 374
           K  +PELPD K E++  EF +S YDA V+V+D+S+A+YFE+ A   + K++ NW+ ++L 
Sbjct: 299 KANLPELPDQKIEKYTKEFSLSKYDAEVIVADESVAEYFEQAANECNPKMLTNWLTSELF 358

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
           G LN++   I +  I+P+   +L+ LI + TISGKIAK +F I++E G  P +IVEE GL
Sbjct: 359 GQLNKASIGINECKITPSNFAKLVKLIENDTISGKIAKTVFEIMFETGKAPDKIVEEKGL 418

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            QV+D + +  V+DEVI  NP +V      K  L  +FVGQVMK TGGKANP++V ++LK
Sbjct: 419 VQVSDNNVLNTVIDEVIAENPESVEGYRSGKDKLFGFFVGQVMKKTGGKANPTLVNQLLK 478

Query: 494 EKL 496
           EKL
Sbjct: 479 EKL 481


>gi|149916239|ref|ZP_01904760.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter sp.
           AzwK-3b]
 gi|149809899|gb|EDM69750.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter sp.
           AzwK-3b]
          Length = 507

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 281/512 (54%), Positives = 360/512 (70%), Gaps = 18/512 (3%)

Query: 1   MVSLD-THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFF 59
           MV LD T+      + +G   DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ VSF 
Sbjct: 1   MVMLDLTYDPPKPKVIAGAKHDWELVIGMEVHAQVASKAKLFSGASTEFGAEPNSNVSFV 60

Query: 60  DAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIV 119
           DAAMPGMLP++N  C++QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   P+V
Sbjct: 61  DAAMPGMLPVINEFCIEQAVRTGLGLKAKINLWSAFDRKNYFYPDLPQGYQISQLYHPLV 120

Query: 120 GEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIV 179
           GEG++ V + P          V IERIH+EQDAGKSIHD   A+S +DLNR+GVALMEIV
Sbjct: 121 GEGEILVDMEP-----GIARLVRIERIHVEQDAGKSIHDMDPAMSFVDLNRTGVALMEIV 175

Query: 180 TKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------G 228
           ++PD+R   EA A++TKLR ILRYLGTCDGNM+ G++RADVNVS+CRP            
Sbjct: 176 SRPDIRGPEEAAAYVTKLRQILRYLGTCDGNMQNGNLRADVNVSICRPGAYEKYMETQDF 235

Query: 229 EAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKE 288
              GTRCE+KN+NS+RF+  AIEYEARRQI I+E GG + QETRL+DP K ETRS+R+KE
Sbjct: 236 SHLGTRCEIKNMNSMRFIQQAIEYEARRQIQIVESGGSVVQETRLYDPDKGETRSMRSKE 295

Query: 289 DALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKS 348
           +A DYRYF +PDLLPLEI++ ++  I   +PELPD K+ RFI ++G++ YDA+VL +D  
Sbjct: 296 EAHDYRYFPDPDLLPLEIEQAWVDGIAASLPELPDEKKARFIADYGVTEYDANVLTADVD 355

Query: 349 IADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISG 408
           +A YFE      D K  ANWVIN++LG  N++  S     ++P     ++ ++    IS 
Sbjct: 356 LAQYFEDSVAGGDGKRTANWVINEVLGRANKAEISPRQI-VAPEVNAAILAMVARDEIST 414

Query: 409 KIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLV 468
           KIAKD+  +  E G  P+EIVE  G++QVTD  AIE  VD++I  NP  V +    P L 
Sbjct: 415 KIAKDVLELHIETGRAPEEIVETEGMKQVTDTGAIEAAVDQIIADNPAQVEKAKANPKLA 474

Query: 469 SWFVGQVMKNTGGKANPSIVQKMLKEKLGIKE 500
            WFVGQVMK TGGKANP  V  ++++KLG+ +
Sbjct: 475 GWFVGQVMKATGGKANPKAVNDIIQQKLGLDQ 506


>gi|257059064|ref|YP_003136952.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Cyanothece sp.
           PCC 8802]
 gi|256589230|gb|ACV00117.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Cyanothece sp. PCC
           8802]
          Length = 495

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 223/487 (45%), Positives = 312/487 (64%), Gaps = 8/487 (1%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
               +E +IG+E H QL+  SK+F   S NF + PNT +       PG+LP+LN   +  
Sbjct: 7   AKTKYEAIIGLETHCQLNTNSKIFCACSTNFDSPPNTNICPICLGYPGVLPVLNEEVLAS 66

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           AV  GL +N  I  YS F RK YFY DLP+ YQISQ+D PIV  G + + +   K+ +  
Sbjct: 67  AVKLGLAINGKIASYSKFDRKQYFYADLPKNYQISQYDLPIVEHGSLEIELVDKKTKEVT 126

Query: 138 TIEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKA 192
              +GI R+H+E+DAGK +H        S  S +D NR+GV L+EIV++PD+RS  EA  
Sbjct: 127 RKTIGITRLHMEEDAGKLVHAGSDRLAGSTHSLVDFNRTGVPLLEIVSEPDLRSGQEAAE 186

Query: 193 FLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIE 251
           +  +LR ++RYLG  DGNM+EGS+R DVN+S+     + +GT+ E+KN+NS   +  AIE
Sbjct: 187 YAQELRRLVRYLGISDGNMQEGSLRCDVNISIRPVGQKEFGTKVEIKNMNSFSAIQKAIE 246

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
           YE  RQI  LE+   I QETRL++     T S+R KE + DYRYF EPDL PLE+  + +
Sbjct: 247 YEIERQIEALENNEPIYQETRLWEEKTQCTVSMRKKEGSSDYRYFPEPDLPPLEVSPEQL 306

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANWVI 370
              K Q+PELP  KR R+  EFG+S YDA VL  D+ +A+Y+E  +A   D K+VANWV 
Sbjct: 307 EHWKHQLPELPAQKRSRYEAEFGLSAYDARVLTDDRDVANYYEAAVAAGADAKLVANWVT 366

Query: 371 NDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVE 430
            D+   LN +  +I +  ++P  LGEL+ LI  GTISGKIAK+I   L EKGG+PKE+V 
Sbjct: 367 QDIAAYLNNNKLAIAEIVLTPQSLGELVQLIETGTISGKIAKEILPELLEKGGSPKELVA 426

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQ 489
           + G+ Q++DL  +EK++DE+I +NP  + +    K NL  +FVGQVMK TGG+A+P +  
Sbjct: 427 KKGMTQISDLGELEKIIDEIIAANPKELEKFRSGKTNLKGFFVGQVMKQTGGRADPKLTN 486

Query: 490 KMLKEKL 496
           +++ +KL
Sbjct: 487 QLVDQKL 493


>gi|229586391|ref|YP_002844892.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           africae ESF-5]
 gi|259647238|sp|C3PMI9|GATB_RICAE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|228021441|gb|ACP53149.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Rickettsia africae
           ESF-5]
          Length = 483

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 269/483 (55%), Positives = 346/483 (71%), Gaps = 6/483 (1%)

Query: 15  TSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRC 74
             G TG WE VIG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  C
Sbjct: 4   IEGNTGKWEYVIGLEIHAQISSKSKLFSGSSTIFAANPNSQVSYVDAAMPGMLPVLNKHC 63

Query: 75  VQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSG 134
           V QA+ TGLGL A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +        
Sbjct: 64  VHQAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEIPT-----S 118

Query: 135 QFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFL 194
                 + I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+
Sbjct: 119 TGDLKTIRINRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPEEAAEFV 178

Query: 195 TKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEA 254
            KLR++LRY+G+CDG+ME+GSMR D N+SV R GE  GTRCE+KN+NSIR +  AIE+EA
Sbjct: 179 KKLRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIIKAIEFEA 238

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           +RQ+ +LE G  I QETRLF+    ETR++R KE+ALDYRYF +PDLLPL I ++ I  +
Sbjct: 239 KRQVDLLESGEEIIQETRLFNADSGETRTMRLKEEALDYRYFPDPDLLPLVISDELINEL 298

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLL 374
           K  +PELPD K E++  EF +S YDA V+V+D+S+A+YFEK A   + K++ NW+ ++L 
Sbjct: 299 KANLPELPDQKIEKYTKEFSLSKYDAEVIVADESVAEYFEKAANECNPKMLTNWLTSELF 358

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
           G LN++   I +  I+P+   +L+ LI + TISGKIAK +F I++E G  P +IVEE GL
Sbjct: 359 GQLNKASIGINECKITPSNFAKLVKLIENDTISGKIAKTVFEIMFETGKAPDKIVEEKGL 418

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            QV+D + +  V+DEVI  NP +V      K  L  +FVGQVMK TGGKANP++V ++LK
Sbjct: 419 VQVSDNNVLNTVIDEVIAENPESVEGYRSGKDKLFGFFVGQVMKKTGGKANPTLVNQLLK 478

Query: 494 EKL 496
           EKL
Sbjct: 479 EKL 481


>gi|218885682|ref|YP_002435003.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Desulfovibrio
           vulgaris str. 'Miyazaki F']
 gi|226709605|sp|B8DKV6|GATB_DESVM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|218756636|gb|ACL07535.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfovibrio
           vulgaris str. 'Miyazaki F']
          Length = 476

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 236/479 (49%), Positives = 312/479 (65%), Gaps = 9/479 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+EVHAQL   SKLF   S  FG+ PNT V    + MPG+LP+ N R V+ A   
Sbjct: 4   YEAVIGLEVHAQLRTRSKLFCSCSTAFGSAPNTNVCEVCSGMPGVLPVPNARAVEYAARM 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           G+ +N  +N  SVFARKNYFYPDLP+GYQISQ + PI   G +++S+         T  +
Sbjct: 64  GMAVNCTVNPVSVFARKNYFYPDLPKGYQISQFETPICEHGHLNISVNGQ------TRRI 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI RIH+E DAGK+IH      S +DLNRSGV L+EIV++PDMRS+ EA A+L  L +I+
Sbjct: 118 GITRIHMEDDAGKNIHSAGDNASYVDLNRSGVPLIEIVSEPDMRSAEEAVAYLKALHAIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            YLG CDGNMEEGS R D NVS+     + +GTR E+KN+NS R +  AIEYE  RQ  +
Sbjct: 178 VYLGICDGNMEEGSFRCDANVSIRPKGQQEFGTRAELKNLNSFRNVQRAIEYEIARQQDV 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LEDG  + QETRL+D  KN T S+R KE+A DYRYF +PDL+P+ I ED +   +  +PE
Sbjct: 238 LEDGDAVVQETRLYDAVKNVTVSMRGKEEAHDYRYFPDPDLMPVRIAEDDLVRWRADLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANWVINDLLGVLNR 379
           LP A+  RF+  + +S  DA VL +D+++AD+FE   A     K VAN +   LL  LN+
Sbjct: 298 LPQARVARFMSAYDLSEQDADVLTADRALADFFEAATAACGQPKKVANLMQGALLRELNQ 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
              +++   + P  LGEL+ +I  G IS KIA DIF  L E G  P+  V+E GL Q++D
Sbjct: 358 RAVTVDAIAMRPEALGELVRIIEAGLISAKIANDIFGELVETGAMPEAFVKERGLVQISD 417

Query: 440 LSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
            SAIE  VDE I  NP  V      K  L+S+F+GQ+M+ T GKANP++V ++L++KLG
Sbjct: 418 TSAIETAVDEAIAENPAEVEAYKGGKTKLISFFMGQIMRKTKGKANPALVTELLQKKLG 476


>gi|15892116|ref|NP_359830.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           conorii str. Malish 7]
 gi|20454921|sp|Q92J76|GATB_RICCN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|15619243|gb|AAL02731.1| glutamyl-tRNA amidotransferase subunit B [Rickettsia conorii str.
           Malish 7]
          Length = 483

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 269/483 (55%), Positives = 346/483 (71%), Gaps = 6/483 (1%)

Query: 15  TSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRC 74
             G TG WE VIG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  C
Sbjct: 4   IEGNTGKWEYVIGLEIHAQISSKSKLFSGSSTIFAANPNSQVSYVDAAMPGMLPVLNKHC 63

Query: 75  VQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSG 134
           V QA+ TGLGL A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +        
Sbjct: 64  VHQAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEIPT-----S 118

Query: 135 QFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFL 194
                 + I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+
Sbjct: 119 TGDLKTIRINRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPEEAAEFV 178

Query: 195 TKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEA 254
            KLR++LRY+G+CDG+ME+GSMR D N+SV R GE  GTRCE+KN+NSIR +  AIE+EA
Sbjct: 179 KKLRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIIKAIEFEA 238

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           +RQ+ +LE G  I QETRLF+    ETR++R KE+ALDYRYF +PDLLPL I ++ I  +
Sbjct: 239 KRQVDLLESGEKIIQETRLFNADSGETRTMRLKEEALDYRYFPDPDLLPLVISDELINEL 298

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLL 374
           K  +PELPD K E++  EF +S YDA V+V+D+S+A+YFEK A   + K++ NW+ ++L 
Sbjct: 299 KANLPELPDQKIEKYTKEFSLSKYDAEVIVADESVAEYFEKAANECNPKMLTNWLTSELF 358

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
           G LN++   I +  I+P+   +L+ LI + TISGKIAK +F I++E G  P +IVEE GL
Sbjct: 359 GQLNKASIGINECKITPSNFAKLVKLIENDTISGKIAKTVFEIMFETGKAPDKIVEEKGL 418

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            QV+D + +  V+DEVI  NP +V      K  L  +FVGQVMK TGGKANP++V ++LK
Sbjct: 419 VQVSDNNVLNTVIDEVIAENPESVEGYRSGKDKLFGFFVGQVMKKTGGKANPTLVNQLLK 478

Query: 494 EKL 496
           EKL
Sbjct: 479 EKL 481


>gi|262375780|ref|ZP_06069012.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter lwoffii SH145]
 gi|262309383|gb|EEY90514.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter lwoffii SH145]
          Length = 493

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 251/502 (50%), Positives = 338/502 (67%), Gaps = 14/502 (2%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M           +L  G    WEVVIGIE+H QL+  +K+FSG+S  FG +PNTQ S  D
Sbjct: 1   MAQAQKSAKPKSNLIDG----WEVVIGIEIHTQLATNTKIFSGSSTVFGNDPNTQASLVD 56

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
            AMPG+LP+LN   V  A+  GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG
Sbjct: 57  LAMPGVLPVLNKEVVDLAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVG 116

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
            G + + +            +G+ R HLE+DAGKSIHDQ+  +S IDLNR+G  L+EIV+
Sbjct: 117 LGHIDIQLED-----GTVKRIGVTRAHLEEDAGKSIHDQFEGMSGIDLNRAGTPLLEIVS 171

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           +PDMRS  EA A++  + +++R+LG  DGNM EGS R D NVS+ RPG+ +GTRCE+KN+
Sbjct: 172 EPDMRSVEEAVAYIKAIHTLVRWLGISDGNMAEGSFRCDCNVSLRRPGQPFGTRCELKNL 231

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NS RF+  AI  E  RQ+ ILE  G I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 232 NSFRFIEQAINVEIERQMEILEWDGTIDQETRLFDPVKMETRSMRSKEEANDYRYFPDPD 291

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLP+ I ++ I AIK  +PELP A+RERF+ +FG++ YDA VL   + +AD++E +    
Sbjct: 292 LLPVVIADEQIEAIKATMPELPAARRERFVADFGVTEYDAHVLTLTREMADFYEAVVTAA 351

Query: 361 DK----KIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFN 416
                 KI ANWV+ +  G LN++G  + D+P+S  +LG +I  I+D TISGKIAK +F 
Sbjct: 352 GGAANGKIAANWVMGEFSGALNKAGLDLADSPVSTEKLGGMIARIVDNTISGKIAKQVFG 411

Query: 417 ILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQV 475
            +WE+G T  EI+ E GL+Q TD  AIE ++ EV+ +N   V      K    +  VGQV
Sbjct: 412 FMWEEGKTADEIIAEKGLKQETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQV 471

Query: 476 MKNTGGKANPSIVQKMLKEKLG 497
           MK + GKANP+ V +++K+ +G
Sbjct: 472 MKASRGKANPAQVNELMKKLIG 493


>gi|254459535|ref|ZP_05072951.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodobacterales bacterium HTCC2083]
 gi|206676124|gb|EDZ40611.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 503

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 300/507 (59%), Positives = 364/507 (71%), Gaps = 17/507 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T         +G   DWE+VIG+EVHAQ++  SKLFS AS  FGAEPN+ V+F D
Sbjct: 1   MLDL-TFETPKIKTIAGAKHDWELVIGMEVHAQVASNSKLFSAASTKFGAEPNSNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPVINEFCVEQAVRTGLGLKAEINLFSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG++ V + P          V IERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV+
Sbjct: 120 EGEIIVDLEP-----GIARRVRIERIHLEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA AF+ KLR ILRYLGTCDGNM+ GSMRADVNVSVC PG+           
Sbjct: 175 RPDIRGPEEAAAFVVKLRQILRYLGTCDGNMQSGSMRADVNVSVCLPGQYEKFIETGDFG 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AI+ EA+RQIAI+E GG + QETRL+DP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIDVEAKRQIAIIEAGGKVEQETRLYDPDKGETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I K +PELPD K+ RF+  FG+S YDASVL +D   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAKTLPELPDEKKARFVTSFGLSEYDASVLTADVES 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE +A NRD K+ ANWVIN+L G L    K I   PI+P QLG +IDLI   TISGK
Sbjct: 355 AGYFESVAENRDGKLAANWVINELFGRLKSDEKDIITCPITPAQLGGIIDLIKADTISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F I++ +GG P +IVE  G++QVTD  AIE  VD++I  NP  VA+    P L  
Sbjct: 415 IAKDLFEIVYTEGGNPADIVEARGMKQVTDTGAIEAAVDQIIADNPAQVAKAKENPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKL 496
           WFVGQVMK TGGKANP  V +++  KL
Sbjct: 475 WFVGQVMKATGGKANPKAVNQIIAAKL 501


>gi|221201878|ref|ZP_03574915.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia multivorans CGD2M]
 gi|221207616|ref|ZP_03580624.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia multivorans CGD2]
 gi|221172462|gb|EEE04901.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia multivorans CGD2]
 gi|221178298|gb|EEE10708.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia multivorans CGD2M]
          Length = 490

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 243/487 (49%), Positives = 333/487 (68%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +  ++         
Sbjct: 64  GLAIGATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGAITIQVPANEKAGKPAYEK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHA 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 184 LVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQI 243

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D++  ++  +
Sbjct: 244 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGRDWVERVQAGM 303

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+  
Sbjct: 304 PELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAAYFEAVVAKAGAANAKIAANWLMGDVSS 363

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVEE 431
            LNR G  I+  P+S  QL  L+  I DGTIS KIAK++F  +WE+     G    I++ 
Sbjct: 364 QLNRDGIDIDAIPVSAAQLALLLQRIADGTISNKIAKEVFATMWEEKASDDGAADRIIDA 423

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP  V +
Sbjct: 424 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVNE 483

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 484 LLKKKLG 490


>gi|290967941|ref|ZP_06559491.1| GatB/GatE catalytic domain protein [Megasphaera genomosp. type_1
           str. 28L]
 gi|290782080|gb|EFD94658.1| GatB/GatE catalytic domain protein [Megasphaera genomosp. type_1
           str. 28L]
          Length = 480

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 220/484 (45%), Positives = 309/484 (63%), Gaps = 13/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             +E VIG+EVHA+L   +K+F G S +FGA PNT V      +PG+LP+LN   +  AV
Sbjct: 1   MKYESVIGLEVHAELKTKTKIFCGCSTSFGAAPNTHVCPVCLGLPGVLPVLNKEVLHFAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL L+  I  +S F RKNY+YPDLP+ +Q SQ D PI   G V + +G       +  
Sbjct: 61  KAGLALHCDILPFSKFDRKNYYYPDLPKNFQTSQFDLPICLHGYVDIEVGG------KQR 114

Query: 140 EVGIERIHLEQDAGKSIHD----QYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
            + + RIH+E+DAGK +H       S  SC+D NR+GV L+EIV++PD+RS  EA+A+L 
Sbjct: 115 RIHLTRIHMEEDAGKLVHSGATIDTSDSSCVDYNRTGVPLIEIVSEPDLRSGEEARAYLE 174

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEA 254
           KLRSIL+YLG  D  MEEGSMR D N+S+     +  GT+ E+KN+NS   +   IEYEA
Sbjct: 175 KLRSILQYLGVSDCRMEEGSMRCDANISIRPVGSDTLGTKTEIKNINSFSGVQKGIEYEA 234

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
            RQ  ILEDGG I+Q TR ++ +K  T   R KE + DYRYF EPDL+P+E+   +I A+
Sbjct: 235 VRQAQILEDGGTIQQATRGWEEAKGITVLQRIKEGSSDYRYFPEPDLIPIEVSPAYIEAV 294

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDL 373
           +K++PELPD +R RF  E G+S YDA++L  +K+ ADYFE+  A   D K+ +NW++ D+
Sbjct: 295 RKELPELPDVRRRRFQTEMGLSAYDAALLTGEKATADYFEETVAAGADAKVASNWILGDI 354

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
              LN  G ++   P+SP  L  L+ LI  GTISGKIAK +   +W    T + +V+E G
Sbjct: 355 AKKLNEEGITMVAIPVSPADLAGLLQLIDKGTISGKIAKKVLPEMWNSHKTAEAVVKEQG 414

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           L Q+TD   +E +V +++ +NP +VA   A K   + + VGQ+MK T G+ANP +V ++L
Sbjct: 415 LVQITDTGELETIVRQIVAANPQSVADYQAGKKKAIGFLVGQIMKETKGRANPGVVNQLL 474

Query: 493 KEKL 496
            + L
Sbjct: 475 TKIL 478


>gi|302038218|ref|YP_003798540.1| aspartyl/glutamyl-tRNA(asn/Gln) amidotransferase subunit B
           [Candidatus Nitrospira defluvii]
 gi|300606282|emb|CBK42615.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, subunit B
           [Candidatus Nitrospira defluvii]
          Length = 476

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 218/478 (45%), Positives = 312/478 (65%), Gaps = 9/478 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +EVVIG+EVHAQL   SKLF      FG   N+Q       +PG LP++N + V+ AV  
Sbjct: 3   YEVVIGVEVHAQLRTQSKLFCACGTTFGLTANSQTCPVCLGLPGTLPVINEKAVEMAVRA 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL +N  I   + FARKNYFYPDLP+GYQISQ++ PI   G + ++ G           V
Sbjct: 63  GLAMNGTIGVRNRFARKNYFYPDLPKGYQISQYEAPICEHGWIEIAAGGS------RKRV 116

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            I R HLE+DAGK++H+  S +S +DLNR+G  L+EIVT+PD+ SS E  A+L  LR +L
Sbjct: 117 RIRRAHLEEDAGKNLHEAGSGMSLVDLNRAGTPLLEIVTEPDLSSSEEVVAYLKSLRDLL 176

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            YL  CDGNMEEGS R + N+S+       +GT+ E+KN+NS +F+  A++YE +RQ  +
Sbjct: 177 MYLDVCDGNMEEGSFRCEPNLSLRPAGQTTFGTKVELKNINSFKFVKDAVDYEIKRQTKV 236

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           L +GG I QETRL++  + ET  +R+KE+A DYRYF +PDL+P+EI  ++I  +++ +PE
Sbjct: 237 LNEGGKIYQETRLWNHERGETAVMRSKEEAHDYRYFPDPDLVPMEISSEWIEQLREGLPE 296

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVLNR 379
           L   K++RFI E+G+  YDA +L S K++A YFE    +    K V+NWV+ +LL  LN 
Sbjct: 297 LASTKQQRFITEYGVPEYDAGILTSSKALAVYFEACVTLYPQPKTVSNWVMGELLRELNN 356

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           SG   + +P++P +L EL+ L+  G IS K+A+DIF  ++  G  P +IV+E GL QV+D
Sbjct: 357 SGTEADASPVTPERLVELLTLVDQGVISLKVARDIFPDVYASGKAPAQIVQEKGLTQVSD 416

Query: 440 LSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
             A+  ++DEV+  NP  V +    K  ++ + VGQVMK +GGKANP  V ++LK+ L
Sbjct: 417 EGALATMIDEVLKKNPAQVGQFKEGKQQVLGFLVGQVMKASGGKANPGKVNELLKKAL 474


>gi|330877213|gb|EGH11362.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
          Length = 481

 Score =  556 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 246/484 (50%), Positives = 337/484 (69%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV
Sbjct: 1   MQWEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + + +           
Sbjct: 61  KFGLAVDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDIPLED-----GTVK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            VGI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +
Sbjct: 116 RVGITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RYLG CDGNM EGS+R D NVS+       +GTRCE+KNVNS RF+  AI  E +RQI
Sbjct: 176 IVRYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ FI   +  +
Sbjct: 236 DLIEDGGRVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFIEETRATL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELP  KRERF  +FG+S YDASVL S +  ADYFEK+   + D K+ ANWV+ +L  +L
Sbjct: 296 PELPPQKRERFQSQFGLSTYDASVLASSREQADYFEKVVSISGDAKLAANWVMVELGSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  I+ +P+S  QLG ++  I D TISGKIAK +F  +    G+  E++E+ GL+QV
Sbjct: 356 NKQGVEIDQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAMANGEGSADEVIEKRGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIE ++DEV+ +N   V +        +  +  +FVGQ MK + GKANP  V ++L
Sbjct: 416 TDSGAIESMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELL 475

Query: 493 KEKL 496
           K KL
Sbjct: 476 KAKL 479


>gi|239502366|ref|ZP_04661676.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           baumannii AB900]
          Length = 489

 Score =  556 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 253/495 (51%), Positives = 344/495 (69%), Gaps = 15/495 (3%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           A+   L  G    WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP
Sbjct: 4   AQKLKLIDG----WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLP 59

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           +LN + V+ A+  GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +
Sbjct: 60  VLNEKVVELAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL 119

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
                    T  +G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  
Sbjct: 120 ED-----GTTKRIGVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVE 174

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           EA A++  + +++R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  
Sbjct: 175 EAVAYIKAIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQ 234

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AI  E  RQ+ ILE GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I +
Sbjct: 235 AINVEIERQMEILEWGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIPD 294

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN----RDKKI 364
           + I AIK  +PELP A+R RFI +FG++ YDA VL   + +AD++E +       +  KI
Sbjct: 295 EQIEAIKATMPELPAARRARFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGVKQGKI 354

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGG 423
            ANWV+ +  G LN++G  + D+P+S  QLG +I  I+D TISGKIAK +F  +WE +G 
Sbjct: 355 AANWVMGEFSGALNKAGLELTDSPVSAEQLGGMIARIVDNTISGKIAKQVFGFMWESEGK 414

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGK 482
           +  +I+ E GL+Q TD  AIE ++ EV+ +N   V      K    +  VGQVMK + GK
Sbjct: 415 SADDIIAEKGLKQETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGK 474

Query: 483 ANPSIVQKMLKEKLG 497
           ANP+ V +++K+ +G
Sbjct: 475 ANPAQVNELMKKLIG 489


>gi|258645491|ref|ZP_05732960.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Dialister invisus
           DSM 15470]
 gi|260402844|gb|EEW96391.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Dialister invisus
           DSM 15470]
          Length = 481

 Score =  556 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 216/484 (44%), Positives = 306/484 (63%), Gaps = 13/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             +EVVIG+EVH +L   +K+F G   +FGA+PNT V      +PG+LP+LN + ++  V
Sbjct: 1   MKYEVVIGLEVHTELRTKTKIFCGCKTSFGADPNTNVCPVCLGLPGVLPVLNRKVLEFGV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  I ++S F RKNY+YPDLP+ +Q SQ D PI G G + V +  +K       
Sbjct: 61  RAGLALNCEIARFSKFDRKNYYYPDLPKNFQTSQFDLPICGPGFLDVEVEGEK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQ----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
            + I R H+E+DAGK +H       S  S +D NR+G  L+EIV++PDMRS+ EA A++ 
Sbjct: 115 HIRITRAHMEEDAGKLVHHGNSITDSDYSLVDYNRTGTPLLEIVSEPDMRSAKEAVAYME 174

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEA 254
           KLR+IL+Y+   D  MEEGS+R D NVSV     +  GT+ E+KN+NS R +  AIEYEA
Sbjct: 175 KLRAILQYVEISDCRMEEGSLRCDANVSVRPIGQKELGTKTEIKNINSFRGVERAIEYEA 234

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
            RQ  +LE+GG I QETR +D  +  T+S+R+KE+A DYRYF EPDL+P  + +++I  I
Sbjct: 235 LRQAELLEEGGKIIQETRTWDEKEGITKSMRSKEEANDYRYFPEPDLVPFTVSKEYIEEI 294

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDL 373
           +K +PELPDA++ER++  FG+S  DA ++ +DK  +DYFE  +    D K   NW++ + 
Sbjct: 295 RKTLPELPDARKERYMRCFGLSSEDAVMMTNDKGRSDYFEAVVKAGADPKAAVNWLMGEF 354

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
              L+  G  I   P++   L EL+ LI  GTISGKIAK +F  +W+ GG  +EIV   G
Sbjct: 355 ASQLSTDGIEIAAAPVTAENLAELLKLISKGTISGKIAKKVFADMWKDGGGAEEIVRVKG 414

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           L Q++D   ++ +V  VI  +P  VA     K   V   VGQ+MK T G+ANP +V ++L
Sbjct: 415 LTQISDTGELKGLVAAVIAEHPQAVADFKAGKKKAVGALVGQIMKATKGQANPQVVNQLL 474

Query: 493 KEKL 496
            +KL
Sbjct: 475 AKKL 478


>gi|163732110|ref|ZP_02139556.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter
           litoralis Och 149]
 gi|161394408|gb|EDQ18731.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter
           litoralis Och 149]
          Length = 503

 Score =  556 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 295/507 (58%), Positives = 365/507 (71%), Gaps = 17/507 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+   +  + SG   DWE+VIG+EVHAQ++  +KLFS AS  FGAEPN  VSF D
Sbjct: 1   MLDL-TYETPAPKVISGAKHDWELVIGMEVHAQVNSAAKLFSAASTQFGAEPNNNVSFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP +N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPTINEFCVEQAVRTGLGLKAEINLHSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +       V +ERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV+
Sbjct: 120 EGEVLVEMGDGTA-----RLVRVERIHLEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSV-----------CRPGE 229
           +PD+R   EA A+L KLR ILRYLGTC+G+M+ G+MRADVNVS+            +   
Sbjct: 175 RPDIRGPEEAAAYLAKLRQILRYLGTCNGDMQSGAMRADVNVSICRAGQYEKYQATQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AI+ EARRQIAI+E GG I QETRL+DP KNETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIDVEARRQIAIVEAGGTIDQETRLYDPDKNETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPDAK+ RF  +FG+S YDASVL +D   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAANLPELPDAKKARFRDDFGLSDYDASVLTADLDS 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           + YFE +A  RD K+ ANWVIN+L G L +   +I D+P+SP QLG +IDLI    ISGK
Sbjct: 355 SGYFEAVAAGRDGKMAANWVINELFGRLKKEDHAITDSPVSPAQLGGIIDLIASDAISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F I +  G  P EIVE  G++QVTD  AIE  VDE+I +NP+ VA+    P L  
Sbjct: 415 IAKDVFEICYTTGRDPAEIVETEGMKQVTDTGAIEAAVDEIIAANPDQVAKARENPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKL 496
           WFVGQVMK TGGKANP  V +++ +KL
Sbjct: 475 WFVGQVMKATGGKANPKAVNQLVAKKL 501


>gi|300867577|ref|ZP_07112227.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Oscillatoria sp. PCC 6506]
 gi|300334465|emb|CBN57397.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Oscillatoria sp. PCC 6506]
          Length = 494

 Score =  556 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 213/487 (43%), Positives = 305/487 (62%), Gaps = 9/487 (1%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
              +E +IG+E H QL   +K+FS +S  FG  PN+ +      MPG+LP+LN + ++ A
Sbjct: 8   KTQYEAIIGLETHCQLGTKTKIFSSSSTEFGGVPNSNIDPICMGMPGVLPVLNQKVLEYA 67

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           V  GL L   I  YS F RK YFYPDLP+ YQISQ D PI   G + + +     G    
Sbjct: 68  VKAGLALKCQIAPYSKFDRKQYFYPDLPKNYQISQFDLPIATNGWLEIELID-DGGNSTR 126

Query: 139 IEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
            ++GI R+H+E+DAGK +H        S  S +D NR+G+ L+EIV++PD+RS  EA  +
Sbjct: 127 KKIGITRLHMEEDAGKLVHGGSDRLSGSTYSMVDYNRAGIPLIEIVSEPDLRSGAEAAEY 186

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEY 252
             +LR I+RYLG  DGNM+EGS+R DVN+SV     E +GT+ E+KN+NS   +  AI++
Sbjct: 187 AQELRRIVRYLGVSDGNMQEGSLRCDVNISVRPVGREEFGTKVEIKNMNSFNAIHRAIDF 246

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           E  RQI  LE+G  I QETRL++  K  T S+R KE + DYRYF EPD+ P+E+  + + 
Sbjct: 247 EIERQIQALENGDRIFQETRLWEEGKQCTVSMRLKEGSSDYRYFPEPDIPPIEVSPEQLG 306

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANWVIN 371
             + ++PELP +KR+R+  + G+S YDA VL  D+++A+YFE  +A   + K VANWV+ 
Sbjct: 307 HWEAELPELPASKRDRYENKIGLSAYDARVLTDDRAVAEYFEAAIAAGGNPKQVANWVMG 366

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D+   L     +I   P  P+ L ELI LI  GTISGKIAKD+   L  +GG+PK+ +E 
Sbjct: 367 DITAYLKNEKLNITQLPFKPDGLAELISLIDAGTISGKIAKDLLPKLLSEGGSPKQAIEA 426

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            G+ Q++D + +E  +D VI  NP  + +    K  L+ +FVGQVMK T G+A+P +  +
Sbjct: 427 AGVTQISDAATLEAAIDRVIAENPKELEQYRSGKTKLLGFFVGQVMKQTEGRADPKLTNQ 486

Query: 491 MLKEKLG 497
           +L +KL 
Sbjct: 487 LLNKKLN 493


>gi|159027280|emb|CAO89375.1| gatB [Microcystis aeruginosa PCC 7806]
          Length = 490

 Score =  556 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 219/484 (45%), Positives = 318/484 (65%), Gaps = 8/484 (1%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           ++E +IG+E H QL+  SK+F     NF + PNT V       PG+LP+LN   +  AV 
Sbjct: 5   EYEAIIGLETHCQLNTKSKIFCSCPTNFDSPPNTNVCPVCLGYPGVLPVLNQEVLASAVK 64

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL ++  I  +S F RK YFYPDLP+ YQISQ+D PIV +G++ + I   K+ +     
Sbjct: 65  LGLAIDGKITPHSKFDRKQYFYPDLPKNYQISQYDLPIVEQGQLEIEIVDKKTKEVSRKI 124

Query: 141 VGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
           +GI R+H+E+DAGK +H        S  S +D NR+GV L+EIV++PD+R+  EA  +  
Sbjct: 125 IGITRLHMEEDAGKLVHAGSERLSGSTHSLVDFNRTGVPLLEIVSEPDLRTGAEAAEYAQ 184

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEA 254
           +LR ++RYLG  DGNM+EGS+R DVN+SV +   + +GT+ E+KN+NS   +  AIEYE 
Sbjct: 185 ELRRLVRYLGISDGNMQEGSLRCDVNISVRKKGAKKFGTKVEIKNMNSFSAIQKAIEYEI 244

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
            RQI  +E+G  I QETRL++ +   T S+R KE + DYRYF EPDL PLE+  + ++A 
Sbjct: 245 DRQIEAIENGEPIVQETRLWEEATQRTISMRKKEGSSDYRYFPEPDLPPLEVSPEQLKAW 304

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDL 373
            +++PELP  KR R+  EFG+S YDA VL  D+++A+YFE  +    + K+VANW+  D+
Sbjct: 305 AEELPELPARKRRRYEEEFGLSPYDARVLTDDRTVAEYFETAVIAGANAKLVANWISQDI 364

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
              LN +   I +  +  + L EL+ LI  GTISGKIAK+I   L  +GG+PK +VE+ G
Sbjct: 365 AAYLNNNKLMITEIALQASDLAELVKLIETGTISGKIAKEILPELLTEGGSPKALVEKKG 424

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           L Q++D SAIEK+++E+I S+P+ + +    K NL  +FVGQVMK +GGKA+P +  ++L
Sbjct: 425 LIQISDSSAIEKLIEEIIASHPSELEKFRAGKTNLKGFFVGQVMKKSGGKADPKLTSQIL 484

Query: 493 KEKL 496
            +KL
Sbjct: 485 DQKL 488


>gi|167631043|ref|YP_001681542.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase, b subunit
           [Heliobacterium modesticaldum Ice1]
 gi|167593783|gb|ABZ85531.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase, b subunit
           [Heliobacterium modesticaldum Ice1]
          Length = 501

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 215/499 (43%), Positives = 311/499 (62%), Gaps = 29/499 (5%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           D+E+V+G+EVH +L   SK+F G +  FG E N+ V      +PG+LP+LN + V  A+ 
Sbjct: 6   DFEIVMGLEVHVELHTKSKIFCGCTTEFGGEQNSHVCPVCLGLPGVLPVLNRQVVDYAMK 65

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
            GL LN  I ++S F RKNYFYPDLP+ YQISQ+D PI   G + +  G       +   
Sbjct: 66  AGLALNCEIAEFSKFDRKNYFYPDLPKAYQISQYDLPIAKNGYIEIEAGG------KQKR 119

Query: 141 VGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
           +GI R+H+E+DAGK +H        +  S  D NR+GV L+EIV++PD+RS  EA A+L 
Sbjct: 120 IGITRVHMEEDAGKLVHAGAVNLSGADYSLADYNRTGVPLIEIVSEPDIRSIEEAIAYLE 179

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEA 254
           +L++IL Y    D  ME+GS+R D NVS+     + +GTR E+KN+NS + L  A+EYE 
Sbjct: 180 QLKAILEYTEVSDCKMEQGSLRCDANVSLRPWGQKEFGTRTELKNMNSFKALQRALEYEI 239

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
            RQ  IL +GG + QETR++D +K  T SLR+KE+A DYRYF +PDL+PL I  +++  +
Sbjct: 240 ERQAEILREGGAVVQETRMWDEAKGMTISLRSKEEAHDYRYFPDPDLVPLVISREWVDKV 299

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA----------------V 358
           ++ +PELP A+R R I  +G+  YDA ++VS K++ADYF+                    
Sbjct: 300 RRTLPELPQARRARLIQSYGLPRYDADIIVSSKAMADYFDAACAAYGIAVPAGTEADGKA 359

Query: 359 NRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNIL 418
               K ++N+++ +L   LN S K  +D+PISP+ L  L+ L+ +GTIS KIAK +F  +
Sbjct: 360 KERAKQISNYMMGELTRFLNASEKGFQDSPISPDNLVGLLRLLEEGTISTKIAKTVFEEM 419

Query: 419 WEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMK 477
           +  G   K +VEE GL Q++D  AI  V+ E++ +NP+ VA     K   + + VGQ MK
Sbjct: 420 FATGKAAKTVVEEKGLVQISDEGAIASVISEIVAANPSVVADYKAGKEKAMGFLVGQAMK 479

Query: 478 NTGGKANPSIVQKMLKEKL 496
            T GKANP +V K+LKE+L
Sbjct: 480 ATKGKANPGLVNKLLKEEL 498


>gi|260548908|ref|ZP_05823130.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter sp. RUH2624]
 gi|260408076|gb|EEX01547.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter sp. RUH2624]
          Length = 489

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 253/495 (51%), Positives = 343/495 (69%), Gaps = 15/495 (3%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           A+   L  G    WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP
Sbjct: 4   AQKLKLIDG----WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLP 59

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           +LN + V  A+  GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +
Sbjct: 60  VLNEKVVDLAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL 119

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
                    T  +G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  
Sbjct: 120 ED-----GTTKRIGVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVE 174

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           EA A++  + +++R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  
Sbjct: 175 EAVAYIKAIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQ 234

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AI  E  RQ+ ILE GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I +
Sbjct: 235 AINVEIERQMEILEWGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIPD 294

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV----NRDKKI 364
           + I AIK  +PELP A+R RFI +FG++ YDA VL   + +AD++E +       +  KI
Sbjct: 295 EQIEAIKATMPELPAARRARFIADFGVTEYDAHVLTLSREMADFYEDVVAAAGGAKQGKI 354

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGG 423
            ANWV+ +  G LN++G  + D+P+S  QLG +I  I+D TISGKIAK +F  +WE +G 
Sbjct: 355 AANWVMGEFSGALNKAGLELTDSPVSAEQLGGMIARIVDNTISGKIAKQVFGFMWESEGK 414

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGK 482
           +  +I+ E GL+Q TD  AIE ++ EV+ +N   V      K    +  VGQVMK + GK
Sbjct: 415 SADDIIAEKGLKQETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGK 474

Query: 483 ANPSIVQKMLKEKLG 497
           ANP+ V +++K+ +G
Sbjct: 475 ANPAQVNELMKKLIG 489


>gi|331016665|gb|EGH96721.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 481

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 245/484 (50%), Positives = 337/484 (69%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV
Sbjct: 1   MQWEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + + +           
Sbjct: 61  KFGLAVDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDIPLED-----GTVK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            VGI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +
Sbjct: 116 RVGITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RYLG CDGNM EGS+R D NVS+       +GTRCE+KNVNS RF+  AI  E +RQI
Sbjct: 176 IVRYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++E+GG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ FI   +  +
Sbjct: 236 DLIEEGGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFIEETRATL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELP  KRERF  +FG+S YDASVL S +  ADYFEK+   + D K+ ANWV+ +L  +L
Sbjct: 296 PELPPQKRERFQSQFGLSTYDASVLASSREQADYFEKVVSISGDAKLAANWVMVELGSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  I+ +P+S  QLG ++  I D TISGKIAK +F  +    G+  E++E+ GL+QV
Sbjct: 356 NKQGVEIDQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAMANGEGSADEVIEKRGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIE ++DEV+ +N   V +        +  +  +FVGQ MK + GKANP  V ++L
Sbjct: 416 TDSGAIESMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELL 475

Query: 493 KEKL 496
           K KL
Sbjct: 476 KAKL 479


>gi|153874608|ref|ZP_02002763.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Beggiatoa sp. PS]
 gi|152068928|gb|EDN67237.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Beggiatoa sp. PS]
          Length = 476

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 241/479 (50%), Positives = 331/479 (69%), Gaps = 10/479 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+E+HAQL+  SK+FSG+S+ +G+EPNTQ    D  +PG+LP+LN + V  A   
Sbjct: 2   YETVIGLEIHAQLATNSKIFSGSSIAYGSEPNTQACAVDLGLPGVLPVLNEKVVTMAAKF 61

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL + A +   S+FARKNYFYPDLP+GYQISQ++ PIV +G++ + +   +        +
Sbjct: 62  GLAIGAEVAPRSIFARKNYFYPDLPKGYQISQYELPIVKQGQLQIEVEGQE------KTI 115

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI R HLE+DAGKS+H+ +   S IDLNR+G  L+EIV++PDMRS+ EA A++ K+ S++
Sbjct: 116 GITRAHLEEDAGKSLHEDFQGSSGIDLNRAGTPLLEIVSEPDMRSAPEAVAYMKKVHSLV 175

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           RYL  CDGNM+EGS R D NVS+     E  GTR E+KN+NS RF+  AI +E  RQI +
Sbjct: 176 RYLEICDGNMQEGSFRCDANVSIRPKGQEELGTRTELKNLNSFRFIEKAINFEIERQIDV 235

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           LE GG + QETRL+D  KNETRS+R+KE+A DYRYF +PDLLP+ I+  F+  IK  +PE
Sbjct: 236 LESGGKVVQETRLYDADKNETRSMRSKEEANDYRYFPDPDLLPVVIEPAFLAQIKAGLPE 295

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV--NRDKKIVANWVINDLLGVLN 378
           LPD K++RFI ++G+SLYDAS L S++ +A+YFE+       D K+ ANWV+ +L   LN
Sbjct: 296 LPDEKKQRFIEQYGLSLYDASFLTSNREMANYFEETVKASGSDAKLCANWVMGELAAFLN 355

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++   I D+ +S  QL  L+  I D TISGKIAK +F  +W   G    I+E+  L+Q T
Sbjct: 356 KNNLEIADSKVSTTQLAGLLRRIADNTISGKIAKQVFEAMWNGEGEADVIIEKRDLKQET 415

Query: 439 DLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           D  AIEK+VD++I  NP+ +A     K  L  +FVGQVMK + GKANP  V ++LK+KL
Sbjct: 416 DSGAIEKIVDDIIAKNPSQLADYRNGKDKLFGFFVGQVMKVSKGKANPKQVNELLKKKL 474


>gi|58040805|ref|YP_192769.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Gluconobacter
           oxydans 621H]
 gi|81556902|sp|Q5FND4|GATB_GLUOX RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|58003219|gb|AAW62113.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Gluconobacter
           oxydans 621H]
          Length = 485

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 274/487 (56%), Positives = 349/487 (71%), Gaps = 7/487 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
               +G+TG+WE+V+G+EVHAQ+   +KLFSGAS  +G EPNT VS  DA  PGMLP+LN
Sbjct: 2   SYRITGSTGEWEIVVGLEVHAQVVSEAKLFSGASAEYGGEPNTHVSLVDAGFPGMLPVLN 61

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QAV TGLGL A IN +S F RKNYFY DLP GYQISQ   PI+G+GKV V +   
Sbjct: 62  RECVAQAVRTGLGLEAEINLFSRFDRKNYFYADLPTGYQISQFAHPIIGKGKVLVDLAD- 120

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
                 T E+G+ R+HLEQDAGKSIHDQ    S IDLNR+GVALMEIV++PD+RS  EA 
Sbjct: 121 ----GSTREIGVTRLHLEQDAGKSIHDQDPTRSFIDLNRAGVALMEIVSEPDIRSPEEAG 176

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAI 250
           A+L KLR ILRY+GTCDGNMEEGSMRADVNVSV +P    + TRCE+KNVNSIRF+ +AI
Sbjct: 177 AYLRKLRQILRYIGTCDGNMEEGSMRADVNVSVRKPGETEYRTRCEIKNVNSIRFVMMAI 236

Query: 251 EYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDF 310
           E EA+RQI + E GG + QETRLFD  + ETRSLR+KEDA DYRYF +PDLLPL I++ +
Sbjct: 237 EVEAQRQIEVWEAGGTVDQETRLFDHVRGETRSLRSKEDAHDYRYFPDPDLLPLVIEQSW 296

Query: 311 IRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVI 370
           +  +K  +PELP+AKR R   E+G+S Y++SVL  +++IAD++E +A   D ++ ANW++
Sbjct: 297 VDELKAALPELPEAKRARLEQEYGVSRYESSVLCVEQAIADFYETVARGADARLAANWML 356

Query: 371 NDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVE 430
            D    LNR+G+SIED+P+S   L EL+ LI D TI+GKIAK++   + E G +   IVE
Sbjct: 357 GDFFAALNRTGRSIEDSPVSAEGLRELLGLISDSTINGKIAKEVLEDMVETGDSASAIVE 416

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQ 489
             GLRQVTD  AIE  + E++ +N + V      K  L  +FVGQ MK   GK NP++V 
Sbjct: 417 RKGLRQVTDTGAIESAIREILAANSDKVEEYKGGKDKLFGFFVGQTMKAMKGKGNPALVN 476

Query: 490 KMLKEKL 496
           + LK+ L
Sbjct: 477 ETLKKLL 483


>gi|329889396|ref|ZP_08267739.1| glutamyl-tRNAGln and/or aspartyl-tRNAAsn amidotransferase, B
           subunit [Brevundimonas diminuta ATCC 11568]
 gi|328844697|gb|EGF94261.1| glutamyl-tRNAGln and/or aspartyl-tRNAAsn amidotransferase, B
           subunit [Brevundimonas diminuta ATCC 11568]
          Length = 497

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 283/502 (56%), Positives = 356/502 (70%), Gaps = 16/502 (3%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
           +  +  L  G TG WE+V+G+E+HAQ++  +KLFSGA+V FGA PN QVS  DA  PGML
Sbjct: 1   MTENSKLIQGRTGAWEIVMGLEIHAQVASNAKLFSGAAVGFGAGPNEQVSLIDAGFPGML 60

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P LN  CV+QAV +GLGL A IN  S F RKNYFYPDLP GYQISQ   PIVGEG V V 
Sbjct: 61  PTLNKYCVEQAVKSGLGLRAQINLKSQFDRKNYFYPDLPTGYQISQLYHPIVGEGVVEVE 120

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
                        VGIER+HLEQDAGK IHD     S +DLNR+G ALMEIV++PD+R+ 
Sbjct: 121 AED-----GSFFNVGIERLHLEQDAGKLIHDLSPTESYVDLNRAGTALMEIVSRPDIRTP 175

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCR-----------PGEAWGTRCE 236
            EA A++ K+R+IL YLGTCDG+ME+G++RADVNVSVCR                GTRCE
Sbjct: 176 EEAVAYVKKIRTILIYLGTCDGDMEKGNLRADVNVSVCRAGNYHKFKETGDFSFLGTRCE 235

Query: 237 VKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYF 296
           +KNVNS RF+  AI+YEARRQI ILEDGG I QETRL+DP+  ETRS+R+KE+A DYRYF
Sbjct: 236 IKNVNSFRFISQAIQYEARRQIEILEDGGSITQETRLYDPTAGETRSMRSKEEAQDYRYF 295

Query: 297 SEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL 356
            +PDLLPL +++ +I AIK  +PELPD KR RF+ E+G+S YDA VL+S+++ A YFE  
Sbjct: 296 PDPDLLPLVLEQAWIDAIKADLPELPDDKRRRFMSEYGLSQYDAGVLISEQAKALYFEAA 355

Query: 357 AVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFN 416
           A  RD K+V+NWV N++   L   GK   D P+    + +L++LI    IS KIAK++F+
Sbjct: 356 AKGRDAKLVSNWVTNEVSARLAADGKDFSDNPLPAAHVAQLVELIETNVISSKIAKEVFD 415

Query: 417 ILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVM 476
            +W   G+P E+VE+ GL+QVTD  AIEK VDE+I +NP+  A +A KP  + WFVGQVM
Sbjct: 416 YVWNGEGSPAEVVEKHGLKQVTDTGAIEKAVDEIIAANPDKAAAVAEKPQAIGWFVGQVM 475

Query: 477 KNTGGKANPSIVQKMLKEKLGI 498
           K TGGKANP+ V  +LK KLG+
Sbjct: 476 KATGGKANPAAVNDILKAKLGL 497


>gi|73539777|ref|YP_294297.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ralstonia
           eutropha JMP134]
 gi|109892053|sp|Q477I0|GATB_RALEJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|72117190|gb|AAZ59453.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Ralstonia eutropha JMP134]
          Length = 485

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 238/486 (48%), Positives = 326/486 (67%), Gaps = 9/486 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E H QLS  SK+FSG S  FGAEPNTQ S  D A+PG+LP+LN   V++A+
Sbjct: 1   MQWEVVIGLETHTQLSTASKIFSGTSTAFGAEPNTQASPVDLALPGVLPVLNKGAVERAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +   K G+    
Sbjct: 61  QFGLAIGATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGSITIQVEG-KKGEVYEK 119

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L S
Sbjct: 120 TVQLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKALHS 179

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     + +GTR E+KN+NS RFL  AIEYE + QI
Sbjct: 180 LVVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRREIKNLNSFRFLQQAIEYEVQWQI 239

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
             +EDG  I+Q T LFDP   ETR++RTKEDA DYRYF +PDL+PLEID  +I  ++ ++
Sbjct: 240 NEIEDGRKIQQATVLFDPDTGETRAMRTKEDAHDYRYFPDPDLMPLEIDAAWIERVRGEL 299

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVINDLLG 375
           PELP A + RF+ ++G+S YDAS L + K++A Y+E +       + K  ANW++ D+  
Sbjct: 300 PELPAAMQARFVSQYGLSAYDASTLTASKAMASYYEAVVAEVGAANAKPAANWLMGDVAS 359

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIA-KDIFNILW--EKGGTPKEIVEEL 432
            LNR G SI+  P+ P QL  L+  I DGT+S   A KD+F  +W  E  G    I+   
Sbjct: 360 QLNREGISIDAAPVKPLQLARLLARIADGTVSNNTAKKDVFPAMWAGESNGDADAIIAAK 419

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL+Q++D   +EK++D+V+ +N  +V      K    +  VGQ MK T GKANP+ V ++
Sbjct: 420 GLKQMSDTGELEKIIDDVLAANAKSVEEFRAGKEKAFNALVGQAMKATKGKANPAQVNEL 479

Query: 492 LKEKLG 497
           LK+KLG
Sbjct: 480 LKKKLG 485


>gi|91205950|ref|YP_538305.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           bellii RML369-C]
 gi|109892060|sp|Q1RHE8|GATB_RICBR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|91069494|gb|ABE05216.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Rickettsia bellii
           RML369-C]
          Length = 483

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 268/484 (55%), Positives = 348/484 (71%), Gaps = 6/484 (1%)

Query: 15  TSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRC 74
               +G WE VIG+E+HAQ+S  SKLFSG+   F A PN+QVS+ DAAMPGMLP+LN  C
Sbjct: 4   IESNSGKWEYVIGLEIHAQISSKSKLFSGSGTTFAASPNSQVSYVDAAMPGMLPVLNEYC 63

Query: 75  VQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSG 134
           V QA+ TGLGL A +NKYSVF RKNYFY DLPQGYQISQ   PIV +G + +        
Sbjct: 64  VHQAIKTGLGLKAKVNKYSVFDRKNYFYADLPQGYQISQFYYPIVQDGTMEIPT-----S 118

Query: 135 QFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFL 194
                 + I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+
Sbjct: 119 TGELKTIRINRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPDEAAEFV 178

Query: 195 TKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEA 254
            KLRS+LRY+G+CDG+ME+GSMR D NVSV R GE  GTRCE+KN+NSIR +  AIE+EA
Sbjct: 179 KKLRSLLRYVGSCDGDMEKGSMRCDANVSVRRKGEPLGTRCEIKNINSIRNIVRAIEFEA 238

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           +RQ+ ++E+G  + QETRLF+    ETR++R+KE+A DYRYF +PDLLP+ + ++ I  +
Sbjct: 239 KRQVDLIENGESVIQETRLFNADSGETRTMRSKEEAADYRYFPDPDLLPVILSDELINEL 298

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLL 374
           K  +PELPD K +++I +FG+S YDA V+V+D+S A YFE+ A   D K++ANW+IN+L 
Sbjct: 299 KASLPELPDQKIDKYITKFGLSKYDAEVIVADESAAKYFEEAANECDPKLLANWLINELF 358

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
           G LN++   I +  I+PN   +LI LI D TISGKIAK +F I++E G    +IVEE GL
Sbjct: 359 GQLNKASAEISECKITPNDFAKLIKLIEDNTISGKIAKTVFEIMFETGKAADKIVEEQGL 418

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            QV+D + +  V+DEVI  NP++V      K  L  +FVGQVMK TGGKANP +V ++LK
Sbjct: 419 VQVSDSNVLNTVIDEVIRENPDSVEGYKGGKDKLFGFFVGQVMKKTGGKANPGLVNQLLK 478

Query: 494 EKLG 497
           EKLG
Sbjct: 479 EKLG 482


>gi|46580294|ref|YP_011102.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|120602325|ref|YP_966725.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Desulfovibrio
           vulgaris DP4]
 gi|81566620|sp|Q72AV5|GATB_DESVH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|166217758|sp|A1VCY2|GATB_DESVV RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|46449711|gb|AAS96361.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|120562554|gb|ABM28298.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Desulfovibrio vulgaris DP4]
 gi|311233724|gb|ADP86578.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfovibrio
           vulgaris RCH1]
          Length = 476

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 235/479 (49%), Positives = 313/479 (65%), Gaps = 9/479 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+EVHAQL   SKLF   S  FGA+PN  V    A MPG+LP+LN + V+ A   
Sbjct: 4   YEAVIGLEVHAQLRTRSKLFCSCSTAFGADPNAHVCEVCAGMPGVLPVLNEKAVEFAARM 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           G+ +   +N+ SVFARKNYFYPDLP+GYQISQ+++PI   G + +S+G           +
Sbjct: 64  GIAVGCTVNRTSVFARKNYFYPDLPKGYQISQYEQPICEHGHLDISVGDA------VKRI 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI RIHLE DAGK+IH     VS +DLNR+GV L+EIV++PD+RS+ EA A+L  LR+I+
Sbjct: 118 GITRIHLEDDAGKNIHSAGENVSYVDLNRTGVPLIEIVSEPDLRSAEEAVAYLKALRAIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            +LG CDGNMEEGS R D NVS+       +GTR E+KN+NS R +  AIEYE  RQ  +
Sbjct: 178 VHLGICDGNMEEGSFRCDANVSLRPRGAAEFGTRAELKNLNSFRHVQRAIEYEISRQADL 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           L+DG  + QETRL+D  KN T S+R KE+A DYRYF +PDL+P+ IDE  +   +  +PE
Sbjct: 238 LDDGDKVVQETRLYDSVKNITVSMRGKEEAHDYRYFPDPDLIPIHIDEARLAEWQATLPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVLNR 379
           LP A+ ERF+  FG+S  DA VL +++  A++FE         + +AN ++  L   LN+
Sbjct: 298 LPQARLERFMSSFGLSAQDAEVLTAERDHAEFFEAAVKLYDQPRKIANMMLGPLQRELNQ 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
            G S+  + + P  L EL+ +I  G IS KI  D+F  L+E G  P+  V E GL Q++D
Sbjct: 358 RGTSLAVSAMRPEALAELVRIIDAGLISAKIGNDVFGELFENGAMPEAFVRERGLVQISD 417

Query: 440 LSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
            SAIE+ VDEVI  NP  V      K  LVS+FVGQVM+ T GKANP++V ++L  KLG
Sbjct: 418 TSAIEQAVDEVIAENPAEVEAYRGGKTKLVSFFVGQVMRKTRGKANPALVNELLASKLG 476


>gi|325123302|gb|ADY82825.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter calcoaceticus PHEA-2]
          Length = 489

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 253/495 (51%), Positives = 340/495 (68%), Gaps = 15/495 (3%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           A+   L  G    WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP
Sbjct: 4   AQKLKLIDG----WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLP 59

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           +LN + V  A+  GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +
Sbjct: 60  VLNEKVVDLAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL 119

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
                    T  +G+ R HLE+DAGKSIHDQ+  +S IDLNR+G  L+EIV++PDMRS  
Sbjct: 120 ED-----GTTKRIGVTRAHLEEDAGKSIHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVE 174

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           EA A++  + +++R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  
Sbjct: 175 EAVAYIKSIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQ 234

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AI  E  RQ+ ILE GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I +
Sbjct: 235 AINVEIERQMEILEYGGSIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIAD 294

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKI 364
           + I A +  +PELP A+R RFI +FG++ YDA VL   + +AD+FE            K+
Sbjct: 295 EQIEAARAALPELPAARRARFIADFGVTEYDAHVLTLSREMADFFEAVVAAAGGAAQGKV 354

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGG 423
            ANWV+ +  G LN++G  + D+P+S  QLG +I  IID TISGKIAK +F  +WE +G 
Sbjct: 355 SANWVMGEFSGALNKAGLDLADSPVSAEQLGGMIARIIDNTISGKIAKQVFGFMWESEGK 414

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGK 482
           +  +I+ E GL+Q TD  AIE ++ EV+ +N   V      K    +  VGQVMK + GK
Sbjct: 415 SADDIIAEKGLKQETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGK 474

Query: 483 ANPSIVQKMLKEKLG 497
           ANP+ V +++K+ +G
Sbjct: 475 ANPAQVNELMKKLIG 489


>gi|299768904|ref|YP_003730930.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           sp. DR1]
 gi|298698992|gb|ADI89557.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           sp. DR1]
          Length = 489

 Score =  555 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 251/495 (50%), Positives = 341/495 (68%), Gaps = 15/495 (3%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           A+   L  G    WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP
Sbjct: 4   AQKLKLIDG----WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLP 59

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           +LN + V  A+  GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +
Sbjct: 60  VLNEKVVDLAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL 119

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
                    T  +G+ R HLE+DAGKSIHDQ+  +S IDLNR+G  L+EIV++PDMRS  
Sbjct: 120 ED-----GTTKRIGVTRAHLEEDAGKSIHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVE 174

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           EA A++  + +++R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  
Sbjct: 175 EAVAYIKSIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQ 234

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AI  E  RQ+ ILE GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I +
Sbjct: 235 AINVEIERQMEILEYGGSIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIAD 294

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKI 364
           + I A +  +PELP A+R RFI +FG++ YDA VL   + +AD+FE         +  K+
Sbjct: 295 EQIEAARAALPELPAARRARFIADFGVTEYDAHVLTLSREMADFFEAVVAAAGGAKQGKV 354

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGG 423
            ANWV+ +  G LN++G  + ++P+S  QLG +I  I+D TISGKIAK +F  +WE +G 
Sbjct: 355 SANWVMGEFSGALNKAGLDLAESPVSAEQLGGMIARIVDNTISGKIAKQVFGFMWESEGK 414

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGK 482
           +  +I+ E GL+Q TD  AIE ++ EV+ +N   V      K    +  VGQVMK + GK
Sbjct: 415 SADDIIAEKGLKQETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGK 474

Query: 483 ANPSIVQKMLKEKLG 497
           ANP+ V +++K+ +G
Sbjct: 475 ANPAQVNELMKKLIG 489


>gi|239813299|ref|YP_002942209.1| glutamyl-tRNA(Gln) amidotransferase, subunit beta [Variovorax
           paradoxus S110]
 gi|259647242|sp|C5CY39|GATB_VARPS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|239799876|gb|ACS16943.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Variovorax
           paradoxus S110]
          Length = 476

 Score =  555 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 230/479 (48%), Positives = 313/479 (65%), Gaps = 9/479 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +EV+IG E HAQLS  SK+FS AS  FGAEPNTQ    D A+PG LP++N   V++A+  
Sbjct: 4   YEVIIGFETHAQLSTASKIFSRASTAFGAEPNTQACAVDLALPGTLPVMNKGAVERAIKL 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL L +HI   SVFARKNYFYPDLP+GYQISQ++ P+V  G VS  +G +K        V
Sbjct: 64  GLALGSHIAPRSVFARKNYFYPDLPKGYQISQYEIPVVQGGAVSFFLGEEK------KTV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
            + R HLE+DAGKS+H+ +   S IDLNR+G  L+EIVT+PDMRS+ EA A+  +L  I+
Sbjct: 118 RLVRAHLEEDAGKSLHENFIGQSGIDLNRAGTPLLEIVTEPDMRSTAEAVAYARELHKIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
            ++G CDGNM+EGS R D NVSV +PGE  GTR E+KN+NS +F+  AI+YE   QI  L
Sbjct: 178 TWIGICDGNMQEGSFRCDANVSVRKPGEKLGTRREIKNLNSFKFMQQAIDYEINSQINEL 237

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           EDG  I Q T LFDP   ETR++RTKEDA DYRYF +PDL PL I+ ++I  ++  +PEL
Sbjct: 238 EDGRKIEQATVLFDPDTGETRTMRTKEDAADYRYFPDPDLPPLAIEAEWIERVRATMPEL 297

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYF-EKLAVNRDKKIVANWVINDLLGVLNRS 380
           P A  ER++ + G+S YDA+ L    ++A YF + +      K+ +NW+  ++   LN  
Sbjct: 298 PRAMAERYVRDHGMSEYDAAQLTQSPALARYFDDAVKAGATPKLASNWITGEMARRLNAQ 357

Query: 381 GKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG-TPKEIVEELGLRQVTD 439
              IE  P++  QL +L+  I DGT+    A+ +F+ LW   G     I+E   L+ ++D
Sbjct: 358 EIGIEAAPVTAQQLAQLVGRIADGTLPNNAARQVFDALWTGEGSDVDAIIEARDLKPMSD 417

Query: 440 LSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
             A+++++DEVI  N  NV      K   ++  VGQVMK +GGKANP+ V ++LK KLG
Sbjct: 418 TGALDRILDEVIAKNAKNVEEYRGGKEKALNGLVGQVMKASGGKANPAQVTELLKAKLG 476


>gi|167645488|ref|YP_001683151.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Caulobacter sp.
           K31]
 gi|167347918|gb|ABZ70653.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Caulobacter sp.
           K31]
          Length = 499

 Score =  555 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 292/504 (57%), Positives = 368/504 (73%), Gaps = 17/504 (3%)

Query: 6   THVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPG 65
           T  A S+    G TG WE+V+G+E+HAQ++ VSKLFSGA+V FGA PN QVS  DAAMPG
Sbjct: 2   TETASSKQ-IQGRTGPWEIVLGLEIHAQVASVSKLFSGAAVGFGAGPNQQVSLVDAAMPG 60

Query: 66  MLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVS 125
           MLP+LNG CV+QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ D+PIVGEG V+
Sbjct: 61  MLPVLNGFCVEQAVKTGLGLKAQINLKSRFDRKNYFYPDLPQGYQISQFDQPIVGEGVVT 120

Query: 126 VSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMR 185
           V           T +VGIER+HLEQDAGKSIHD     + +DLNR+G ALMEIV+KP MR
Sbjct: 121 VERDD-----GTTFDVGIERLHLEQDAGKSIHDIDPNATYVDLNRAGTALMEIVSKPHMR 175

Query: 186 SSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-----------GEAWGTR 234
           S+ EA A++ K+R+IL YLGTCDG+ME+G++RADVNVSVCRP               GTR
Sbjct: 176 SAEEAAAYVKKIRTILVYLGTCDGDMEKGNLRADVNVSVCRPGDYEKFRETGSFSHLGTR 235

Query: 235 CEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYR 294
           CE+KNVNS R++  AIEYEARRQI ILEDGG I QETRLFDP+K ETRS+R+KE+A DYR
Sbjct: 236 CEIKNVNSYRYIQQAIEYEARRQIEILEDGGKIDQETRLFDPTKVETRSMRSKEEAHDYR 295

Query: 295 YFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE 354
           YF +PDLLPL +D D+++ I+  +PELPDAK+ R   ++G+S YDA VL+ +   ADYFE
Sbjct: 296 YFPDPDLLPLVLDADWVKRIQDTLPELPDAKKARLQSQYGLSAYDAGVLIIESHRADYFE 355

Query: 355 KLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDI 414
             AV RD K+V+NWV N+LL  L+  G  I  +P+  + + +L++LI +GTIS KIAK++
Sbjct: 356 AAAVGRDAKLVSNWVTNELLSKLSAHGHEIAASPLPSSDIAQLVELIENGTISSKIAKEV 415

Query: 415 FNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQ 474
           F  +W   G P +IVE  GL Q+ D  AIE  +D +I +NP+  + +  KP  + WFVGQ
Sbjct: 416 FEHMWAGEGRPAQIVETRGLVQINDTGAIEAAIDALIAANPDKASAVKEKPQAIGWFVGQ 475

Query: 475 VMKNTGGKANPSIVQKMLKEKLGI 498
           VMK TGGKANP+ V ++L+ KLG+
Sbjct: 476 VMKETGGKANPATVNELLRSKLGL 499


>gi|328952711|ref|YP_004370045.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Desulfobacca acetoxidans DSM 11109]
 gi|328453035|gb|AEB08864.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Desulfobacca acetoxidans DSM 11109]
          Length = 476

 Score =  555 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 212/480 (44%), Positives = 317/480 (66%), Gaps = 9/480 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++EVVIG+EVHAQL   SK+F G +  FGA PN+Q       MPG+LP+LN + V+  +
Sbjct: 1   MEYEVVIGLEVHAQLLTQSKIFCGCATTFGATPNSQTCPICLGMPGVLPVLNRKVVEYGL 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              L  +  I  YS FARKNYFYPDLP+GYQISQ++ P+   G+V + +   K       
Sbjct: 61  KMALATHCLIASYSRFARKNYFYPDLPKGYQISQYELPLAEHGRVDIEVDGVK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           ++G+ RIH+E+DAGK IHD+   +S +D NR+GV L+EIV++PD+R+  EA A+L  +R+
Sbjct: 115 QIGLTRIHMEEDAGKLIHDEQLPISYVDFNRTGVPLLEIVSEPDLRTPDEAAAYLKAIRN 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL YL  CDGNMEEGS+R D N+S+       +G R E+KN+NS R +  A+EYE RRQ 
Sbjct: 175 ILLYLEICDGNMEEGSLRCDANISLRPQGATEFGVRTELKNMNSFRNVQRALEYEIRRQR 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
           ++L+ GG + QETRL+D ++ +T S+R KE+A DYRYF +PDL+PL I  ++++ ++  +
Sbjct: 235 SLLDAGGEVIQETRLWDANQGKTYSMRGKEEAHDYRYFPDPDLIPLVISPEWLKEVQATL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVL 377
           PELPDAK+ERFI ++ +  YDA VL  +K++ADYFE    +    K V+NW++++L+  L
Sbjct: 295 PELPDAKKERFISQYDLPEYDAGVLTQEKALADYFEDCVRDFPQPKKVSNWIMSELMREL 354

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
            +  + I+  P++P  L  L+ L+ +  ISGKIAK +F  +   G  P  IV+  GL Q+
Sbjct: 355 KKEDQDIQTCPVAPTGLARLLTLVEEEVISGKIAKSVFMEMIASGNDPDAIVKAKGLIQI 414

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D  ++E +  E++ +NP  VA     K  ++ +FVG++MK T G+ANP +  ++L   L
Sbjct: 415 SDTGSLETLAREILAANPKEVADFKAGKTKVMGFFVGEMMKKTKGQANPKLANQLLSRLL 474


>gi|295675145|ref|YP_003603669.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia sp.
           CCGE1002]
 gi|295434988|gb|ADG14158.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia sp.
           CCGE1002]
          Length = 491

 Score =  555 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 233/489 (47%), Positives = 333/489 (68%), Gaps = 11/489 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  WEVVIG+E H QLS  SK+FSG +  FGA PNTQ S  D A+PG LP++N   V++A
Sbjct: 2   TKQWEVVIGLETHTQLSTHSKIFSGTATQFGAAPNTQASPVDLALPGTLPVMNRGAVERA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQF 136
           +  GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G+V++ +  ++    + 
Sbjct: 62  IQFGLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQVTIQVPANEKAGKEA 121

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
               + + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   
Sbjct: 122 YEKTINLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKS 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L +++ +LG CDGNM+EGS R D NVSV     + +GTR E+KN+NS RFL  AI+YE R
Sbjct: 182 LHTLVVWLGICDGNMQEGSFRCDANVSVRPLGQKEFGTRAEIKNLNSFRFLEEAIQYEVR 241

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL ID  ++  ++
Sbjct: 242 RQIELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLMIDAAWVERVR 301

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVIND 372
            ++PELP+A + RF+ ++G++ YDA+VL S K+ A Y+E +       + K+ ANWV+ +
Sbjct: 302 SEMPELPEAIQRRFVSQYGLTPYDANVLTSSKATAAYYEAVVAKAGEANAKVAANWVMGE 361

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT----PKEI 428
           +   LNR G  I   P+S  QL  ++  I DGTIS KIAK+IF  +WE+  T       I
Sbjct: 362 VSSQLNREGLDIAACPVSAAQLALVLQRIADGTISNKIAKEIFLAIWEEKATDEAAADRI 421

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSI 487
           +E  GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP+ 
Sbjct: 422 IEAKGLKQISDTGALEAIIDEVLAANQKSVDEYRAGKEKAFNALIGQAMKATKGKANPAQ 481

Query: 488 VQKMLKEKL 496
           V ++LK+KL
Sbjct: 482 VNELLKKKL 490


>gi|209545485|ref|YP_002277714.1| aspartyl/glutamyl-tRNA amidotransferase subunit B
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533162|gb|ACI53099.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 482

 Score =  555 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 282/486 (58%), Positives = 353/486 (72%), Gaps = 6/486 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
             L  G TG WE+V+G+EVHAQ+   SKLFSGAS ++G EPNT VS  DA  PGMLP++N
Sbjct: 2   TYLVEGRTGPWELVVGLEVHAQVISRSKLFSGASASYGGEPNTHVSLVDAGFPGMLPVIN 61

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QAV TGLGL A IN  S F RKNYFY DLP GYQISQ   PI+GEG V + +   
Sbjct: 62  RECVAQAVRTGLGLKARINLESRFDRKNYFYADLPTGYQISQFAHPIIGEGAVEIELAD- 120

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
                 T  +GI R+HLEQDAGKS+HDQ    S IDLNR+GVALMEIV++PD+R+  EA 
Sbjct: 121 ----GATRTIGITRLHLEQDAGKSMHDQDPTRSFIDLNRAGVALMEIVSEPDIRTPEEAG 176

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A+L KLR ILRYLGTCDGNMEEGSMRADVNVSV + GE + TRCE+KNVNSIR++  AIE
Sbjct: 177 AYLRKLRMILRYLGTCDGNMEEGSMRADVNVSVRKAGEPFRTRCEIKNVNSIRYVMQAIE 236

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
            EA RQ+ I E GG + QETRLFDP++ ETRSLR+KEDA DYRYF +PDLLPL I+E ++
Sbjct: 237 VEAVRQVEIWESGGEVDQETRLFDPARGETRSLRSKEDAHDYRYFPDPDLLPLVIEEAWV 296

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
            ++   +PELPDAKR+RF  E+GI  YDA VLV++++ AD++E +A  RD ++ ANWVI 
Sbjct: 297 ESLAAVLPELPDAKRQRFQDEYGIPRYDAGVLVAEQATADFYETVARGRDPRLAANWVIG 356

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           DL   LNR+G++I+D+PIS + LG ++DL+ DGTI+GKIAK++F  + E G     IVE 
Sbjct: 357 DLFAALNRTGRTIQDSPISADALGGMLDLVTDGTINGKIAKEVFEDMLETGDPAAAIVER 416

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GLRQVTD  AI+  V  V+ +N + +A     K  L  +FVGQVMK   GK NP++V +
Sbjct: 417 KGLRQVTDTGAIDAAVQAVLAANADKLAEYRSGKDKLFGFFVGQVMKAMAGKGNPALVNE 476

Query: 491 MLKEKL 496
            LK+ L
Sbjct: 477 ALKKVL 482


>gi|162148749|ref|YP_001603210.1| aspartyl/glutamyl-tRNA amidotransferase subunit B
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787326|emb|CAP56920.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 483

 Score =  555 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 282/486 (58%), Positives = 353/486 (72%), Gaps = 6/486 (1%)

Query: 12  ESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILN 71
             L  G TG WE+V+G+EVHAQ+   SKLFSGAS ++G EPNT VS  DA  PGMLP++N
Sbjct: 3   TYLVEGRTGPWELVVGLEVHAQVISRSKLFSGASASYGGEPNTHVSLVDAGFPGMLPVIN 62

Query: 72  GRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPD 131
             CV QAV TGLGL A IN  S F RKNYFY DLP GYQISQ   PI+GEG V + +   
Sbjct: 63  RECVAQAVRTGLGLKARINLESRFDRKNYFYADLPTGYQISQFAHPIIGEGAVEIELAD- 121

Query: 132 KSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAK 191
                 T  +GI R+HLEQDAGKS+HDQ    S IDLNR+GVALMEIV++PD+R+  EA 
Sbjct: 122 ----GATRTIGITRLHLEQDAGKSMHDQDPTRSFIDLNRAGVALMEIVSEPDIRTPEEAG 177

Query: 192 AFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIE 251
           A+L KLR ILRYLGTCDGNMEEGSMRADVNVSV + GE + TRCE+KNVNSIR++  AIE
Sbjct: 178 AYLRKLRMILRYLGTCDGNMEEGSMRADVNVSVRKAGEPFRTRCEIKNVNSIRYVMQAIE 237

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
            EA RQ+ I E GG + QETRLFDP++ ETRSLR+KEDA DYRYF +PDLLPL I+E ++
Sbjct: 238 VEAVRQVEIWESGGEVDQETRLFDPARGETRSLRSKEDAHDYRYFPDPDLLPLVIEEAWV 297

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
            ++   +PELPDAKR+RF  E+GI  YDA VLV++++ AD++E +A  RD ++ ANWVI 
Sbjct: 298 ESLAAVLPELPDAKRQRFQDEYGIPRYDAGVLVAEQATADFYETVARGRDPRLAANWVIG 357

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           DL   LNR+G++I+D+PIS + LG ++DL+ DGTI+GKIAK++F  + E G     IVE 
Sbjct: 358 DLFAALNRTGRTIQDSPISADALGGMLDLVTDGTINGKIAKEVFEDMLETGDPAAAIVER 417

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GLRQVTD  AI+  V  V+ +N + +A     K  L  +FVGQVMK   GK NP++V +
Sbjct: 418 KGLRQVTDTGAIDAAVQAVLAANADKLAEYRSGKDKLFGFFVGQVMKAMAGKGNPALVNE 477

Query: 491 MLKEKL 496
            LK+ L
Sbjct: 478 ALKKVL 483


>gi|56418818|ref|YP_146136.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Geobacillus
           kaustophilus HTA426]
 gi|81558105|sp|Q5L3B2|GATB_GEOKA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|56378660|dbj|BAD74568.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Geobacillus kaustophilus
           HTA426]
          Length = 476

 Score =  554 bits (1428), Expect = e-155,   Method: Composition-based stats.
 Identities = 218/481 (45%), Positives = 310/481 (64%), Gaps = 10/481 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVH +L   SK+FS +   FGA PNTQ +  D   PG+LP+LN + V+ A+
Sbjct: 1   MNFETVIGLEVHVELKTKSKIFSSSPNAFGAPPNTQTNVIDLGYPGVLPVLNRQAVEFAM 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              + LN  I   + F RKNYFYPD P+ YQISQ+D+P+   G + + +   K       
Sbjct: 61  KAAMALNCEIATETKFDRKNYFYPDNPKAYQISQYDQPLGRNGWIEIEVNGKK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           ++GI RIHLE+DAGK  H      S +D NR G  L+EIV++PD+RS  EA A+L KL++
Sbjct: 115 KIGITRIHLEEDAGKLTHTGD-GYSLVDFNRQGTPLIEIVSEPDIRSPEEAYAYLEKLKA 173

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I++Y G  D  MEEGS+R D N+S+     + +GT+ E+KN+NS  F+ + +EYEA+RQ 
Sbjct: 174 IIQYTGVSDCKMEEGSLRCDANISLRPLGSDKFGTKTELKNLNSFNFVRMGLEYEAKRQE 233

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            IL  GG IRQETR FD +   T  +R KE + DYRYF EPDL+ L ID+++   ++  I
Sbjct: 234 KILLSGGVIRQETRRFDEATKTTVLMRVKEGSEDYRYFPEPDLVMLYIDDEWKERVRASI 293

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELPDA+R+R+I E+G+  YDA VL   K +AD+FE       D K+ +NW++ ++ G L
Sbjct: 294 PELPDARRKRYIEEWGLPEYDAKVLTLTKEMADFFEATVANGADPKLASNWLMVEVSGYL 353

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N   K + D  ++P  L  +I LI +GTIS KIAK +F  L E GG P++IV+E GL Q+
Sbjct: 354 NAEQKELHDIALTPESLAGMIKLIQNGTISSKIAKKVFKELVEHGGDPEKIVKEKGLVQI 413

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D  A+ K+V EV+++NP +V      K   + + VGQVMK T G+ANP +V K+L E++
Sbjct: 414 SDEGALRKIVLEVLDANPQSVEDYKNGKDRALGFLVGQVMKATKGQANPPLVNKLLVEEI 473

Query: 497 G 497
           G
Sbjct: 474 G 474


>gi|206558887|ref|YP_002229647.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           cenocepacia J2315]
 gi|229486048|sp|B4E7X7|GATB_BURCJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|198034924|emb|CAR50796.1| glutamyl-tRNA amidotransferase subunit B [Burkholderia cenocepacia
           J2315]
          Length = 491

 Score =  554 bits (1428), Expect = e-155,   Method: Composition-based stats.
 Identities = 244/487 (50%), Positives = 334/487 (68%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++         
Sbjct: 65  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKAAYEK 124

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 125 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQI 244

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I +D+I  ++  +
Sbjct: 245 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGQDWIERVQSGM 304

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A ++RF+ E+G+S YDA VL S K++A YFE     A   + KI ANW++ D+  
Sbjct: 305 PELPAAMQQRFVDEYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAANAKIAANWLMGDVSS 364

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVEE 431
            LNR G  I+  P+S  QL  L+  I DGTIS KIAK+IF  +W++     G    I++ 
Sbjct: 365 QLNRDGIEIDAIPVSAAQLALLLQRIADGTISNKIAKEIFATIWDEKATDEGAADRIIDA 424

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP  V +
Sbjct: 425 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVNE 484

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 485 LLKKKLG 491


>gi|255318766|ref|ZP_05359992.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter radioresistens SK82]
 gi|255304022|gb|EET83213.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter radioresistens SK82]
          Length = 493

 Score =  554 bits (1428), Expect = e-155,   Method: Composition-based stats.
 Identities = 248/502 (49%), Positives = 338/502 (67%), Gaps = 14/502 (2%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M           +L  G    WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D
Sbjct: 1   MAQAQKSAKPKSNLIDG----WEVVIGIEIHTQLATKSKIFSGSSTEFGQDPNTQASLVD 56

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
            AMPG+LP+LN   V  A+  GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG
Sbjct: 57  LAMPGVLPVLNKEVVDLAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVG 116

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
            G + + +            +G+ R HLE+DAGKSIHDQ+  +S IDLNR+G  L+EIV+
Sbjct: 117 LGHIDIQLED-----GTVKRIGVTRAHLEEDAGKSIHDQFEGMSGIDLNRAGTPLLEIVS 171

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
           +PDMRS  EA A++  + +++R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+
Sbjct: 172 EPDMRSVEEAVAYIKAIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNL 231

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NS RF+  AI  E  RQ+ ILE  G I QETRLFDP K ETRS+R+KE+A DYRYF +PD
Sbjct: 232 NSFRFIEQAINVEIERQMEILEWDGTIDQETRLFDPVKMETRSMRSKEEANDYRYFPDPD 291

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-- 358
           LLP+ I ++ I AIK  +PELP A+R RF+ +FG++ YDA VL   + +++++E++    
Sbjct: 292 LLPVIIADEQIEAIKATMPELPAARRARFVADFGVTEYDAHVLTLTREMSEFYEEVVKAA 351

Query: 359 --NRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFN 416
                 KI ANWV+ +  G LN++   + D+P++  +LG +I  I+D TISGKIAK +F 
Sbjct: 352 GGAAQGKIAANWVMGEFSGALNKASLDLADSPVTAEKLGGMIARIVDNTISGKIAKQVFG 411

Query: 417 ILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQV 475
            +WE+G T  EI+ E GL+Q TD  AIE ++ EV+ +N   V      K    +  VGQV
Sbjct: 412 FMWEEGKTADEIIAEKGLKQETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQV 471

Query: 476 MKNTGGKANPSIVQKMLKEKLG 497
           MK + GKANP+ V +++K+ +G
Sbjct: 472 MKASKGKANPAQVNELMKKLIG 493


>gi|332853447|ref|ZP_08434766.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Acinetobacter baumannii 6013150]
 gi|332870570|ref|ZP_08439312.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Acinetobacter baumannii 6013113]
 gi|332728653|gb|EGJ60021.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Acinetobacter baumannii 6013150]
 gi|332732130|gb|EGJ63399.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Acinetobacter baumannii 6013113]
          Length = 489

 Score =  554 bits (1428), Expect = e-155,   Method: Composition-based stats.
 Identities = 253/495 (51%), Positives = 342/495 (69%), Gaps = 15/495 (3%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           A+   L  G    WEVVIGIE+H QL+  SK+FSG+   FG +PNTQ S  D AMPG+LP
Sbjct: 4   AQKLKLIDG----WEVVIGIEIHTQLATNSKIFSGSPTEFGQDPNTQASLVDLAMPGVLP 59

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           +LN + V+ A+  GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +
Sbjct: 60  VLNEKVVELAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL 119

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
                    T  +G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  
Sbjct: 120 ED-----GTTKRIGVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVE 174

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           EA A++  + +++R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  
Sbjct: 175 EAVAYIKAIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQ 234

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AI  E  RQ+ ILE GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I +
Sbjct: 235 AINVEIERQMEILEWGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIPD 294

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKI 364
           + I AIK  +PELP A+R RFI +FG++ YDA VL   + +AD++E         +  KI
Sbjct: 295 EQIEAIKATMPELPAARRARFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKI 354

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGG 423
            ANWV+ +  G LN++G  + D+P+S  QLG +I  IID TISGKIAK +F  +WE +G 
Sbjct: 355 AANWVMGEFSGALNKAGLELTDSPVSAEQLGGMIARIIDNTISGKIAKQVFGFMWESEGK 414

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGK 482
           +  +I+ E GL+Q TD  AIE ++ EV+ +N   V      K    +  VGQVMK + GK
Sbjct: 415 SADDIIAEKGLKQETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGK 474

Query: 483 ANPSIVQKMLKEKLG 497
           ANP+ V +++K+ +G
Sbjct: 475 ANPAQVNELMKKLIG 489


>gi|88704049|ref|ZP_01101764.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Congregibacter
           litoralis KT71]
 gi|88701876|gb|EAQ98980.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Congregibacter
           litoralis KT71]
          Length = 484

 Score =  554 bits (1428), Expect = e-155,   Method: Composition-based stats.
 Identities = 243/481 (50%), Positives = 322/481 (66%), Gaps = 12/481 (2%)

Query: 23  EVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTG 82
           E+VIG+EVH QL+  SK+FSG+   FGAEPNTQ +  D AMPGMLP+LN + V+ AVM G
Sbjct: 4   EMVIGLEVHLQLATRSKIFSGSPTTFGAEPNTQANAVDLAMPGMLPVLNKQAVRYAVMFG 63

Query: 83  LGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVG 142
           L ++A I K S F RKNYFYPDLP+GYQISQ  +PIVG G+ S  +            VG
Sbjct: 64  LAIDAEIGKRSAFDRKNYFYPDLPKGYQISQFAEPIVGTGRFSFKLPDGSES-----TVG 118

Query: 143 IERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILR 202
           I R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIVT+PD RS  +A AFL  L S++ 
Sbjct: 119 ITRAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVTEPDFRSGEQAVAFLKALHSLVT 178

Query: 203 YLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           YLG  DGNM EGSMR DVN+S+     +  GTR E+KNVNS RF+  AI  E  RQ  IL
Sbjct: 179 YLGISDGNMAEGSMRCDVNLSLRPADSDTLGTRTEIKNVNSFRFVEKAIRCERIRQEDIL 238

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPEL 321
           +DGG I QETRL+D  ++ETRS+R+KE A DYRYF EPDLLP+ +D++ I  IK  +PEL
Sbjct: 239 DDGGSIVQETRLYDADRDETRSMRSKEVANDYRYFPEPDLLPVILDDEDIAEIKASLPEL 298

Query: 322 PDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVLNRS 380
           P A+  RF  E+G+S YDA VL  ++ +ADYFE     + D K+ ANW+  +LL  LN  
Sbjct: 299 PRARWARFQDEYGLSEYDAGVLTDERDVADYFEATAKASGDPKLAANWIQGELLAALNAE 358

Query: 381 GKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDL 440
            +SI+  P++   LG LI  I D TISGKIAK++F  +W   G    I++  GL+QV+D 
Sbjct: 359 DQSIQSCPVAAEHLGGLILRIKDQTISGKIAKEVFEAMWNGEGDADAIIDARGLKQVSDS 418

Query: 441 SAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
            A+  +VD+V+  NP+ VA+        +  L  +FVGQ+MK + G+ANP +V ++L  +
Sbjct: 419 GALAAMVDQVVADNPDQVAQYRAADPAKRKKLSGFFVGQIMKASKGQANPQMVNELLIPR 478

Query: 496 L 496
           L
Sbjct: 479 L 479


>gi|169794870|ref|YP_001712663.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           baumannii AYE]
 gi|213157803|ref|YP_002320601.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Acinetobacter
           baumannii AB0057]
 gi|215482418|ref|YP_002324600.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Acinetobacter baumannii AB307-0294]
 gi|260557236|ref|ZP_05829452.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter baumannii ATCC 19606]
 gi|301344938|ref|ZP_07225679.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           baumannii AB056]
 gi|301594360|ref|ZP_07239368.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           baumannii AB059]
 gi|169147797|emb|CAM85660.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter baumannii AYE]
 gi|213056963|gb|ACJ41865.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Acinetobacter
           baumannii AB0057]
 gi|213986020|gb|ACJ56319.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Acinetobacter baumannii AB307-0294]
 gi|260409342|gb|EEX02644.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter baumannii ATCC 19606]
          Length = 489

 Score =  554 bits (1428), Expect = e-155,   Method: Composition-based stats.
 Identities = 253/495 (51%), Positives = 343/495 (69%), Gaps = 15/495 (3%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           A+   L  G    WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP
Sbjct: 4   AQKLKLIDG----WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLP 59

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           +LN + V+ A+  GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +
Sbjct: 60  VLNEKVVELAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL 119

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
                    T  +G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  
Sbjct: 120 ED-----GTTKRIGVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVE 174

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           EA A++  + +++R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  
Sbjct: 175 EAVAYIKAIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQ 234

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AI  E  RQ+ ILE GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I +
Sbjct: 235 AINVEIERQMEILEWGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIPD 294

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKI 364
           + I AIK  +PELP A+R RFI +FG++ YDA VL   + +AD++E         +  KI
Sbjct: 295 EQIEAIKATMPELPAARRARFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKI 354

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGG 423
            ANWV+ +  G LN++G  + D+P+S  QLG +I  I+D TISGKIAK +F  +WE +G 
Sbjct: 355 AANWVMGEFSGALNKAGLELTDSPVSAEQLGGMIARIVDNTISGKIAKQVFGFMWESEGK 414

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGK 482
           +  +I+ E GL+Q TD  AIE ++ EV+ +N   V      K    +  VGQVMK + GK
Sbjct: 415 SADDIIAEKGLKQETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGK 474

Query: 483 ANPSIVQKMLKEKLG 497
           ANP+ V +++K+ +G
Sbjct: 475 ANPAQVNELMKKLIG 489


>gi|165932765|ref|YP_001649554.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           rickettsii str. Iowa]
 gi|189045149|sp|B0BWC2|GATB_RICRO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|165907852|gb|ABY72148.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Rickettsia rickettsii str. Iowa]
          Length = 483

 Score =  554 bits (1428), Expect = e-155,   Method: Composition-based stats.
 Identities = 267/483 (55%), Positives = 345/483 (71%), Gaps = 6/483 (1%)

Query: 15  TSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRC 74
             G TG WE VIG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  C
Sbjct: 4   IEGNTGKWEYVIGLEIHAQISSKSKLFSGSSTIFAANPNSQVSYVDAAMPGMLPVLNKHC 63

Query: 75  VQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSG 134
           V QA+ TGLGL A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +        
Sbjct: 64  VHQAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEIPT-----S 118

Query: 135 QFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFL 194
                 + I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+
Sbjct: 119 TGDLKTIRINRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPEEAAEFV 178

Query: 195 TKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEA 254
            KLR++LRY+G+CDG+ME+GSMR D N+SV R GE  GTRCE+KN+NSIR +  AIE+EA
Sbjct: 179 KKLRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIIKAIEFEA 238

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           +RQ+ +LE G  I QETRLF+    ETR++R KE+ALDYRYF +PDLLPL I ++ I  +
Sbjct: 239 KRQVDLLESGEEIIQETRLFNADSGETRTMRLKEEALDYRYFPDPDLLPLVISDELINEL 298

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLL 374
           K  +PELPD K E++  EF +S YDA V+V+D+S+A+YFEK A   + K++ NW+ ++L 
Sbjct: 299 KANLPELPDQKIEKYTKEFSLSKYDAEVIVADESVAEYFEKAANECNPKMLTNWLTSELF 358

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
           G LN++   I +  I+P+   +L+ LI + TISGKIAK +F I++E G  P +I+EE GL
Sbjct: 359 GQLNKASIGINECKITPSNFAKLVKLIENDTISGKIAKTVFEIMFETGKAPDKIIEEKGL 418

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            QV+D + +  V+DEVI  NP +V      K  L  +FVGQVMK T GKANP++V ++LK
Sbjct: 419 VQVSDNNVLNTVIDEVIAENPESVEGYRSGKDKLFGFFVGQVMKKTDGKANPTLVNQLLK 478

Query: 494 EKL 496
           EKL
Sbjct: 479 EKL 481


>gi|114331582|ref|YP_747804.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nitrosomonas
           eutropha C91]
 gi|122313632|sp|Q0AFP3|GATB_NITEC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|114308596|gb|ABI59839.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Nitrosomonas eutropha C91]
          Length = 478

 Score =  554 bits (1427), Expect = e-155,   Method: Composition-based stats.
 Identities = 237/482 (49%), Positives = 328/482 (68%), Gaps = 11/482 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+E+H QL   SK+FSGASV +GA PN+Q    D A+PG+LP+LN + V+ A+
Sbjct: 1   MQWETVIGLEIHVQLLTRSKIFSGASVAYGARPNSQACAVDIALPGVLPVLNRQVVEYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL +NA IN  S+FARKNYFYPDLP+GYQISQ   PIV  G V++  G       +  
Sbjct: 61  RFGLAINATINSPSIFARKNYFYPDLPKGYQISQLAHPIVEGGHVTIRTGD------KEK 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + + R HLE+DAGKS H+ +   + IDLNR+G  L+EIV++P+MRSS EA A+   L S
Sbjct: 115 TIHLTRAHLEEDAGKSTHEGFHDKTGIDLNRAGTGLLEIVSEPEMRSSAEAVAYARVLHS 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++R++G CDGNM+EGS R D NVSV     +  GTRCE+KN+NS RFL  AI+YE  RQI
Sbjct: 175 LVRWIGICDGNMQEGSFRCDANVSVRPAGSDVLGTRCEIKNLNSFRFLERAIDYEVARQI 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ILE GG I Q+TRL+D  ++ETR++R+KEDA DYRYF +PDLLP+ I +++I+ I++++
Sbjct: 235 DILESGGSIVQQTRLYDADRDETRTMRSKEDAHDYRYFPDPDLLPVVIPQEWIKQIREKL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV--NRDKKIVANWVINDLLGV 376
           PELP+ +  R+I +F +S YDA++L + + +ADYFE+         K+ ANW+I ++ G 
Sbjct: 295 PELPEDRHNRYIRDFSLSAYDANILTAARELADYFEQTVKFLPEQIKLCANWIIGEVSGR 354

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG-TPKEIVEELGLR 435
           LN+ G  I+  P+SP QL  L+  I DGT+SGKIAKD+F+ +W+    +   I++   LR
Sbjct: 355 LNKEGLEIDQCPVSPEQLAGLLLRITDGTVSGKIAKDVFDSMWQSNDNSADTIIDAKNLR 414

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q++D S IEK V+EV+ +N   VA     K    +  VGQVMK + GKANP  V  +LK+
Sbjct: 415 QISDNSEIEKWVNEVLAANQQQVADYRAGKEKAFNSLVGQVMKMSRGKANPVQVNTLLKK 474

Query: 495 KL 496
            L
Sbjct: 475 HL 476


>gi|108759569|ref|YP_629721.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Myxococcus
           xanthus DK 1622]
 gi|122389893|sp|Q1DCA2|GATB_MYXXD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|108463449|gb|ABF88634.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Myxococcus xanthus
           DK 1622]
          Length = 479

 Score =  554 bits (1427), Expect = e-155,   Method: Composition-based stats.
 Identities = 222/480 (46%), Positives = 307/480 (63%), Gaps = 9/480 (1%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           D++ VIG+EVHAQL   SK+F G S  FGAEPN         MPG+LP+LN R  + AV 
Sbjct: 5   DFQPVIGLEVHAQLLTQSKIFCGCSTAFGAEPNRNTCPVCLGMPGVLPVLNQRVAEFAVR 64

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
           TGL L   I   SV++RKNYFYPDLP+GYQI+Q D+PI   G++ +              
Sbjct: 65  TGLALECTIRPTSVWSRKNYFYPDLPKGYQITQFDQPICEHGRLVIDTP------QGEKA 118

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           + I RIH+E+DAGKS+HD     S +DLNR+GV L+EIV++PD+R + EA  +L  +R +
Sbjct: 119 IRILRIHMEEDAGKSVHDAGGGQSLVDLNRAGVPLLEIVSQPDLRDADEAVEYLKAMRDV 178

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           L YLG  DGN+EEGS R D NVSV       +G RCE+KN+NS RFL  AIEYE  RQ+ 
Sbjct: 179 LVYLGVNDGNLEEGSFRCDANVSVMPKGSTTFGQRCELKNLNSFRFLKQAIEYEIARQVD 238

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++E GG + QETRL+D +K  TRS+R+KE+A DYRYF EPDL PL +  + I A  K +P
Sbjct: 239 VIESGGKVVQETRLWDVNKGVTRSMRSKEEAHDYRYFPEPDLPPLHVSAEAIAAAAKALP 298

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLN 378
           ELP AK +RF  ++G+  YDA +L +++ +ADYFE  A   +D K ++NW + +L+ +L 
Sbjct: 299 ELPRAKLQRFTSQYGLPAYDARILTAERPLADYFEACAGHYKDYKKLSNWFLGELMRLLK 358

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
             G  +     +P QLGEL+  +  G +S    KD+   ++  G  P +I+ E GL QV+
Sbjct: 359 EEGTPLSALRFTPAQLGELLGAVDQGMVSANAGKDVLGEMFRTGKAPADIIAEKGLAQVS 418

Query: 439 DLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           D  AIE VVD+++  N   + +    K  +  +FVGQVM+   GK NP++V ++LK+KLG
Sbjct: 419 DTGAIEAVVDDILAKNAGEIEKYRAGKKQVFGFFVGQVMRAMKGKGNPALVNELLKKKLG 478


>gi|83310683|ref|YP_420947.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Magnetospirillum
           magneticum AMB-1]
 gi|109892030|sp|Q2W6Y7|GATB_MAGMM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|82945524|dbj|BAE50388.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit
           [Magnetospirillum magneticum AMB-1]
          Length = 485

 Score =  554 bits (1427), Expect = e-155,   Method: Composition-based stats.
 Identities = 294/486 (60%), Positives = 366/486 (75%), Gaps = 7/486 (1%)

Query: 13  SLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNG 72
            +  G TGDWE+VIG+EVHAQ+   +KLFSGA+  FGAEPNTQVSF DA  PGMLP++N 
Sbjct: 3   YIIQGETGDWEIVIGLEVHAQVISKAKLFSGAATEFGAEPNTQVSFIDAGFPGMLPVINE 62

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
            CV+QAV TGLGL A IN  SVFARKNYFY DLPQGYQISQ+D+PIVGEG++ + +    
Sbjct: 63  VCVEQAVRTGLGLKAKINLTSVFARKNYFYADLPQGYQISQYDQPIVGEGELILDLPDGG 122

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKA 192
                T  VGIER+HLEQDAGKSIHD + + S IDLNRSGVALMEIV+KPD+RS  EA  
Sbjct: 123 -----TRTVGIERLHLEQDAGKSIHDMHPSKSFIDLNRSGVALMEIVSKPDLRSPEEAGL 177

Query: 193 FLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIE 251
           +LTKLRSILRYL TCDGNM+EGSMR D NVSV         TRCE+KNVNSIRF+  AIE
Sbjct: 178 YLTKLRSILRYLETCDGNMQEGSMRCDANVSVRPVGSTELRTRCEIKNVNSIRFVQQAIE 237

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
           +EARR I + E GG IRQETRLFD  K ETRS+R+KE A DYRYF +PDLLPL I++ F+
Sbjct: 238 FEARRHIDVYESGGEIRQETRLFDSVKGETRSMRSKEHAHDYRYFPDPDLLPLVIEQSFV 297

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVIN 371
             IK  +PELPD K+ RF+ E+G++ YDA VLV++K+ A++FE +A  RD K+  NWV+ 
Sbjct: 298 DGIKSGLPELPDEKKARFMAEYGLNAYDAGVLVAEKASAEFFETVAKGRDSKMACNWVMG 357

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D    LN +GK+IE+ P++   LG+LIDLI DGT+SG++AKD+F ++ E G  P  +VEE
Sbjct: 358 DFFASLNATGKTIENPPVTAANLGQLIDLIKDGTLSGRLAKDVFALMVETGKAPAVLVEE 417

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+QVTD  AIE  VD VI++NP+ V ++   K  L+ WF GQVMK+T GKANP++V +
Sbjct: 418 RGLKQVTDTGAIEAAVDAVISANPDKVQQVKDGKTALLGWFTGQVMKSTQGKANPAMVNE 477

Query: 491 MLKEKL 496
           ML +K+
Sbjct: 478 MLSKKI 483


>gi|186474826|ref|YP_001856296.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           phymatum STM815]
 gi|229486049|sp|B2JJW3|GATB_BURP8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|184191285|gb|ACC69250.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia
           phymatum STM815]
          Length = 491

 Score =  554 bits (1427), Expect = e-155,   Method: Composition-based stats.
 Identities = 234/487 (48%), Positives = 336/487 (68%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGA+  FGA PNTQ    D A+PG+LP++N   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGAATQFGAAPNTQACPVDLALPGVLPVMNKGAVERAIQF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL ++A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++    +    
Sbjct: 65  GLAIDATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKEAYEK 124

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 125 TINLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     + +GTR E+KN+NS RFL  AI+YE RRQI
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRAEIKNLNSFRFLEEAIQYEVRRQI 244

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL ID  ++  +K ++
Sbjct: 245 ELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIDASWVERVKGEL 304

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVINDLLG 375
           PELP A ++RF+ ++G++ YDA V+ + K++A Y+E +         K+ ANW++ ++  
Sbjct: 305 PELPAAMQKRFVDQYGLTPYDAGVVTAGKAMAAYYEAVVAKVGAAQAKVAANWLMGEVSS 364

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT----PKEIVEE 431
            LNR G  I D+P+S  QL  ++  I DGTIS KIAK+IF  +WE+  T       I+E 
Sbjct: 365 QLNREGLDIADSPVSAAQLALVLQRIADGTISNKIAKEIFLAIWEEKATDEAAADRIIEA 424

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP  V +
Sbjct: 425 KGLKQISDTGALEAIIDEVLAANQKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVNE 484

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 485 LLKKKLG 491


>gi|296391194|ref|ZP_06880669.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           aeruginosa PAb1]
          Length = 481

 Score =  554 bits (1427), Expect = e-155,   Method: Composition-based stats.
 Identities = 247/484 (51%), Positives = 341/484 (70%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+E+HAQL+  SK+FSG+S  FGA PNTQ S  D AMPG LP+LN   V+ A 
Sbjct: 1   MQWETVIGLEIHAQLATQSKIFSGSSTAFGAAPNTQASLVDLAMPGTLPVLNEEAVRMAC 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           + GL ++A I++ +VFARKNYFYPDLP+GYQ SQ D PIVG+G + +++         T 
Sbjct: 61  LFGLAIDARIDRQNVFARKNYFYPDLPKGYQTSQMDHPIVGKGYLDITLED-----GTTK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RS+ EA A++  + +
Sbjct: 116 RIGITRAHLEEDAGKSLHEDFQGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYLG CDGNM EGS+R D NVSV       +GTR E+KNVNS RF+  AI +E +RQI
Sbjct: 176 LVRYLGICDGNMAEGSLRCDCNVSVRPKGQAEFGTRAEIKNVNSFRFIEKAINHEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP+K+ETRS+R KE+A DYRYF  PDLLP+ I+ +++  +++Q+
Sbjct: 236 ELIEDGGKVVQETRLYDPNKDETRSMRGKEEANDYRYFPCPDLLPVVIEPEYLAKLREQL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVL 377
           PELP  KRERF  ++G+S YDASVL + + +ADYFEK+  +  D K+ ANWV+ +L  +L
Sbjct: 296 PELPVQKRERFESQYGLSAYDASVLSASREMADYFEKVQGICGDAKLAANWVMVELGSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  IE +P+S  QLG +I  I D TISGKIAK +F  +    G+  +I+E  GL+QV
Sbjct: 356 NKDGLEIEQSPVSAEQLGGMILRIKDNTISGKIAKMVFEAMANGEGSADQIIEAKGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIEK++DEV+ +N   V +        +  +  +FVGQ MK + GKANP  V ++L
Sbjct: 416 TDSGAIEKMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELL 475

Query: 493 KEKL 496
           K+KL
Sbjct: 476 KKKL 479


>gi|83718877|ref|YP_440707.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           thailandensis E264]
 gi|167579379|ref|ZP_02372253.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           thailandensis TXDOH]
 gi|167617480|ref|ZP_02386111.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           thailandensis Bt4]
 gi|257140645|ref|ZP_05588907.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           thailandensis E264]
 gi|109892011|sp|Q2T292|GATB_BURTA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|83652702|gb|ABC36765.1| glutamyl-tRNA [Burkholderia thailandensis E264]
          Length = 490

 Score =  554 bits (1427), Expect = e-155,   Method: Composition-based stats.
 Identities = 245/487 (50%), Positives = 336/487 (68%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++    Q  + 
Sbjct: 64  GLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 184 LVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQI 243

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D+I  +K ++
Sbjct: 244 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWIERVKGEM 303

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+  
Sbjct: 304 PELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAAYFEAVVAKAGAANAKIAANWLMGDVSS 363

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVEE 431
            LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G    I++ 
Sbjct: 364 QLNRDGIDIDACPVSAAQLALVLQRIADGTISNKIAKEIFVAIWDEKAADEGAADRIIDA 423

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  VGQ MK T GKANP  V +
Sbjct: 424 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALVGQAMKATKGKANPQQVNE 483

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 484 LLKKKLG 490


>gi|184159355|ref|YP_001847694.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           baumannii ACICU]
 gi|332874204|ref|ZP_08442126.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Acinetobacter baumannii 6014059]
 gi|183210949|gb|ACC58347.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit [Acinetobacter
           baumannii ACICU]
 gi|322509267|gb|ADX04721.1| gatB [Acinetobacter baumannii 1656-2]
 gi|323519295|gb|ADX93676.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           baumannii TCDC-AB0715]
 gi|332737563|gb|EGJ68468.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Acinetobacter baumannii 6014059]
          Length = 489

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 254/495 (51%), Positives = 343/495 (69%), Gaps = 15/495 (3%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           A+   L  G    WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP
Sbjct: 4   AQKLKLIDG----WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLP 59

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           +LN + V+ A+  GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +
Sbjct: 60  VLNEKVVELAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL 119

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
                    T  +G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  
Sbjct: 120 ED-----GTTKRIGVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVE 174

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           EA A++  + +++R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  
Sbjct: 175 EAVAYIKAIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQ 234

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AI  E  RQ+ ILE GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I +
Sbjct: 235 AINVEIERQMEILEWGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIPD 294

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKI 364
           + I AIK  +PELP A+R RFI +FG++ YDA VL   + +AD++E         +  KI
Sbjct: 295 EQIEAIKATMPELPAARRARFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKI 354

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGG 423
            ANWV+ +  G LN++G  + D+P+S  QLG +I  IID TISGKIAK +F  +WE +G 
Sbjct: 355 AANWVMGEFSGALNKAGLELTDSPVSAEQLGGMIARIIDNTISGKIAKQVFGFMWESEGK 414

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGK 482
           +  +I+ E GL+Q TD  AIE ++ EV+ +N   V      K    +  VGQVMK + GK
Sbjct: 415 SADDIIAEKGLKQETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGK 474

Query: 483 ANPSIVQKMLKEKLG 497
           ANP+ V +++K+ +G
Sbjct: 475 ANPAQVNELMKKLIG 489


>gi|56477144|ref|YP_158733.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Aromatoleum
           aromaticum EbN1]
 gi|81598811|sp|Q5P4D1|GATB_AZOSE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|56313187|emb|CAI07832.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Aromatoleum aromaticum EbN1]
          Length = 493

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 243/494 (49%), Positives = 328/494 (66%), Gaps = 15/494 (3%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
           +  DWEVVIG+EVHAQL+  SK+FS AS  FGAEPN Q S  D A+PG+LP+LNG  V++
Sbjct: 2   SRNDWEVVIGLEVHAQLNTASKIFSAASTAFGAEPNVQASAVDIALPGVLPVLNGGAVER 61

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           A+  G+ + A +   SVFARKNYFYPDLP+GYQISQ + P+V  G +++ +G     +  
Sbjct: 62  AIRFGVAIGATVAPKSVFARKNYFYPDLPKGYQISQFELPVVQGGAITIRVGD--GDKAY 119

Query: 138 TIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
              V + R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PDMRSS EA A+   L
Sbjct: 120 EKTVQLTRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDMRSSAEAVAYARAL 179

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
            +++R++  CDGNM+EGS R D NVSV RPG   GTR E+KN+NS RFL  AI++E + Q
Sbjct: 180 HALVRWIDICDGNMQEGSFRCDANVSVRRPGGPLGTRREIKNLNSFRFLQQAIDFEVQWQ 239

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I  +EDGG I+Q T LFDP   ETR +R+KEDA DYRYF +PDLLPL I  ++I  ++ +
Sbjct: 240 IGTIEDGGRIQQATVLFDPDTGETRMMRSKEDAHDYRYFPDPDLLPLVIPSEWIARVRSE 299

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRD-------KKIVANWVI 370
           +PELP A + RFI ++G+S YDA+ L + K IA Y++ +    D        K+ ANWV+
Sbjct: 300 MPELPGAMKARFINDYGLSAYDAASLTAAKEIAAYYQAMLATADTKPGSQVPKLGANWVM 359

Query: 371 NDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG-----TP 425
            +L   LNR+ + I D+P++P QL  L+  I DGTIS  IA+ +F  LW   G       
Sbjct: 360 GELAAQLNRAERDIGDSPVTPAQLAGLVQRIADGTISNNIARKVFAALWNGEGGSGADAA 419

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKAN 484
             I+E  GLRQV D SA+E ++DEV+ +N  +V      K    +  VGQVMK + GKAN
Sbjct: 420 DRIIEAQGLRQVNDSSALEPLIDEVLAANRKSVDEFRAGKEKAFNALVGQVMKASRGKAN 479

Query: 485 PSIVQKMLKEKLGI 498
           P+ V +MLK KL  
Sbjct: 480 PAQVNEMLKRKLDA 493


>gi|258404635|ref|YP_003197377.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfohalobium
           retbaense DSM 5692]
 gi|257796862|gb|ACV67799.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfohalobium
           retbaense DSM 5692]
          Length = 477

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 230/479 (48%), Positives = 317/479 (66%), Gaps = 9/479 (1%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+EVHAQL   SK+F   S  FG EPN+        MPG+LP+LN R V+     
Sbjct: 4   YEPVIGLEVHAQLKTASKIFCSCSTAFGREPNSNTCPVCTGMPGVLPVLNKRAVEFGAKM 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
            L +   +N  S+FARKNYFYPDLP+GYQISQ+++P+   G++S+S+G          EV
Sbjct: 64  ALAVECRVNPRSIFARKNYFYPDLPKGYQISQYEEPLAEFGRLSISMGEA------IKEV 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI RIH+E+DAGKS+H      S +DLNR+GV L+EIV++PDMRS  EA A+L  LR+IL
Sbjct: 118 GITRIHMEEDAGKSLHGTGDRTSYVDLNRTGVPLLEIVSEPDMRSPEEAVAYLKALRAIL 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            YL  CDGNMEEGS R D N+S+   G+  +GTR E+KN+NS R +  A+EYE  RQ  I
Sbjct: 178 VYLDICDGNMEEGSFRCDANISLRPQGQEAFGTRTELKNLNSFRHVQRALEYEIARQEDI 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           L+DG  + QETRLFD  K  TRS+R KE+A DYRYF +PDL+PL +DE ++     ++PE
Sbjct: 238 LDDGDAVVQETRLFDVDKGVTRSMRGKEEAHDYRYFPDPDLVPLCLDESWLTTWGAELPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANWVINDLLGVLNR 379
           LP+AKR RF+ ++ +SL DA  L  ++ +A+YFE  +A     K  ANW++ ++L  +  
Sbjct: 298 LPEAKRRRFLDDYELSLDDAQTLTGERELAEYFEAVVAAGASAKAAANWMLTEMLREIRE 357

Query: 380 SGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD 439
           +G +  +    P QL  L+DLI   TIS KIAKDI+  ++ +G  P++ V++ GL Q++D
Sbjct: 358 AGLAPGEVCFRPEQLAALLDLIEKQTISRKIAKDIYPEIFREGLDPEQYVQDKGLVQISD 417

Query: 440 LSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG 497
            SA+E VV EVI+ NP  V      K  LV +FVGQVM+ T G+ANP +V ++L ++L 
Sbjct: 418 TSALEAVVQEVIDENPAEVEAYQGGKKKLVGFFVGQVMRKTQGQANPKLVNELLAKRLD 476


>gi|323141456|ref|ZP_08076345.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Phascolarctobacterium sp. YIT 12067]
 gi|322414036|gb|EFY04866.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Phascolarctobacterium sp. YIT 12067]
          Length = 480

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 219/481 (45%), Positives = 310/481 (64%), Gaps = 13/481 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +  VIG+EVHA+L   +K F   S  FG+ PNT V      MPG LP+LN + V  A+  
Sbjct: 4   YITVIGLEVHAELKTKTKAFCSCSTAFGSLPNTHVCPVCLGMPGALPVLNKQVVDFAIKA 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL LN  I KY+ F RKNYFYPDL + YQISQ DKPI   G + + +            +
Sbjct: 64  GLALNCDIQKYNKFDRKNYFYPDLSKNYQISQFDKPICLGGHIDIVVDG------EHKRI 117

Query: 142 GIERIHLEQDAGKSIHDQ----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
           G+ RIH+E+DAGK  H       S  S +D NR+GV L+EIV++PDMRS+ EA+A++  L
Sbjct: 118 GVTRIHMEEDAGKLNHSGATISTSDSSAVDYNRAGVPLIEIVSEPDMRSAAEARAYMENL 177

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
           ++IL Y   CD  M+EGS+R D N+S+     + +GTR E+KN+NS R L  AI YE  R
Sbjct: 178 KAILEYTDVCDCKMQEGSLRCDANISIMPEGAKEFGTRAEIKNLNSFRALERAINYEVER 237

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q  +LEDGGH+ QETR +D +   T S+R+KE+A DYRYF EPDL+P+++D+ +I  I++
Sbjct: 238 QKEVLEDGGHVVQETRTWDEANGVTLSMRSKEEAHDYRYFPEPDLVPVQLDDAWIERIRE 297

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLG 375
            +PELP  ++ R + E G+  YDAS +VS K++A+YF++     +D K V+NW++ D+  
Sbjct: 298 TLPELPAQRQARLMSEHGLPEYDASQIVSTKAMAEYFDEAVKTAKDSKAVSNWLLGDVSA 357

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
            +N  G +I D  ++P  L EL++LI DG +S K+AK +F  + ++   PK +V++LGL 
Sbjct: 358 YMNNEGITIADFKVTPAHLAELVNLIKDGVLSSKLAKKVFAEMLKEDEAPKALVKKLGLE 417

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           QV+D  AI K+V+E I  NP +VA     K   + + VGQ+MK + GKANP +V KMLKE
Sbjct: 418 QVSDEGAILKLVEETIAENPQSVADYKAGKDKAIGFLVGQIMKKSRGKANPGMVTKMLKE 477

Query: 495 K 495
           K
Sbjct: 478 K 478


>gi|169632545|ref|YP_001706281.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acinetobacter
           baumannii SDF]
 gi|169151337|emb|CAP00053.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter baumannii]
          Length = 489

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 253/495 (51%), Positives = 343/495 (69%), Gaps = 15/495 (3%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           A+   L  G    WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP
Sbjct: 4   AQKLKLIDG----WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLP 59

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           +LN + V+ A+  GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +
Sbjct: 60  VLNEKVVELAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL 119

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
                    T  +G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  
Sbjct: 120 ED-----GTTKRIGVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVE 174

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           EA A++  + +++R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  
Sbjct: 175 EAIAYIKAIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQ 234

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AI  E  RQ+ ILE GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I +
Sbjct: 235 AINVEIERQMEILEWGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIPD 294

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKI 364
           + I AIK  +PELP A+R RFI +FG++ YDA VL   + +AD++E         +  KI
Sbjct: 295 EQIEAIKATMPELPAARRARFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKI 354

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGG 423
            ANWV+ +  G LN++G  + D+P+S  QLG +I  I+D TISGKIAK +F  +WE +G 
Sbjct: 355 AANWVMGEFSGALNKAGLELTDSPVSAEQLGGMIARIVDNTISGKIAKQVFGFMWESEGK 414

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGK 482
           +  +I+ E GL+Q TD  AIE ++ EV+ +N   V      K    +  VGQVMK + GK
Sbjct: 415 SADDIIAEKGLKQETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGK 474

Query: 483 ANPSIVQKMLKEKLG 497
           ANP+ V +++K+ +G
Sbjct: 475 ANPAQVNELMKKLIG 489


>gi|303326742|ref|ZP_07357184.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfovibrio sp.
           3_1_syn3]
 gi|302862730|gb|EFL85662.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfovibrio sp.
           3_1_syn3]
          Length = 478

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 227/480 (47%), Positives = 300/480 (62%), Gaps = 11/480 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E VIG+EVH QL+  SKLF   S  FG  PNT V    A MPG LP+ N + V  A + 
Sbjct: 4   YEAVIGLEVHVQLATASKLFCSCSTRFGQPPNTNVCEVCAGMPGALPVPNRQAVHYAALV 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL  N  IN+ S+FARKNYFYPDLP GYQISQ D PI   G + +        + ++  +
Sbjct: 64  GLATNCAINRRSIFARKNYFYPDLPAGYQISQFDLPICEHGHLDI------VAEGQSKRI 117

Query: 142 GIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSIL 201
           GI RIH+E DAGK+IH Q    S +DLNR+G  L+EIV++PDMRS+ EA A+L  L  I+
Sbjct: 118 GITRIHMENDAGKNIHAQGENASYVDLNRAGTPLVEIVSEPDMRSAAEAVAYLKTLYGIV 177

Query: 202 RYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
            YLG CDGNMEEGS R D NVS+      A+GTR E+KN+NS R +  AIEYE  RQ  +
Sbjct: 178 TYLGVCDGNMEEGSFRCDANVSLRPVGATAFGTRTELKNLNSFRNVQRAIEYEIARQQDV 237

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           L+DG  + QETRL+D  KN T S+R+KE+A DYRYF +PDLLP+EI+   +   + ++PE
Sbjct: 238 LDDGDSVVQETRLYDAVKNLTASMRSKEEAHDYRYFPDPDLLPVEIEAAELERWRAELPE 297

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRS 380
           LP  +  RF+   G+   +  VLV  +++AD+FE  A   D + VAN+V+  LL   N  
Sbjct: 298 LPQPRAGRFMELTGLPEAEVEVLVQSRALADFFEAAAQKADPRKVANYVLGPLLRECNAR 357

Query: 381 GKS---IEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
                      + P  L EL+ ++  G IS KIA DIF  L+  G  P+  V E GL Q+
Sbjct: 358 NVPTGDPARWAMKPEALAELVRIVDQGLISAKIANDIFGDLFSNGAMPEAYVREKGLGQI 417

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D SA+E  VD VI +NP  V      K  L+S+FVGQ+M+ T GKANP++V ++L +KL
Sbjct: 418 SDSSALEAAVDAVIAANPAEVEAYKGGKTKLISFFVGQIMRATKGKANPALVNELLNKKL 477


>gi|146305888|ref|YP_001186353.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           mendocina ymp]
 gi|166198807|sp|A4XQK5|GATB_PSEMY RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|145574089|gb|ABP83621.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Pseudomonas mendocina ymp]
          Length = 481

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 246/484 (50%), Positives = 337/484 (69%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+E+HAQLS  SK+FS ++ +FGAEPNTQ S  D  MPG LP+LN   V+ AV
Sbjct: 1   MQWETVIGLEIHAQLSTQSKIFSASATSFGAEPNTQASLIDLGMPGTLPVLNAEAVRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL ++AHI   +VFARKNYFYPDLP+GYQ SQ D PIVG+G + +++           
Sbjct: 61  KFGLAIDAHIAPQNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITLED-----GTVK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RS+ EA A++  + +
Sbjct: 116 RIGITRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYLG CDGNM EGS+R D NVSV   G+  +GTR E+KNVNS RF+  AI +E +RQI
Sbjct: 176 LVRYLGICDGNMAEGSLRCDCNVSVRPKGQEAFGTRAEIKNVNSFRFIEKAINHEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP+K+ETRS+R KE+A DYRYF  PDLLP+ I++ F+  ++ Q+
Sbjct: 236 ELIEDGGKVIQETRLYDPNKDETRSMRGKEEANDYRYFPCPDLLPVVIEQSFLDEVRSQL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELP  KRERF  ++G+S YDASVL + + +A+YFE++A    D K+ ANWV+ +L  +L
Sbjct: 296 PELPTQKRERFQSQYGLSTYDASVLSASREMAEYFEEVAKVCGDAKLAANWVMGELSSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  IE +P+S   LG +I  I D TISGKIAK +F  +    G+   I+E  GL+QV
Sbjct: 356 NKEGLEIEQSPVSAEHLGGMILRIKDNTISGKIAKMVFEAMAAGEGSADAIIESKGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIE ++DEV+ +N   V +        +  +  +FVGQ MK + GKANP  V ++L
Sbjct: 416 TDSGAIEAMLDEVLAANAEQVEQYRASDEAKRGKMFGFFVGQAMKASKGKANPGQVNELL 475

Query: 493 KEKL 496
           K+KL
Sbjct: 476 KKKL 479


>gi|110680511|ref|YP_683518.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Roseobacter
           denitrificans OCh 114]
 gi|123065373|sp|Q163L1|GATB_ROSDO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|109456627|gb|ABG32832.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Roseobacter
           denitrificans OCh 114]
          Length = 503

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 298/507 (58%), Positives = 370/507 (72%), Gaps = 17/507 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+   +  + SG   DWE+VIG+EVHAQ++  +KLFS AS  FGAEPN  VSF D
Sbjct: 1   MLDL-TYETPAPKVISGAKEDWELVIGMEVHAQVTSAAKLFSAASTQFGAEPNNNVSFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP +N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPTINEYCVEQAVRTGLGLKAEINLHSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +       V +ERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV+
Sbjct: 120 EGEVLVEMGNGTA-----RLVRVERIHLEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A+L KLR ILRYLGTC+G+M+ G+MRADVNVS+CRPG+           
Sbjct: 175 RPDIRGPEEAAAYLGKLRQILRYLGTCNGDMQSGAMRADVNVSICRPGQYEKYQATQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIE EARRQIAI+E GG + QETRL+DP +NETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIEVEARRQIAIVEAGGTVDQETRLYDPDRNETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPLEI++ ++  I   +PELPDAK+ RF  +FG+S YDASVL +D   
Sbjct: 295 AHDYRYFPDPDLLPLEIEQAWVDDIAANLPELPDAKKARFRNDFGLSDYDASVLTADLDS 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE +A  RD K+ ANWVIN+L G L +   +I D+P+SP QLG +IDLI    ISGK
Sbjct: 355 AGYFEAVAAGRDGKMAANWVINELFGRLKKEDHAITDSPVSPAQLGGIIDLIASDAISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F I +  G  P EIVE  G++QVTD  AIE  VDE+I +NP+ VA+    P L  
Sbjct: 415 IAKDVFEICYTTGRDPAEIVETEGMKQVTDTGAIEAAVDEIIAANPDQVAKARENPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKL 496
           WFVGQVMK TGGKANP +V +++ ++L
Sbjct: 475 WFVGQVMKATGGKANPKVVNQLIAKRL 501


>gi|113477297|ref|YP_723358.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Trichodesmium
           erythraeum IMS101]
 gi|123056281|sp|Q10XY9|GATB_TRIEI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|110168345|gb|ABG52885.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Trichodesmium erythraeum IMS101]
          Length = 494

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 224/486 (46%), Positives = 312/486 (64%), Gaps = 9/486 (1%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
              +E +IG+E H QLS  +K+FS +S  FGA PNT +      MPG+LP+LN + ++ A
Sbjct: 8   KTKYEAIIGLETHCQLSTQTKIFSNSSTEFGATPNTNIDPICMGMPGVLPVLNEKVLEYA 67

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           V  GL LN  I  YS F RK YFYPDLP+ YQISQ+D PI   G + + I  ++ G    
Sbjct: 68  VKAGLALNCEIALYSKFDRKQYFYPDLPKNYQISQYDLPIAEHGWLEIEI-VEEDGNATR 126

Query: 139 IEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
            ++GI R+H+E+DAGK +H        S  S +D NR+GV L+EIV++PD+RS +EA  +
Sbjct: 127 KKIGITRLHMEEDAGKLVHGGSDRLSGSTYSMVDYNRAGVPLIEIVSEPDIRSGIEAAEY 186

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEY 252
             +LR I+RYLG  DGNM+EGS+R DVNVSV     + +GT+ E+KN+NS   +  AIEY
Sbjct: 187 AQELRRIVRYLGVSDGNMQEGSLRCDVNVSVRPVGQKEFGTKVEIKNMNSFSAIQRAIEY 246

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           E  RQ   +E G  I QETRL++ +   T S+RTKE + DYRYF EPD+ P+E+    + 
Sbjct: 247 EIERQTEAIETGEKIIQETRLWEEASQCTVSMRTKEGSSDYRYFPEPDIPPIEVSTQQLD 306

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANWVIN 371
             K ++PELP  KR  +  + G+S YD  VL  D ++A YFE  +A   + K VANWV+ 
Sbjct: 307 TWKAELPELPAQKRYLYESKLGLSAYDTRVLTDDFNVAKYFEAAVAAGGNSKQVANWVMG 366

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D+   L     SI D  + P+ L EL+ +I DGTISGKIAKDI   L  KGG+PKE+VE+
Sbjct: 367 DITAFLKNEKISINDITLKPDNLAELVTIIDDGTISGKIAKDILPELLSKGGSPKELVEK 426

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL Q++D+ AIE ++DEV+ ++P  +A+    K  L  +FVGQVMK T G+A+P +  +
Sbjct: 427 KGLIQISDIKAIEAIIDEVLAAHPEELAKYRGGKTKLKGFFVGQVMKKTQGRADPKMTNQ 486

Query: 491 MLKEKL 496
           ++ +KL
Sbjct: 487 LISKKL 492


>gi|193078236|gb|ABO13196.2| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter baumannii ATCC 17978]
          Length = 489

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 252/495 (50%), Positives = 343/495 (69%), Gaps = 15/495 (3%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           A+   L  G    WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP
Sbjct: 4   AQKLKLIDG----WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLP 59

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           +LN + V+ A+  GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +
Sbjct: 60  VLNEKVVELAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL 119

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
                    T  +G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  
Sbjct: 120 ED-----GTTKRIGVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVE 174

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           EA A++  + +++R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  
Sbjct: 175 EAVAYIKAIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQ 234

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AI  E  RQ+ ILE GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I +
Sbjct: 235 AINVEIERQMEILEWGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIPD 294

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKI 364
           + I AIK  +PELP A+R RFI +FG++ YDA VL   + +AD++E         +  KI
Sbjct: 295 EQIEAIKATMPELPAARRARFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKI 354

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGG 423
            ANWV+ +  G LN++G  + D+P+S  QLG +I  I+D TISGKIAK +F  +WE +G 
Sbjct: 355 AANWVMGEFSGALNKAGLELTDSPVSAEQLGGMIARIVDNTISGKIAKQVFGFMWESEGK 414

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGK 482
           +  +I+ E GL+Q TD  AIE ++ +V+ +N   V      K    +  VGQVMK + GK
Sbjct: 415 SADDIIAEKGLKQETDTGAIEAIIKDVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGK 474

Query: 483 ANPSIVQKMLKEKLG 497
           ANP+ V +++K+ +G
Sbjct: 475 ANPAQVNELMKKLIG 489


>gi|297528699|ref|YP_003669974.1| glutamyl-tRNA(Gln) amidotransferase subunit beta [Geobacillus sp.
           C56-T3]
 gi|297251951|gb|ADI25397.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacillus sp.
           C56-T3]
          Length = 476

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 217/481 (45%), Positives = 309/481 (64%), Gaps = 10/481 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVH +L   SK+FS +   FGA PNTQ +  D   PG+LP+LN + V+ A+
Sbjct: 1   MNFETVIGLEVHVELKTKSKIFSSSPNAFGAPPNTQTNVIDLGYPGVLPVLNRQAVEFAM 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              + LN  I   + F RKNYFYPD P+ YQISQ+D+P+   G + + +   K       
Sbjct: 61  KAAMALNCEIATETKFDRKNYFYPDNPKAYQISQYDQPLGKNGWIEIEVNGKK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           ++GI RIHLE+DAGK  H      S +D NR G  L+EIV++PD+RS  EA A+L KL++
Sbjct: 115 KIGITRIHLEEDAGKLTHTGD-GYSLVDFNRQGTPLIEIVSEPDIRSPEEAYAYLEKLKA 173

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I++Y G  D  MEEGS+R D N+S+     + +GT+ E+KN+NS  F+ + +EYEA+RQ 
Sbjct: 174 IIQYTGVSDCKMEEGSLRCDANISLRPIGSDQFGTKTELKNLNSFNFVRMGLEYEAKRQE 233

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            IL  GG IRQETR FD +   T  +R KE + DYRYF EPDL+ L ID+++   ++  I
Sbjct: 234 KILLSGGVIRQETRRFDEATKTTVLMRVKEGSEDYRYFPEPDLVMLYIDDEWKERVRASI 293

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELPDA+R+R++ E+G+  YDA VL   K +AD+FE       D K+ +NW++ ++ G L
Sbjct: 294 PELPDARRKRYVEEWGLPEYDAKVLTLTKEMADFFEATVANGADPKLASNWLMVEVSGYL 353

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N   K + D  ++P  L  +I LI +GTIS KIAK +F  L E GG P+ IV+E GL Q+
Sbjct: 354 NAEQKELHDIALTPESLAGMIKLIQNGTISSKIAKKVFKELVEHGGDPERIVKEKGLVQI 413

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D  A+ K+V EV+++NP +V      K   + + VGQVMK T G+ANP +V K+L E++
Sbjct: 414 SDEGALRKIVLEVLDANPQSVEDYKNGKDRALGFLVGQVMKATKGQANPPLVNKLLVEEI 473

Query: 497 G 497
           G
Sbjct: 474 G 474


>gi|121533511|ref|ZP_01665339.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermosinus
           carboxydivorans Nor1]
 gi|121308070|gb|EAX48984.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermosinus
           carboxydivorans Nor1]
          Length = 477

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 218/483 (45%), Positives = 314/483 (65%), Gaps = 12/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            D+E+VIG+EVH +L   SK+F G S  FGAE NT V      +PG+LP+LN + ++ A+
Sbjct: 1   MDYEIVIGLEVHTELKTNSKIFCGCSTKFGAEQNTNVCPVCLGLPGVLPVLNQKVLEFAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
            TGL LN  I  +S F RKNY+YPDLP+ YQISQ+D PI   G + + +           
Sbjct: 61  RTGLALNCQILPFSKFDRKNYYYPDLPKNYQISQYDLPIAVNGYLDIEVNG------EVK 114

Query: 140 EVGIERIHLEQDAGKSIHDQ---YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            +GI R+H+E+DAGK +H      +  + +D NR+GV L+EIV++PD+RS  EAKA+L K
Sbjct: 115 RIGITRVHMEEDAGKLVHAGTIANADYALVDYNRTGVPLLEIVSEPDIRSPEEAKAYLEK 174

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L++IL+Y+   D  MEEGS+R D N+S+       +GT+ E+KN+NS R +   +EYEA 
Sbjct: 175 LKAILQYIDVSDCKMEEGSLRCDANISLRPRGSAQFGTKTEIKNLNSFRAVQRGLEYEAA 234

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQ  IL++GG I QETR +D  +  T SLR+KE A DYRYF +PDL+P+ +D  ++  I+
Sbjct: 235 RQAQILDEGGTIVQETRSWDEGRGITLSLRSKEQAHDYRYFPDPDLVPIVVDPAWVEEIR 294

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR-DKKIVANWVINDLL 374
           + +PELPDA+++R +  +G+S YDA ++ + +++ADYF+ +  +  D K  ANW++ ++ 
Sbjct: 295 RSLPELPDARKKRLMDSYGLSAYDADIITASRAMADYFDAVVAHEVDPKAAANWLMGEVA 354

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
             LN     I D PI P  L  ++ LI  GTISGKIAK +F  +W  G   + IV+E GL
Sbjct: 355 KHLNAQNIDITDCPIKPQDLAGMLKLIDKGTISGKIAKTVFEEMWTSGKDAETIVKEKGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            Q+TD SAI  VV+ VI +NP +VA     K   + + VGQVMK T G+ANP +V K+L+
Sbjct: 415 VQITDESAIVAVVEAVIAANPQSVADYKAGKERALGFLVGQVMKQTKGRANPELVNKLLR 474

Query: 494 EKL 496
           E+L
Sbjct: 475 ERL 477


>gi|167717546|ref|ZP_02400782.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei DM98]
          Length = 490

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 245/487 (50%), Positives = 337/487 (69%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGA+PNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + A +   SVFARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++    Q  + 
Sbjct: 64  GLAIGATVAPRSVFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 184 LVMWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQI 243

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D+I  +K ++
Sbjct: 244 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGTDWIARVKGEM 303

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK---LAVNRDKKIVANWVINDLLG 375
           PELP A ++RF+ ++G+S YDA VL S K++A+YFE     A   + K+ ANW++ D+  
Sbjct: 304 PELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAEYFEALVAKAGAANAKLAANWLMGDVSS 363

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVEE 431
            LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G    I+E 
Sbjct: 364 QLNRDGIDIDACPVSAAQLALVLQRIADGTISNKIAKEIFVTIWDEKAADEGAADRIIEA 423

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  VGQ MK T GKANP  V +
Sbjct: 424 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKDKAFNALVGQAMKATKGKANPQQVNE 483

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 484 LLKKKLG 490


>gi|157828067|ref|YP_001494309.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|166198816|sp|A8GQX6|GATB_RICRS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|157800548|gb|ABV75801.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           rickettsii str. 'Sheila Smith']
          Length = 483

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 267/483 (55%), Positives = 345/483 (71%), Gaps = 6/483 (1%)

Query: 15  TSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRC 74
             G TG WE VIG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  C
Sbjct: 4   IEGNTGKWEYVIGLEIHAQISSKSKLFSGSSTIFAANPNSQVSYIDAAMPGMLPVLNKHC 63

Query: 75  VQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSG 134
           V QA+ TGLGL A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +        
Sbjct: 64  VHQAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEIPT-----S 118

Query: 135 QFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFL 194
                 + I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+
Sbjct: 119 TGDLKTIRINRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPEEAAEFV 178

Query: 195 TKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEA 254
            KLR++LRY+G+CDG+ME+GSMR D N+SV R GE  GTRCE+KN+NSIR +  AIE+EA
Sbjct: 179 KKLRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIIKAIEFEA 238

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           +RQ+ +LE G  I QETRLF+    ETR++R KE+ALDYRYF +PDLLPL I ++ I  +
Sbjct: 239 KRQVDLLESGEEIIQETRLFNADSGETRTMRLKEEALDYRYFPDPDLLPLVISDELINEL 298

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLL 374
           K  +PELPD K E++  EF +S YDA V+V+D+S+A+YFEK A   + K++ NW+ ++L 
Sbjct: 299 KANLPELPDQKIEKYTKEFSLSKYDAEVIVADESVAEYFEKAANECNPKMLTNWLTSELF 358

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
           G LN++   I +  I+P+   +L+ LI + TISGKIAK +F I++E G  P +I+EE GL
Sbjct: 359 GQLNKASIGINECKITPSNFAKLVKLIENDTISGKIAKTVFEIMFETGKAPDKIIEEKGL 418

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            QV+D + +  V+DEVI  NP +V      K  L  +FVGQVMK T GKANP++V ++LK
Sbjct: 419 VQVSDNNVLNTVIDEVIAENPESVEGYRSGKDKLFGFFVGQVMKKTDGKANPTLVNQLLK 478

Query: 494 EKL 496
           EKL
Sbjct: 479 EKL 481


>gi|293610984|ref|ZP_06693283.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826636|gb|EFF85002.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 489

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 251/495 (50%), Positives = 341/495 (68%), Gaps = 15/495 (3%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           A+   L  G    WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP
Sbjct: 4   AQKLKLIDG----WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLVDLAMPGVLP 59

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           +LN + V  A+  GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +
Sbjct: 60  VLNEKVVDLAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL 119

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
                    T  +G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  
Sbjct: 120 ED-----GTTKRIGVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVE 174

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           EA A++  + +++R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  
Sbjct: 175 EAVAYIKAIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQ 234

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AI  E  RQ+ ILE GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I +
Sbjct: 235 AINVEIERQMEILEYGGSIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIAD 294

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKI 364
           + I A +  +PELP A+R RFI +FG++ YDA VL   + +AD++E         +  K+
Sbjct: 295 EQIEAARAALPELPAARRARFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKV 354

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGG 423
            ANWV+ +  G LN++G  + D+P+S  QLG +I  IID TISGKIAK +F  +WE +G 
Sbjct: 355 SANWVMGEFSGALNKAGLDLADSPVSAEQLGGMIARIIDNTISGKIAKQVFGFMWESEGK 414

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGK 482
           +  +I+ E GL+Q TD  AIE ++ EV+ +N   V      K    +  VGQVMK + GK
Sbjct: 415 SADDIIAEKGLKQETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGK 474

Query: 483 ANPSIVQKMLKEKLG 497
           ANP+ V +++K+ +G
Sbjct: 475 ANPAQVNELMKKLIG 489


>gi|107099931|ref|ZP_01363849.1| hypothetical protein PaerPA_01000952 [Pseudomonas aeruginosa PACS2]
 gi|116052516|ref|YP_792829.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|313107071|ref|ZP_07793272.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           39016]
 gi|122257477|sp|Q02GV7|GATB_PSEAB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|115587737|gb|ABJ13752.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|310879774|gb|EFQ38368.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           39016]
          Length = 481

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 247/484 (51%), Positives = 341/484 (70%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+E+HAQL+  SK+FSG+S  FGA PNTQ S  D AMPG LP+LN   V+ A 
Sbjct: 1   MQWETVIGLEIHAQLATQSKIFSGSSTAFGAAPNTQASLVDLAMPGTLPVLNEEAVRMAC 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           + GL ++A I++ +VFARKNYFYPDLP+GYQ SQ D PIVG+G + +++         T 
Sbjct: 61  LFGLAIDARIDRQNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITLED-----GTTK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RS+ EA A++  + +
Sbjct: 116 RIGITRAHLEEDAGKSLHEDFQGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYLG CDGNM EGS+R D NVSV       +GTR E+KNVNS RF+  AI +E +RQI
Sbjct: 176 LVRYLGICDGNMAEGSLRCDCNVSVRPKGQAEFGTRAEIKNVNSFRFIEKAINHEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP+K+ETRS+R KE+A DYRYF  PDLLP+ I+ +++  +++Q+
Sbjct: 236 ELIEDGGKVVQETRLYDPNKDETRSMRGKEEANDYRYFPCPDLLPVVIEPEYLAKLREQL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVL 377
           PELP  KRERF  ++G+S YDASVL + + +ADYFEK+  +  D K+ ANWV+ +L  +L
Sbjct: 296 PELPVQKRERFESQYGLSAYDASVLSASREMADYFEKVQGICGDAKLAANWVMVELGSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  IE +P+S  QLG +I  I D TISGKIAK +F  +    G+  +I+E  GL+QV
Sbjct: 356 NKDGLEIEQSPVSAEQLGGMILRIKDNTISGKIAKMVFEAMANGEGSADQIIEAKGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIEK++DEV+ +N   V +        +  +  +FVGQ MK + GKANP  V ++L
Sbjct: 416 TDSGAIEKMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELL 475

Query: 493 KEKL 496
           K+KL
Sbjct: 476 KKKL 479


>gi|329851414|ref|ZP_08266171.1| glutamyl-tRNA and/or aspartyl-tRNA amidotransferase, B subunit
           [Asticcacaulis biprosthecum C19]
 gi|328840260|gb|EGF89832.1| glutamyl-tRNA and/or aspartyl-tRNA amidotransferase, B subunit
           [Asticcacaulis biprosthecum C19]
          Length = 496

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 289/500 (57%), Positives = 367/500 (73%), Gaps = 8/500 (1%)

Query: 2   VSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDA 61
             LD   A +     G TG WE++IG+EVHAQ++  +KLFSGA V FGA PN QVS  DA
Sbjct: 3   NDLDIRPADASKFIQGRTGPWELIIGLEVHAQVASNTKLFSGAKVGFGAGPNEQVSLVDA 62

Query: 62  AMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGE 121
           AMPGMLP+LN  CV+QAV TGLGL A IN++S F RKNYFYPDLPQGYQISQ   PIVGE
Sbjct: 63  AMPGMLPVLNRFCVEQAVKTGLGLKAQINRHSRFDRKNYFYPDLPQGYQISQLFHPIVGE 122

Query: 122 GKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTK 181
           G+V V +         TI V IER+HLEQDAGKSIHD     + +DLNR+G ALMEIV+K
Sbjct: 123 GEVLVELDDT------TITVRIERLHLEQDAGKSIHDIDPVATYVDLNRAGTALMEIVSK 176

Query: 182 PDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVN 241
           PDMRSS EA A+  KLR+IL YLGTCDG+ME+G+MRAD NVSV RPGE  GTRCE+KNVN
Sbjct: 177 PDMRSSDEAVAYFKKLRTILIYLGTCDGDMEKGNMRADCNVSVRRPGEKLGTRCEIKNVN 236

Query: 242 SIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDL 301
           S RF+  AIE+EARRQI +LEDGG I QETRLFD +K ETRS+R+KE+A DYRYF +PDL
Sbjct: 237 SFRFMQQAIEFEARRQIEVLEDGGSIIQETRLFDATKVETRSMRSKEEAHDYRYFPDPDL 296

Query: 302 LPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRD 361
           LPLEI+E +I  I++ + ELPD K+ RF+ ++G+S YDA VL+SD++ A+Y+E+ A  RD
Sbjct: 297 LPLEIEEAWIEEIRQHLVELPDDKKARFVSQYGLSGYDAGVLISDQARAEYYEQAAKGRD 356

Query: 362 KKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK 421
            K+VANWV N LL  L  +G+ I D+P+ P  +  L++LI    IS KIAK +F  +W++
Sbjct: 357 AKLVANWVTNGLLSRLAEAGQDIADSPLPPEHISGLVELIETKVISSKIAKQVFEHMWDE 416

Query: 422 GG--TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNT 479
            G  TP EIV++  L+   D  A++K +D++I +N +  A + TKP  + WFVGQVM+ T
Sbjct: 417 KGILTPAEIVDKHDLKTDNDTGALDKAIDDLIAANADKAAEVMTKPQALGWFVGQVMRAT 476

Query: 480 GGKANPSIVQKMLKEKLGIK 499
            GKA+P+ V  +LK KLG++
Sbjct: 477 QGKADPATVNALLKAKLGVE 496


>gi|89896631|ref|YP_520118.1| aspartyl/glutamyl-tRNA amidotransferase subunit B
           [Desulfitobacterium hafniense Y51]
 gi|219667573|ref|YP_002458008.1| aspartyl/glutamyl-tRNA amidotransferase subunit B
           [Desulfitobacterium hafniense DCB-2]
 gi|89336079|dbj|BAE85674.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219537833|gb|ACL19572.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfitobacterium
           hafniense DCB-2]
          Length = 484

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 206/482 (42%), Positives = 302/482 (62%), Gaps = 14/482 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           +E+V G+EVH +L+  +K+F   S  FG E NT V      +PG+LP+LN   V  A+  
Sbjct: 7   YEMVCGVEVHVELATKTKIFCNCSTEFGGEQNTHVCPVCLGLPGVLPVLNREVVNLAIKA 66

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEV 141
           GL LN  I  +S F RKNYFYPD P+ +Q SQ+D PI   G +  ++  +K        V
Sbjct: 67  GLALNCDIADFSKFDRKNYFYPDAPKNFQTSQYDLPICKNGWLEFAVDGEK------KRV 120

Query: 142 GIERIHLEQDAGKSIHDQ----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKL 197
           GI R H+E DAGK +H       S  S +D NR+GV L+EIV++PDMRS  E  +FL ++
Sbjct: 121 GITRAHMEDDAGKLVHSGATISTSEESFVDYNRTGVPLLEIVSEPDMRSIAEVVSFLEEM 180

Query: 198 RSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARR 256
              ++Y    D  ME+GS+R D+NVS+     + +GTR E KN+NS   +   +EYE  R
Sbjct: 181 VRTIQYTEVSDCRMEQGSVRFDINVSLRPHGQKEFGTRTETKNLNSFSSVRRCLEYEIER 240

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           Q  +L+DG  + QETR +D  K  T SLR+KE+A DYRYF EPDL+PL I  +++  I++
Sbjct: 241 QARLLDDGEKVIQETRTWDEGKGVTLSLRSKEEAHDYRYFPEPDLVPLVIAREWVEEIRQ 300

Query: 317 QIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLG 375
            +PE+P A+RER+    G++ YDA VL + K+++D+F++      D K +ANWV+ +   
Sbjct: 301 TLPEMPGARRERYQS-LGLTEYDAGVLTAAKALSDFFDEALQSYSDAKALANWVMGEFTR 359

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLR 435
           +LN    S+E++P+ P+QL EL+ LI  G ISGKI K +   ++E G  P+ I++E GL 
Sbjct: 360 LLNAKQISVEESPVRPSQLAELLTLIEKGAISGKIGKTVIEAMFESGKDPEVIIKEKGLA 419

Query: 436 QVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKE 494
           Q++D +A+ K+VDEVI ++P +V      K   + + VGQ+MK T G+ANP +V  +LKE
Sbjct: 420 QISDTAALLKLVDEVIAAHPQSVEDYKAGKDRAIGFLVGQIMKATKGQANPGVVNDLLKE 479

Query: 495 KL 496
           +L
Sbjct: 480 QL 481


>gi|76809058|ref|YP_331783.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei 1710b]
 gi|126440871|ref|YP_001057226.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei 668]
 gi|126453954|ref|YP_001064467.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei 1106a]
 gi|134284076|ref|ZP_01770770.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 305]
 gi|167822203|ref|ZP_02453674.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei 9]
 gi|167843797|ref|ZP_02469305.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei B7210]
 gi|167900791|ref|ZP_02487996.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei NCTC 13177]
 gi|217425074|ref|ZP_03456570.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 576]
 gi|226194639|ref|ZP_03790234.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei Pakistan 9]
 gi|237810364|ref|YP_002894815.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei MSHR346]
 gi|242315865|ref|ZP_04814881.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 1106b]
 gi|254182231|ref|ZP_04888828.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 1655]
 gi|254188158|ref|ZP_04894670.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei Pasteur 52237]
 gi|254196380|ref|ZP_04902804.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei S13]
 gi|254259364|ref|ZP_04950418.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 1710a]
 gi|254295729|ref|ZP_04963186.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 406e]
 gi|109892009|sp|Q3JXC0|GATB_BURP1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|166217742|sp|A3NQ46|GATB_BURP0 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|166217743|sp|A3N4F5|GATB_BURP6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|76578511|gb|ABA47986.1| glutamyl-tRNA amidotransferase subunit B [Burkholderia pseudomallei
           1710b]
 gi|126220364|gb|ABN83870.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 668]
 gi|126227596|gb|ABN91136.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 1106a]
 gi|134244528|gb|EBA44632.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 305]
 gi|157805920|gb|EDO83090.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 406e]
 gi|157935838|gb|EDO91508.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei Pasteur 52237]
 gi|169653123|gb|EDS85816.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei S13]
 gi|184212769|gb|EDU09812.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 1655]
 gi|217392094|gb|EEC32120.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 576]
 gi|225933340|gb|EEH29332.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei Pakistan 9]
 gi|237504535|gb|ACQ96853.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei MSHR346]
 gi|242139104|gb|EES25506.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 1106b]
 gi|254218053|gb|EET07437.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia pseudomallei 1710a]
          Length = 490

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 245/487 (50%), Positives = 337/487 (69%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGA+PNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + A +   SVFARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++    Q  + 
Sbjct: 64  GLAIGATVAPRSVFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 184 LVMWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQI 243

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D+I  +K ++
Sbjct: 244 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWIARVKGEM 303

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK---LAVNRDKKIVANWVINDLLG 375
           PELP A ++RF+ ++G+S YDA VL S K++A+YFE     A   + K+ ANW++ D+  
Sbjct: 304 PELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAEYFEALVAKAGAANAKLAANWLMGDVSS 363

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVEE 431
            LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G    I+E 
Sbjct: 364 QLNRDGIDIDACPVSAAQLALVLQRIADGTISNKIAKEIFVTIWDEKAADEGAADRIIEA 423

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  VGQ MK T GKANP  V +
Sbjct: 424 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKDKAFNALVGQAMKATKGKANPQQVNE 483

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 484 LLKKKLG 490


>gi|262378969|ref|ZP_06072126.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter radioresistens SH164]
 gi|262300254|gb|EEY88166.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter radioresistens SH164]
          Length = 491

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 249/493 (50%), Positives = 338/493 (68%), Gaps = 14/493 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
              +L  G    WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+
Sbjct: 8   PKSNLIDG----WEVVIGIEIHTQLATKSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPV 63

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           LN   V  A+  GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + + 
Sbjct: 64  LNKEVVDLAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQLE 123

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
                      +G+ R HLE+DAGKSIHDQ+  +S IDLNR+G  L+EIV++PDMRS  E
Sbjct: 124 D-----GTVKRIGVTRAHLEEDAGKSIHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEE 178

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           A A++  + +++R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  A
Sbjct: 179 AVAYIKAIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQA 238

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           I  E  RQ+ ILE  G I QETRLFDP K ETRS+R+KE+A DYRYF +PDLLP+ I ++
Sbjct: 239 INVEIERQMEILEWDGTIDQETRLFDPVKMETRSMRSKEEANDYRYFPDPDLLPVIIADE 298

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV----NRDKKIV 365
            I AIK  +PELP A+R RF+ +FG++ YDA VL   + +++++E++          KI 
Sbjct: 299 QIEAIKATMPELPAARRARFVADFGMTEYDAHVLTLTREMSEFYEEVVKAAGGAAQGKIA 358

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ANWV+ +  G LN++G  + D+P+S  +LG +I  I+D TISGKIAK +F  +WE+G T 
Sbjct: 359 ANWVMGEFSGALNKAGLDLADSPVSAEKLGGMIARIVDNTISGKIAKQVFGFMWEEGKTA 418

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKAN 484
            EI+ E GL+Q TD  AIE ++ EV+ +N   V      K    +  VGQVMK + GKAN
Sbjct: 419 DEIIAEKGLKQETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGKAN 478

Query: 485 PSIVQKMLKEKLG 497
           P+ V +++K+ +G
Sbjct: 479 PAQVNELMKKLIG 491


>gi|134093454|ref|YP_001098529.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Herminiimonas
           arsenicoxydans]
 gi|166217764|sp|A4G1L3|GATB_HERAR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|133737357|emb|CAL60400.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           (Asp/Glu-ADT subunit B) [Herminiimonas arsenicoxydans]
          Length = 486

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 235/486 (48%), Positives = 329/486 (67%), Gaps = 11/486 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E H QL+  +K+FSG+   FGA PNTQ S  D A+PG LP++N   V++A+
Sbjct: 1   MQWEVVIGLETHTQLTTKTKIFSGSPTRFGAAPNTQTSPVDLALPGALPVMNRSAVERAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I  YSVFARKNYFYPDLP+GYQISQ D PIV  G+VS ++  D   + R+ 
Sbjct: 61  QFGLAIGATIAPYSVFARKNYFYPDLPKGYQISQMDLPIVQGGRVSFAMEVDGKTEIRS- 119

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ Y  ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L +
Sbjct: 120 -VQLTRAHLEEDAGKSLHEDYHGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKALHT 178

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ ++G CDGNM+EGS R D NVSV     + +GTRCE+KN+NS RF+  AI YE RRQI
Sbjct: 179 LVTWIGICDGNMQEGSFRCDANVSVRPVGQKEYGTRCEIKNLNSFRFMEDAINYEVRRQI 238

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + Q TRL+DP K ETR +R+KE+A DYRYF +PDL PL +  ++I  ++ ++
Sbjct: 239 ELIEDGGRVVQATRLYDPDKKETREMRSKENAHDYRYFPDPDLPPLVVSAEWITRVQAEM 298

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYF---EKLAVNRDKKIVANWVINDLLG 375
           PELP A RERF  E+G+S YDA+VL   K++A+YF     +A +   K  AN ++ D+  
Sbjct: 299 PELPGAMRERFTREYGLSDYDAAVLTQSKAMANYFELICSIAGHEQAKPAANLLMGDVAS 358

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT----PKEIVEE 431
            +NR G  ++  P+S  QL  L+  I DGTIS KIAK++F  +WE          E++E 
Sbjct: 359 AVNRDGIELDAAPVSAAQLAVLLHRIADGTISNKIAKEVFGAMWEAKSDSPTIADELIES 418

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+EK+VD+V+ +N  +V      K   ++  +GQ MK + GKANP+ + +
Sbjct: 419 KGLKQISDSGALEKIVDDVLAANTKSVEEFRAGKEQAINALMGQAMKASKGKANPAQLTE 478

Query: 491 MLKEKL 496
           +LK+KL
Sbjct: 479 LLKKKL 484


>gi|261418611|ref|YP_003252293.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Geobacillus sp.
           Y412MC61]
 gi|319765426|ref|YP_004130927.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacillus sp.
           Y412MC52]
 gi|261375068|gb|ACX77811.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacillus sp.
           Y412MC61]
 gi|317110292|gb|ADU92784.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacillus sp.
           Y412MC52]
          Length = 476

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 218/481 (45%), Positives = 309/481 (64%), Gaps = 10/481 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVH +L   SK+FS +   FGA PNTQ +  D   PG+LP+LN + V+ A+
Sbjct: 1   MNFETVIGLEVHVELKTKSKIFSSSPNAFGAPPNTQTNVIDLGYPGVLPVLNRQAVEFAM 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              + LN  I   + F RKNYFYPD P+ YQISQ+D+P+   G + + +   K       
Sbjct: 61  KAAMALNCEIATETKFDRKNYFYPDNPKAYQISQYDQPLGKNGWIEIEVNGKK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           ++GI RIHLE+DAGK  H      S +D NR G  L+EIV++PD+RS  EA A+L KL++
Sbjct: 115 KIGITRIHLEEDAGKLTHTGD-GYSLVDFNRQGTPLIEIVSEPDIRSPEEAYAYLEKLKA 173

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I++Y G  D  MEEGS+R D N+S+     + +GT+ E+KN+NS  F+ + +EYEA+RQ 
Sbjct: 174 IIQYTGVSDCKMEEGSLRCDANISLRPIGSDKFGTKTELKNLNSFNFVRMGLEYEAKRQE 233

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            IL  GG IRQETR FD +   T  +R KE + DYRYF EPDL+ L ID+++   ++  I
Sbjct: 234 KILLSGGVIRQETRRFDEATKTTVLMRVKEGSEDYRYFPEPDLVMLYIDDEWKERVRASI 293

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELPDA+R+R+I E+G+  YDA VL   K +AD+FE       D K+ +NW++ ++ G L
Sbjct: 294 PELPDARRKRYIEEWGLPEYDAKVLTLTKEMADFFEATVANGADPKLASNWLMVEVSGYL 353

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N   K + D  ++P  L  +I LI +GTIS KIAK +F  L E GG P+ IV+E GL Q+
Sbjct: 354 NAEQKELHDIALTPESLAGMIKLIQNGTISSKIAKKVFKELVEHGGDPERIVKEKGLVQI 413

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D  A+ K+V EV+++NP +V      K   + + VGQVMK T G+ANP +V K+L E++
Sbjct: 414 SDEGALRKIVLEVLDANPQSVEDYKNGKDRALGFLVGQVMKATKGQANPPLVNKLLVEEI 473

Query: 497 G 497
           G
Sbjct: 474 G 474


>gi|332186740|ref|ZP_08388482.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Sphingomonas sp. S17]
 gi|332013073|gb|EGI55136.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Sphingomonas sp. S17]
          Length = 493

 Score =  553 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 276/492 (56%), Positives = 357/492 (72%), Gaps = 8/492 (1%)

Query: 11  SESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPIL 70
           SE    G +G+WEVVIG+EVHAQ++  +KLFSGA+  FGAEPNTQVS  DAAMPGMLP+ 
Sbjct: 2   SEYRIQGASGEWEVVIGLEVHAQVTSNAKLFSGAATAFGAEPNTQVSLVDAAMPGMLPVP 61

Query: 71  NGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP 130
           N  C++QAV TG+ ++A INK+S F RKNYFY DLPQGYQISQ   P+VGEG + +S+  
Sbjct: 62  NMECIRQAVRTGMAIDAQINKWSRFDRKNYFYADLPQGYQISQLYHPLVGEGAIEISL-D 120

Query: 131 DKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEA 190
           +K+    T  +G+ERIH+EQDAGK +HDQ+   S +DLNRSGVALMEIV++PDMRS  EA
Sbjct: 121 EKNPDGPTKSIGVERIHVEQDAGKLMHDQHPTRSYVDLNRSGVALMEIVSRPDMRSPAEA 180

Query: 191 KAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAI 250
            A+L KLR+ILRY+G+CDGNMEEGSMRADVNVSV + G+ +GTR E KNVNS+RF+  AI
Sbjct: 181 GAYLRKLRAILRYVGSCDGNMEEGSMRADVNVSVRKVGDEFGTRTETKNVNSVRFVMAAI 240

Query: 251 EYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDF 310
           EYEA+RQ+A+LEDGG I QETRLF+     TRS+R+KEDA DYRYF +PDLLPLE+ + F
Sbjct: 241 EYEAKRQVAVLEDGGKIVQETRLFNVESGTTRSMRSKEDAHDYRYFPDPDLLPLELTDAF 300

Query: 311 IRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-----NRDKKIV 365
           +   +  +PELPDAKR R+    G++ Y+A VL ++   A +F+ L       +      
Sbjct: 301 VEECRASLPELPDAKRRRYEA-LGLTAYNAGVLTAEVETARWFDALLEALEGTSAKPAQA 359

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ANWV  +L G LNR GK I ++P+SP Q  EL+ L+ DGT+SG ++K +F I+ E G  P
Sbjct: 360 ANWVAAELFGALNRLGKDITESPVSPAQAAELLALVADGTLSGSLSKQVFEIMLETGDGP 419

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKAN 484
            +IVEE GL+Q +D  AIE V+ EV+  NPN + +    K  L  +FVGQ MK  GGKAN
Sbjct: 420 SKIVEERGLKQTSDTGAIEAVIAEVLEKNPNQLGQYRAGKEALFGFFVGQTMKAMGGKAN 479

Query: 485 PSIVQKMLKEKL 496
           P++V  +LK+ L
Sbjct: 480 PAVVNDLLKKAL 491


>gi|330958035|gb|EGH58295.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. maculicola str. ES4326]
          Length = 481

 Score =  553 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 245/484 (50%), Positives = 338/484 (69%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV
Sbjct: 1   MQWEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +++           
Sbjct: 61  KFGLAVDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDITLED-----GTVK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +
Sbjct: 116 RIGITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RYLG CDGNM EGS+R D NVS+       +GTRCE+KNVNS RF+  AI  E +RQI
Sbjct: 176 IVRYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ F+   +  +
Sbjct: 236 DLIEDGGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFLEETRATL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELP  KRERF  +FG+S YDASVL S +  ADYFEK+   + D K+ ANWV+ +L  +L
Sbjct: 296 PELPPQKRERFQSQFGLSTYDASVLASSREQADYFEKVVSISGDAKLAANWVMVELGSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  IE +P+S  QLG ++  I D TISGKIAK +F  +    G+  E++E+ GL+QV
Sbjct: 356 NKQGVEIEQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAMANGEGSADEVIEKRGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIE ++DEV+ +N   V +        +  +  +FVGQ MK + GKANP  V ++L
Sbjct: 416 TDSGAIESMLDEVLAANAEQVEQYRAADEIKRGKMFGFFVGQAMKASKGKANPQQVNELL 475

Query: 493 KEKL 496
           K KL
Sbjct: 476 KAKL 479


>gi|327479576|gb|AEA82886.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           stutzeri DSM 4166]
          Length = 481

 Score =  553 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 246/484 (50%), Positives = 336/484 (69%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+E+HAQLS  SK+FSG++  FGAEPNTQ S  D  MPG LP+LN   V+ A 
Sbjct: 1   MQWETVIGLEIHAQLSTQSKIFSGSATTFGAEPNTQASLVDLGMPGTLPVLNAEAVRMAC 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL ++A I + +VFARKNYFYPDLP+GYQ SQ D PIVG+G + +++         T 
Sbjct: 61  KFGLAIDAEIAEKNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITLED-----GSTR 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RS+ EA A++  + +
Sbjct: 116 RIGITRAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYLG CDGNM EGS+R D NVSV       +GTR E+KNVNS RF+  AI +E +RQI
Sbjct: 176 LVRYLGICDGNMAEGSLRCDCNVSVRPKGQAEFGTRAEIKNVNSFRFIEKAINHEVQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP+K+ETRS+R+KE+A DYRYF  PDLLP+ I++ F+  ++  +
Sbjct: 236 ELIEDGGKVVQETRLYDPNKDETRSMRSKEEANDYRYFPCPDLLPVVIEQSFLDEVRASL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELP  KRERF  EFG+S YDASVL + + +ADYFE++     D K+ ANWV+ +L  +L
Sbjct: 296 PELPGQKRERFEREFGLSTYDASVLSASREMADYFEQVNATCGDAKLAANWVMGELSSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  IE +P++  QLG +I  I D TISGKIAK +F  +    G+  EI+E+  L+QV
Sbjct: 356 NKEGLDIEQSPVTAEQLGGMILRIKDDTISGKIAKMVFEAMAAGEGSADEIIEKKCLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIE ++DEV+ +N   V +        +  +  +FVGQ MK + GKANP  V ++L
Sbjct: 416 TDSGAIEAMLDEVLAANAEQVEQYRASDEAKRGKMFGFFVGQAMKASKGKANPGQVNQLL 475

Query: 493 KEKL 496
           K+KL
Sbjct: 476 KKKL 479


>gi|326795033|ref|YP_004312853.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Marinomonas mediterranea MMB-1]
 gi|326545797|gb|ADZ91017.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Marinomonas mediterranea MMB-1]
          Length = 481

 Score =  553 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 243/485 (50%), Positives = 332/485 (68%), Gaps = 12/485 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +WEVVIG+E+HAQL+  SKLFSGA+ +FGAEPNT  +  D  MPG LP+ N   ++ AV
Sbjct: 1   MNWEVVIGLEIHAQLATKSKLFSGAATSFGAEPNTNTTLVDLGMPGALPVFNKEALRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           M G  ++A I   SVFARKNYFYPDLP+GYQ SQ D PIVG G + V++           
Sbjct: 61  MFGHAVDAEIGMTSVFARKNYFYPDLPKGYQTSQMDHPIVGPGHLDVTLED-----GTVT 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            VGI R HLE+DAGKS+H+ +  ++ IDLNRS   L+EIV++PD+RS+ EA A++  + S
Sbjct: 116 RVGITRAHLEEDAGKSLHEDFHGMTGIDLNRSSTPLLEIVSEPDIRSAKEAVAYVKMIHS 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+ YLG CDGNM EGSMR DVN+S+     E +GTR E+KNVNS RF+  AI  E  RQ+
Sbjct: 176 IVTYLGICDGNMAEGSMRCDVNLSLRPKGQEEFGTRTEIKNVNSFRFIEKAIYCEIERQM 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ILEDGG I QETRL+DP K+ETRS+R+KEDA DYRYF  PDLLP+ +D++++  I+  +
Sbjct: 236 DILEDGGKIVQETRLYDPDKDETRSMRSKEDANDYRYFPCPDLLPIVLDDEYVEEIRANL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGVL 377
           PELP  K +RF  E+ +S YDA VL S +++ADYFE  A   ++ K+ ANWV+ ++   L
Sbjct: 296 PELPTQKAKRFEAEYALSEYDAGVLSSSRAMADYFEDAAKTAKNSKLAANWVMGEVSKFL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+    I ++P+S   LG+L+  I D TI+GK AKD+F  +W+  G+  EI+E+ GL+QV
Sbjct: 356 NQENLDITESPVSAQALGQLLSRIEDNTINGKTAKDVFQSMWQGEGSADEIIEKKGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIE ++  VI++NP  V +        +  ++ +F+GQVMK + GKANP +V  +L
Sbjct: 416 TDTGAIETLIQSVIDANPAQVEQFKASEPDKQKKMIGFFMGQVMKASQGKANPGLVTPIL 475

Query: 493 KEKLG 497
            + L 
Sbjct: 476 NKLLN 480


>gi|67459522|ref|YP_247146.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia felis
           URRWXCal2]
 gi|75536071|sp|Q4UKF0|GATB_RICFE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|67005055|gb|AAY61981.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Rickettsia felis
           URRWXCal2]
          Length = 483

 Score =  553 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 267/484 (55%), Positives = 348/484 (71%), Gaps = 6/484 (1%)

Query: 15  TSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRC 74
             G TG WE +IG+E+HAQ+S  SKLFSG+S  F A PN+QVS+ DAAMPGMLP+LN  C
Sbjct: 4   IEGNTGKWEYIIGLEIHAQISSKSKLFSGSSTIFAANPNSQVSYVDAAMPGMLPVLNKHC 63

Query: 75  VQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSG 134
           V QA+ TGLGL A INKYSVF RKNYFY DLPQGYQISQ   PIV  G + +        
Sbjct: 64  VYQAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEIPT-----S 118

Query: 135 QFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFL 194
                 + I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+
Sbjct: 119 TGDLKTIRINRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPDEAAEFV 178

Query: 195 TKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEA 254
            KLR++LRY+G+CDG+ME+GSMR D N+SV R GE  GTRCE+KN+NSIR +  AIE+EA
Sbjct: 179 KKLRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIIKAIEFEA 238

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           +RQ+ +LE+G  I QETRLF+    ET+++R KE+ALDYRYF +PDLLPL I ++ I  +
Sbjct: 239 KRQVDLLENGEAIIQETRLFNADSGETKTMRLKEEALDYRYFPDPDLLPLVISDELINEL 298

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLL 374
           K  +PELPD K E++  EFG+S YDA V+V+D+S+A+YFEK A   + K++ NW+ ++L 
Sbjct: 299 KANLPELPDQKIEKYTKEFGLSKYDAEVIVADESVAEYFEKAANECNPKMLTNWLTSELF 358

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
           G LN++   I +  I+P+   +L+ LI + TISGKIAK +F I++E G  P +IVEE GL
Sbjct: 359 GQLNKASIGINECKITPSNFAKLVKLIENDTISGKIAKTVFEIMFETGKAPDKIVEEKGL 418

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            QV+D + +  V+DEVI  NP +V      K  L  +FVGQVMK TGGKANP++V ++LK
Sbjct: 419 VQVSDNNVLNTVIDEVIAENPESVEGYKRGKDKLFGFFVGQVMKKTGGKANPTLVNQLLK 478

Query: 494 EKLG 497
           +KL 
Sbjct: 479 DKLD 482


>gi|332529930|ref|ZP_08405881.1| glutamyl-tRNA(gln) amidotransferase subunit B [Hylemonella gracilis
           ATCC 19624]
 gi|332040627|gb|EGI77002.1| glutamyl-tRNA(gln) amidotransferase subunit B [Hylemonella gracilis
           ATCC 19624]
          Length = 490

 Score =  553 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 232/497 (46%), Positives = 314/497 (63%), Gaps = 21/497 (4%)

Query: 11  SESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPIL 70
           S  L  G    +EVVIG E HAQLS  SK+FS A   FGAEPNTQ S  D A+PG LP++
Sbjct: 2   SSKLIQG----YEVVIGFETHAQLSTESKIFSRAPTAFGAEPNTQASAVDLALPGTLPVM 57

Query: 71  NGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP 130
           N   V++A+  GL L +H+   S+FARKNYFYPDLP+GYQISQ + P+V  G+VS  +G 
Sbjct: 58  NRGAVERAIQLGLALGSHVAPRSIFARKNYFYPDLPKGYQISQFEIPVVQGGEVSFYLGD 117

Query: 131 DKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEA 190
           +K        V + R HLE+DAGKS+H+ +   S IDLNR+G  L+EIVT+PD+RSS EA
Sbjct: 118 EK------KTVRLVRAHLEEDAGKSLHEDFIGQSGIDLNRAGTPLLEIVTEPDIRSSEEA 171

Query: 191 KAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAI 250
            A+  +L  I+ ++G CDGNM+EGS R D NVSV +PG   GTR E+KN+NS +F+  AI
Sbjct: 172 VAYAKELHKIVTWIGICDGNMQEGSFRCDANVSVRKPGAPLGTRREIKNLNSFKFMQQAI 231

Query: 251 EYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDF 310
           +YE R QI  +EDG  I+Q T LFDP   ETR++RTKEDA DYRYF +PDL PL I  ++
Sbjct: 232 DYEIRWQIEQIEDGHAIQQATVLFDPDTGETRAMRTKEDAADYRYFPDPDLPPLVIAPEW 291

Query: 311 IRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYF-EKLAVNRDKKIVANWV 369
           I  ++ Q+PELP+   +R   E G+  YDA  +   ++IA ++       +  K+ ANW+
Sbjct: 292 IERVRAQMPELPNDLAKRLQEEDGLPAYDAVQMTQSRAIARFYKMTRERCQQPKLAANWI 351

Query: 370 INDLLGVLNRSGKSIEDTP---ISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT-- 424
           + ++   LN  G  IE       +P  LG++I  I DG IS    K + + LW  G +  
Sbjct: 352 MGEVSKRLNAEGIDIEQLEVRGFTPAILGDMIRSIHDGIISNNAGKQVLDELWLGGDSSN 411

Query: 425 ----PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNT 479
                  ++E  GL+Q+ D  A+EK++DEVI +NP+NVA+    K    +  VGQ MK +
Sbjct: 412 PQARVAAVIEAKGLKQMNDSGALEKIIDEVIAANPDNVAQFKAGKDKAFNALVGQAMKAS 471

Query: 480 GGKANPSIVQKMLKEKL 496
            GKANP  V  +LK+KL
Sbjct: 472 KGKANPQQVNDLLKKKL 488


>gi|254238855|ref|ZP_04932178.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           C3719]
 gi|126170786|gb|EAZ56297.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           C3719]
          Length = 481

 Score =  553 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 246/484 (50%), Positives = 341/484 (70%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+E+HAQL+  SK+FSG+S  FGA PNTQ S  D AMPG LP+LN   V+ A 
Sbjct: 1   MQWETVIGLEIHAQLATQSKIFSGSSTAFGAAPNTQASLVDLAMPGTLPVLNEEAVRMAC 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           + GL ++A I++ +VFARKNYFYPDLP+GYQ SQ D PIVG+G + +++         + 
Sbjct: 61  LFGLAIDARIDRQNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITLED-----GTSK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RS+ EA A++  + +
Sbjct: 116 RIGITRAHLEEDAGKSLHEDFQGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYLG CDGNM EGS+R D NVSV       +GTR E+KNVNS RF+  AI +E +RQI
Sbjct: 176 LVRYLGICDGNMAEGSLRCDCNVSVRPKGQAEFGTRAEIKNVNSFRFIEKAINHEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP+K+ETRS+R KE+A DYRYF  PDLLP+ I+ +++  +++Q+
Sbjct: 236 ELIEDGGKVVQETRLYDPNKDETRSMRGKEEANDYRYFPCPDLLPVVIEPEYLAKLREQL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVL 377
           PELP  KRERF  ++G+S YDASVL + + +ADYFEK+  +  D K+ ANWV+ +L  +L
Sbjct: 296 PELPVQKRERFESQYGLSAYDASVLSASREMADYFEKVQGICGDAKLAANWVMVELGSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  IE +P+S  QLG +I  I D TISGKIAK +F  +    G+  +I+E  GL+QV
Sbjct: 356 NKDGLEIEQSPVSAEQLGGMILRIKDNTISGKIAKMVFEAMANGEGSADQIIEAKGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIEK++DEV+ +N   V +        +  +  +FVGQ MK + GKANP  V ++L
Sbjct: 416 TDSGAIEKMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELL 475

Query: 493 KEKL 496
           K+KL
Sbjct: 476 KKKL 479


>gi|15599680|ref|NP_253174.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           aeruginosa PAO1]
 gi|218893576|ref|YP_002442445.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           aeruginosa LESB58]
 gi|254244703|ref|ZP_04938025.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           2192]
 gi|24418437|sp|Q9HVT7|GATB_PSEAE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|226709606|sp|B7V024|GATB_PSEA8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|9950722|gb|AAG07872.1|AE004862_6 Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           PAO1]
 gi|126198081|gb|EAZ62144.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           2192]
 gi|218773804|emb|CAW29618.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           LESB58]
          Length = 481

 Score =  553 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 246/484 (50%), Positives = 341/484 (70%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+E+HAQL+  SK+FSG+S  FGA PNTQ S  D AMPG LP+LN   V+ A 
Sbjct: 1   MQWETVIGLEIHAQLATQSKIFSGSSTAFGAAPNTQASLVDLAMPGTLPVLNEEAVRMAC 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           + GL ++A I++ +VFARKNYFYPDLP+GYQ SQ D PIVG+G + +++         T 
Sbjct: 61  LFGLAIDARIDRQNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITLED-----GTTK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RS+ EA A++  + +
Sbjct: 116 RIGITRAHLEEDAGKSLHEDFQGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYLG CDGNM EGS+R D NVSV       +GTR E+KNVNS RF+  AI +E +RQI
Sbjct: 176 LVRYLGICDGNMAEGSLRCDCNVSVRPKGQAEFGTRAEIKNVNSFRFIEKAINHEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP+K+ETRS+R KE+A DYRYF  PDLLP+ I+ +++  +++Q+
Sbjct: 236 ELIEDGGKVVQETRLYDPNKDETRSMRGKEEANDYRYFPCPDLLPVVIEPEYLAKLREQL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVL 377
           PELP  KRERF  ++G+S YDASVL + + +ADYFEK+  +  D K+ ANWV+ +L  +L
Sbjct: 296 PELPVQKRERFESQYGLSAYDASVLSASREMADYFEKVQGICGDAKLAANWVMVELGSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  IE +P+S  QLG +I  I D TISGK+AK +F  +    G+  +I+E  GL+QV
Sbjct: 356 NKDGLEIEQSPVSAEQLGGMILRIKDNTISGKLAKMVFEAMANGEGSADQIIEAKGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIEK++DEV+ +N   V +        +  +  +FVGQ MK + GKANP  V ++L
Sbjct: 416 TDSGAIEKMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELL 475

Query: 493 KEKL 496
           K+KL
Sbjct: 476 KKKL 479


>gi|53724971|ref|YP_102004.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           mallei ATCC 23344]
 gi|121598654|ref|YP_994078.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           mallei SAVP1]
 gi|124384355|ref|YP_001028259.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           mallei NCTC 10229]
 gi|126451255|ref|YP_001081903.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           mallei NCTC 10247]
 gi|167001942|ref|ZP_02267732.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei PRL-20]
 gi|238561928|ref|ZP_00441229.2| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia mallei
           GB8 horse 4]
 gi|254177115|ref|ZP_04883772.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei ATCC 10399]
 gi|254203684|ref|ZP_04910044.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei FMH]
 gi|254208660|ref|ZP_04915008.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei JHU]
 gi|254360285|ref|ZP_04976555.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei 2002721280]
 gi|81605677|sp|Q62MR3|GATB_BURMA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|166217739|sp|A3MNR7|GATB_BURM7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|166217740|sp|A2S8J0|GATB_BURM9 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|166217741|sp|A1V775|GATB_BURMS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|52428394|gb|AAU48987.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia mallei
           ATCC 23344]
 gi|121227464|gb|ABM49982.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei SAVP1]
 gi|124292375|gb|ABN01644.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei NCTC 10229]
 gi|126244125|gb|ABO07218.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei NCTC 10247]
 gi|147745196|gb|EDK52276.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei FMH]
 gi|147750536|gb|EDK57605.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei JHU]
 gi|148029525|gb|EDK87430.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei 2002721280]
 gi|160698156|gb|EDP88126.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei ATCC 10399]
 gi|238523634|gb|EEP87071.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia mallei
           GB8 horse 4]
 gi|243062350|gb|EES44536.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit [Burkholderia mallei PRL-20]
          Length = 490

 Score =  553 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 245/487 (50%), Positives = 336/487 (68%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGA+PNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + A +   SVFARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++    Q  + 
Sbjct: 64  GLAIGATVAPRSVFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 184 LVMWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQI 243

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D+I  +K ++
Sbjct: 244 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWIARVKGEM 303

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK---LAVNRDKKIVANWVINDLLG 375
           PELP   ++RFI ++G+S YDA VL S K++A+YFE     A   + K+ ANW++ D+  
Sbjct: 304 PELPAVMQQRFIEQYGVSAYDAGVLTSTKAMAEYFEALVAKAGAANAKLAANWLMGDVSS 363

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVEE 431
            LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G    I+E 
Sbjct: 364 QLNRDGIDIDACPVSAAQLALVLQRIADGTISNKIAKEIFVTIWDEKAADEGAADRIIEA 423

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  VGQ MK T GKANP  V +
Sbjct: 424 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKDKAFNALVGQAMKATKGKANPQQVNE 483

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 484 LLKKKLG 490


>gi|53717831|ref|YP_106817.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei K96243]
 gi|167736588|ref|ZP_02409362.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei 14]
 gi|167813688|ref|ZP_02445368.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei 91]
 gi|167909015|ref|ZP_02496106.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei 112]
 gi|81608158|sp|Q63YJ8|GATB_BURPS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|52208245|emb|CAH34176.1| glutamyl-tRNA amidotransferase subunit B [Burkholderia pseudomallei
           K96243]
          Length = 490

 Score =  553 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 246/487 (50%), Positives = 337/487 (69%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGA+PNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + A +   SVFARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++    Q  + 
Sbjct: 64  GLAIGATVAPRSVFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 184 LVMWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQI 243

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D+I  +K ++
Sbjct: 244 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWIARVKGEM 303

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK---LAVNRDKKIVANWVINDLLG 375
           PELP A ++RFI ++G+S YDA VL S K++A+YFE     A   + K+ ANW++ D+  
Sbjct: 304 PELPAAMQQRFIEQYGVSAYDAGVLTSTKAMAEYFEALVAKAGAANAKLAANWLMGDVSS 363

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVEE 431
            LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G    I+E 
Sbjct: 364 QLNRDGIDIDACPVSAAQLALVLQRIADGTISNKIAKEIFVTIWDEKAADEGAADRIIEA 423

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  VGQ MK T GKANP  V +
Sbjct: 424 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKDKAFNALVGQAMKATKGKANPQQVNE 483

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 484 LLKKKLG 490


>gi|138893939|ref|YP_001124392.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Geobacillus
           thermodenitrificans NG80-2]
 gi|196250511|ref|ZP_03149202.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacillus sp.
           G11MC16]
 gi|166217762|sp|A4IJZ3|GATB_GEOTN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|134265452|gb|ABO65647.1| Glutamyl-tRNAGln amidotransferase subunit B [Geobacillus
           thermodenitrificans NG80-2]
 gi|196210001|gb|EDY04769.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geobacillus sp.
           G11MC16]
          Length = 476

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 216/481 (44%), Positives = 310/481 (64%), Gaps = 10/481 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVH +L   SK+FS +   FGA PNTQ +  D   PG+LP+LN + V+ A+
Sbjct: 1   MNFETVIGLEVHVELKTKSKIFSSSPNAFGAPPNTQTNVIDLGYPGVLPVLNRQAVEFAM 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              + LN  I   + F RKNYFYPD P+ YQISQ+D+P+   G + + +   K       
Sbjct: 61  KAAMALNCEIATETKFDRKNYFYPDNPKAYQISQYDQPLGKNGWIEIEVNGKK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
           ++GI RIHLE+DAGK +H      S +D NR G  L+EIV++PD+RS  EA A+L KL++
Sbjct: 115 KIGITRIHLEEDAGKLMHTGD-GYSLVDFNRQGTPLIEIVSEPDIRSPEEAYAYLEKLKA 173

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I++Y G  D  MEEGS+R D N+S+     + +GT+ E+KN+NS  F+ + +EYEA+RQ 
Sbjct: 174 IIQYTGVSDCKMEEGSLRCDANISLRPLGSDKFGTKTELKNLNSFNFVRMGLEYEAKRQE 233

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            IL  GG IRQETR FD +   T  +R KE + DYRYF EPDL+ L ID+++   ++  I
Sbjct: 234 KILLSGGVIRQETRRFDEATKTTVLMRVKEGSEDYRYFPEPDLVMLYIDDEWKERVRASI 293

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELPDA+R+R++ E+G+  YDA VL   K +AD+FE       D K+ +NW++ ++ G L
Sbjct: 294 PELPDARRKRYVEEWGLPEYDAKVLTLTKEMADFFEATVANGADPKLASNWLMVEVSGYL 353

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N   K + D  ++P  L  +I LI +GTIS KIAK +F  L E GG P++IV+E GL Q+
Sbjct: 354 NSEQKELHDIALTPESLAGMIKLIQNGTISSKIAKKVFKELVEHGGDPEKIVKEKGLVQI 413

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D  A+ K+V EV+++NP +V      K   + + VGQVMK T G+ANP +V K+L E++
Sbjct: 414 SDEGALRKIVLEVLDANPQSVEDYKNGKDRALGFLVGQVMKATKGQANPPLVNKLLVEEI 473

Query: 497 G 497
            
Sbjct: 474 N 474


>gi|134297282|ref|YP_001121017.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           vietnamiensis G4]
 gi|166217744|sp|A4JIS9|GATB_BURVG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|134140439|gb|ABO56182.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Burkholderia vietnamiensis G4]
          Length = 490

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 241/487 (49%), Positives = 334/487 (68%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGA   FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGAPTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++         
Sbjct: 64  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKPAYEK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHA 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 184 LVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQI 243

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I +D+I  ++  +
Sbjct: 244 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGQDWIERVQAGM 303

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+  
Sbjct: 304 PELPAAIQQRFVDQYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAANAKIAANWLMGDVSS 363

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVEE 431
            LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G    I++ 
Sbjct: 364 QLNRDGIEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFATIWDEKATDEGAADRIIDA 423

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP  V +
Sbjct: 424 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVNE 483

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 484 LLKKKLG 490


>gi|67923708|ref|ZP_00517175.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Crocosphaera
           watsonii WH 8501]
 gi|67854463|gb|EAM49755.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Crocosphaera
           watsonii WH 8501]
          Length = 495

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 222/487 (45%), Positives = 311/487 (63%), Gaps = 8/487 (1%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
              +E +IG+E H QL+  SK+F   S  F + PNT V       PG+LP+LN   +  A
Sbjct: 8   KTKYEAIIGLETHCQLNTNSKIFCDCSTEFDSPPNTNVCPVCLGYPGVLPVLNEEVLASA 67

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           V  GL LNA I  YS F RK YFYPDLP+ +QISQ D PIV  G + + +   K+ +   
Sbjct: 68  VKLGLALNAKIAPYSKFDRKQYFYPDLPKNFQISQFDLPIVEHGSLEIELVDKKTKEITR 127

Query: 139 IEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAF 193
             +GI R+H+E+DAGK +H        S  S +D NR+GV L+EIV++PD+R+  EA  +
Sbjct: 128 KTIGITRLHMEEDAGKLVHAGSDRLAGSTHSLVDFNRTGVPLLEIVSEPDIRTGQEAAEY 187

Query: 194 LTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEY 252
             +LR ++RYLG  DGNM+EGSMR DVN+SV     + +GT+ E+KN+NS   +  AIEY
Sbjct: 188 AQELRRMVRYLGISDGNMQEGSMRCDVNISVRPVGQKEFGTKVEIKNMNSFSAIQKAIEY 247

Query: 253 EARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIR 312
           E  RQI  +E+G  I QETRL+D S   T S+R KE + DYRYF EPDL PLE+ ++ + 
Sbjct: 248 EIERQIEAVENGDPIYQETRLWDESNQATISMRKKEGSSDYRYFPEPDLPPLEVSKERLN 307

Query: 313 AIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANWVIN 371
           + K+++PELP  KR+R+   FG+S YDA VL  D+ +A+Y+E  +    D K+VANWV  
Sbjct: 308 SWKEELPELPAEKRQRYEEAFGLSAYDARVLSDDREVAEYYESAVNTGADAKLVANWVTQ 367

Query: 372 DLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEE 431
           D+   LN +  SI +  + P+ LGEL+ LI   TISGKIAK+I   L EKGG+PK+IVE 
Sbjct: 368 DIAAYLNNNKLSITEIALKPDSLGELVQLIEKKTISGKIAKEILPELLEKGGSPKKIVES 427

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            G+ Q++D + I KV+  ++ +NP+ V +    K  L  +FVGQVMK TGG A+P +  +
Sbjct: 428 KGMTQISDPAEIAKVITALMEANPSEVEKYRGGKKKLKGFFVGQVMKQTGGCADPKLTNQ 487

Query: 491 MLKEKLG 497
           ++++ L 
Sbjct: 488 LVEKLLN 494


>gi|167892296|ref|ZP_02479698.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei 7894]
 gi|167917053|ref|ZP_02504144.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           pseudomallei BCC215]
          Length = 490

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 244/487 (50%), Positives = 337/487 (69%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGA+PNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + A +   SVFARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++    Q  + 
Sbjct: 64  GLAIGATVAPRSVFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 184 LVMWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQI 243

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D+I  +K ++
Sbjct: 244 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWIARVKGEM 303

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK---LAVNRDKKIVANWVINDLLG 375
           PELP A ++RF+ ++G+S YDA VL S K++A+YFE     A   + K+ ANW++ D+  
Sbjct: 304 PELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAEYFEALVAKAGAANAKLAANWLMGDVSS 363

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVEE 431
            LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G    ++E 
Sbjct: 364 QLNRDGIDIDACPVSAAQLALVLQRIADGTISNKIAKEIFVTIWDEKAADEGAADRLIEA 423

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  VGQ MK T GKANP  V +
Sbjct: 424 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKDKAFNALVGQAMKATKGKANPQQVNE 483

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 484 LLKKKLG 490


>gi|313891686|ref|ZP_07825293.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Dialister microaerophilus UPII 345-E]
 gi|313119964|gb|EFR43149.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
           [Dialister microaerophilus UPII 345-E]
          Length = 481

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 220/484 (45%), Positives = 312/484 (64%), Gaps = 13/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             +E VIG+EVH +L   +K+F     +FGA+PNT V      +PG+LP+LN + ++ AV
Sbjct: 1   MKYEAVIGLEVHTELRTNTKIFCSCKTSFGADPNTNVCPVCLGLPGVLPVLNEKVLEFAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  I +YS F RKNY+YPDLP+ +Q SQ D PI G G + + +   K       
Sbjct: 61  RAGLALNCKIARYSKFDRKNYYYPDLPKDFQTSQFDLPICGPGYLDIEVEGVK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQ----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
            + I R H+E+DAGK +H       S  S +D NR+G  L+EIV++PDMRS+ EA A++ 
Sbjct: 115 RINITRAHMEEDAGKLVHHGTSITDSDYSLVDYNRTGTPLLEIVSEPDMRSAEEAVAYME 174

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEA 254
           KLR+IL+Y+G  D  MEEGS+R D N+SV        GT+ E+KN+NS R +G AIEYEA
Sbjct: 175 KLRTILQYVGISDCKMEEGSLRCDANISVRPAGTTKLGTKTEIKNINSFRGVGRAIEYEA 234

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
            RQ  +LE+GG + QETR +D  +  T+S+R+KE+A DYRYF EPDL+P  + E++I  I
Sbjct: 235 IRQAELLEEGGKVIQETRTWDEKEGITKSMRSKEEANDYRYFPEPDLVPFTVSEEYIENI 294

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDL 373
              +PELPD ++ R+I +FG+S  DA ++ ++KS++DYFE++     + K   NW++ + 
Sbjct: 295 NSTLPELPDVRKARYIKDFGLSSDDAEMMTNNKSLSDYFEEIVKAGAEPKATVNWLMGEF 354

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
           +  L+ SG  IEDTP++   L  L+DLI  G ISGKIAK +F  +WE    P  IV+E G
Sbjct: 355 MSHLSDSGLEIEDTPVTAKDLASLLDLISKGVISGKIAKQVFKEMWETHKEPALIVKEKG 414

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           L Q++D SA+E +VD+VI  NP +V      K   V + +GQ+MK T GKANP +V  +L
Sbjct: 415 LVQISDTSALESIVDDVILKNPQSVDDFKQGKKKAVGFLMGQIMKATKGKANPRVVNGIL 474

Query: 493 KEKL 496
            +KL
Sbjct: 475 LKKL 478


>gi|302342284|ref|YP_003806813.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfarculus
           baarsii DSM 2075]
 gi|301638897|gb|ADK84219.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Desulfarculus
           baarsii DSM 2075]
          Length = 476

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 229/481 (47%), Positives = 318/481 (66%), Gaps = 9/481 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            D+E VIG+EVHAQL   SK+F G S +FG  PN+ V      MPG+LP+LN + V+ A+
Sbjct: 1   MDYEAVIGLEVHAQLLTRSKIFCGCSTSFGQPPNSNVCPVCLGMPGVLPVLNQQVVELAM 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              L     + + SV+ARKNYFYPDLP+GYQISQ++ P+   G++ +++   +       
Sbjct: 61  RAALATGCQVAERSVWARKNYFYPDLPKGYQISQYELPLAQHGRLEITVDGQE------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            VGI RIH+E+DAGK +HD     S +DLNR+GV L+EIV++PDMRS  EA A+L  LR 
Sbjct: 115 CVGITRIHMEEDAGKLVHDPSLPQSYVDLNRTGVPLIEIVSEPDMRSPEEAGAYLRALRD 174

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           IL YL  CDGNMEEGS R D NVS+     E  GTR E+KN+NS R +  AI+YE RRQ 
Sbjct: 175 ILVYLEVCDGNMEEGSFRCDANVSIRPLGQEKLGTRAELKNMNSFRNVMKAIDYEIRRQK 234

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
           AIL++GG + Q+TRL+D +  +T ++R KE+A DYRYF +PDLLPLEI   ++  + + +
Sbjct: 235 AILDEGGQVIQQTRLWDDAAGKTVAMRGKEEAHDYRYFPDPDLLPLEIAPAWLARVGQGL 294

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANWVINDLLGVL 377
           PELP AKR+RF    G+S YDA VL +++++ADYFE  +      K  ANW+++DLLG L
Sbjct: 295 PELPAAKRQRFQQAHGLSAYDAEVLCAERALADYFEAAVNAGAPAKAAANWIMSDLLGAL 354

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
              G++I    ++P  L EL+ L+  G ISGKIAKDIF ++ E G +   IVE+ GLRQV
Sbjct: 355 RAEGQAIGQCAVTPQALAELLALVASGQISGKIAKDIFPLMLETGQSAATIVEQKGLRQV 414

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +D   ++ V++ +I  +P         K  L+ +FVGQVMK T G+ANP  V +++++ L
Sbjct: 415 SDSGELQAVLERIIAESPKEAEGYRAGKKKLMGYFVGQVMKATKGQANPQAVNELVEKLL 474

Query: 497 G 497
           G
Sbjct: 475 G 475


>gi|84686379|ref|ZP_01014273.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84665562|gb|EAQ12038.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodobacterales
           bacterium HTCC2654]
          Length = 535

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 295/540 (54%), Positives = 370/540 (68%), Gaps = 47/540 (8%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+          ++ +G   DWE+VIG+EVHAQ+S  +KLFSGAS  FGAEPN  V+F D
Sbjct: 1   MLDHLAFETPKPTVIAGAREDWELVIGMEVHAQVSSKAKLFSGASTQFGAEPNANVAFVD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 61  AAMPGMLPVINEFCVEQAVRTGLGLKAEINLFSAFDRKNYFYPDLPQGYQISQLYHPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG++ V +GP          V IERIHLEQDAGKSIHD   ++S +DLNR+GVALMEIV+
Sbjct: 121 EGEIIVDMGP-----GIARRVRIERIHLEQDAGKSIHDMDPSMSFVDLNRTGVALMEIVS 175

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A++TKLR ILRYLGTCDGNM+ G++RADVNVSVCRPG+           
Sbjct: 176 RPDIRGPEEAAAYVTKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYMETQDFS 235

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AI+YEARRQIAI+EDGG + QETRL+DP KNETRS+R+KE+
Sbjct: 236 HLGTRCEIKNMNSMRFIQAAIDYEARRQIAIVEDGGEVVQETRLYDPDKNETRSMRSKEE 295

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF  PDLLPLEI++ ++  IK  +PELPD K+ RF+ +FG+S YDA VL +D + 
Sbjct: 296 AHDYRYFPCPDLLPLEIEQAWVDGIKATLPELPDEKKARFVKDFGLSEYDAGVLTADTTN 355

Query: 350 ADYFEK-------------------------------LAVNRDKKIVANWVINDLLGVLN 378
           A +FE+                               +      K+ ANWVIN+L G L 
Sbjct: 356 ASFFEEVVGSTIGKLDELPLSPVYATTSDKPVGDFESIQSRDLGKLSANWVINELFGRLK 415

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           +  + I D+PISP +LG+++ LI  G ISGKI KD+F I + +   P+EIVE  G++QVT
Sbjct: 416 KDDRDIADSPISPARLGQIVALIKKGDISGKIGKDVFEIAYTQDRDPEEIVETEGMKQVT 475

Query: 439 DLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLGI 498
           D  AIE  VDEVI +NP  V +    P L  WFVGQVMK TGGKANP  V +++  KLG+
Sbjct: 476 DTGAIETAVDEVIAANPEQVEKAKQNPKLAGWFVGQVMKATGGKANPKAVNEIVAAKLGL 535


>gi|262368934|ref|ZP_06062263.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter johnsonii SH046]
 gi|262316612|gb|EEY97650.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter johnsonii SH046]
          Length = 491

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 246/493 (49%), Positives = 333/493 (67%), Gaps = 14/493 (2%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
               L  G    WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP+
Sbjct: 8   PKSLLIDG----WEVVIGIEIHTQLATQSKIFSGSSTEFGQDPNTQASLVDLAMPGVLPV 63

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           LN   V  A+  GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + + 
Sbjct: 64  LNKEVVDLAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQLE 123

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
                      +G+ R HLE+DAGKSIHDQ+  +S IDLNR+G  L+EIV++PDMRS  E
Sbjct: 124 D-----GTVKRIGVTRAHLEEDAGKSIHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVEE 178

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLA 249
           A A++  + +++R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  A
Sbjct: 179 AVAYIKSIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQA 238

Query: 250 IEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDED 309
           I  E  RQ+ ILE  G I QETRLFDP K ETRS+R+KE+A DYRYF +PDLLP+ I + 
Sbjct: 239 INVEIERQMEILEWDGTIDQETRLFDPVKMETRSMRSKEEANDYRYFPDPDLLPVIISDA 298

Query: 310 FIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKIV 365
            I   +  +PELP A+RERF+ +FG++ YDA VL   + ++D++E            K+ 
Sbjct: 299 QIETARAALPELPAARRERFVADFGVTEYDAHVLTLTREMSDFYEVVVAAAGGAAQGKVS 358

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ANWV+ +  G LN++G  + D+P+S  +LG +I  I+D TISGKIAK +F  +W++G T 
Sbjct: 359 ANWVMGEFSGALNKAGLELADSPVSAEKLGGMIARIVDNTISGKIAKQVFGFMWDEGKTA 418

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKAN 484
            EI+ E GL+Q TD  AIE ++ EV+ +N   V      K    +  VGQVMK + GKAN
Sbjct: 419 DEIIAEKGLKQETDTGAIEAIIKEVLAANEKMVEEFKSGKEKAFNGLVGQVMKASKGKAN 478

Query: 485 PSIVQKMLKEKLG 497
           P+ V +++K+ +G
Sbjct: 479 PAQVNELMKKLIG 491


>gi|329122128|ref|ZP_08250736.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Dialister
           micraerophilus DSM 19965]
 gi|327466935|gb|EGF12451.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Dialister
           micraerophilus DSM 19965]
          Length = 481

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 220/484 (45%), Positives = 312/484 (64%), Gaps = 13/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             +E VIG+EVH +L   +K+F     +FGA+PNT V      +PG+LP+LN + ++ AV
Sbjct: 1   MKYEAVIGLEVHTELRTNTKIFCSCKTSFGADPNTNVCPVCLGLPGVLPVLNEKVLEFAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  I +YS F RKNY+YPDLP+ +Q SQ D PI G G + + +   K       
Sbjct: 61  RAGLALNCKIARYSKFDRKNYYYPDLPKDFQTSQFDLPICGPGYLDIEVEGVK------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQ----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
            + I R H+E+DAGK +H       S  S +D NR+G  L+EIV++PDMRS+ EA A++ 
Sbjct: 115 RINITRAHMEEDAGKLVHHGTSITDSDYSLVDYNRTGTPLLEIVSEPDMRSAEEAVAYME 174

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEA 254
           KLR+IL+Y+G  D  MEEGS+R D N+SV        GT+ E+KN+NS R +G AIEYEA
Sbjct: 175 KLRTILQYVGISDCKMEEGSLRCDANISVRPAGTTKLGTKTEIKNINSFRGVGRAIEYEA 234

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
            RQ  +LE+GG + QETR +D  +  T+S+R+KE+A DYRYF EPDL+P  + E++I  I
Sbjct: 235 IRQAELLEEGGKVIQETRTWDEKEGITKSMRSKEEANDYRYFPEPDLVPFTVSEEYIENI 294

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDL 373
              +PELPD ++ R+I +FG+S  DA ++ ++KS++DYFE++     + K   NW++ + 
Sbjct: 295 NSTLPELPDVRKARYIKDFGLSSDDAEMMTNNKSLSDYFEEIVKVGAEPKATVNWLMGEF 354

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
           +  L+ SG  IEDTP++   L  L+DLI  G ISGKIAK +F  +WE    P  IV+E G
Sbjct: 355 MSHLSDSGLEIEDTPVTAKDLASLLDLISKGVISGKIAKQVFKEMWETHKEPALIVKEKG 414

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           L Q++D SA+E +VD+VI  NP +V      K   V + +GQ+MK T GKANP +V  +L
Sbjct: 415 LVQISDTSALESIVDDVILKNPQSVDDFKQGKKKAVGFLMGQIMKATKGKANPRVVNGIL 474

Query: 493 KEKL 496
            +KL
Sbjct: 475 LKKL 478


>gi|83942720|ref|ZP_00955181.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sulfitobacter sp.
           EE-36]
 gi|83953959|ref|ZP_00962680.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sulfitobacter
           sp. NAS-14.1]
 gi|83841904|gb|EAP81073.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sulfitobacter
           sp. NAS-14.1]
 gi|83846813|gb|EAP84689.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sulfitobacter sp.
           EE-36]
          Length = 503

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 300/508 (59%), Positives = 368/508 (72%), Gaps = 17/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+        +G   DWE+VIG+EVHAQ+   +KLFS AS  FGAEPN  V+F D
Sbjct: 1   MLDL-TYDTPKVRTIAGAKHDWELVIGMEVHAQVLSNAKLFSAASTKFGAEPNNNVAFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP +N  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVG
Sbjct: 60  AAMPGMLPTINEYCVEQAVRTGLGLKAEINLHSAFDRKNYFYPDLPQGYQISQLYHPIVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG+V V +G   +       V +ERIHLEQDAGKSIHD    +S +DLNR+GVALMEIV+
Sbjct: 120 EGEVLVELGDGTA-----RLVRVERIHLEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A+LTKLR ILRYLGTC+G+M+ G+MRADVNVS+C PG+           
Sbjct: 175 RPDIRGPEEAAAYLTKLRQILRYLGTCNGDMQSGAMRADVNVSICLPGQYEKYQETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+  AIE EA+RQIAI+E GG + QETRLFDP K ETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQQAIEVEAKRQIAIVEAGGEVVQETRLFDPDKQETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF +PDLLPL I++ ++  I   +PELPDAK+ RFI +FG+S YDASVL SD   
Sbjct: 295 AHDYRYFPDPDLLPLVIEQAWVDDIGANLPELPDAKKARFINDFGLSDYDASVLTSDLDS 354

Query: 350 ADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           A YFE  A  RD K+ ANWVIN+L G L +  K+I D+P+SP QLG +IDLI    ISGK
Sbjct: 355 AGYFEATAQGRDGKMAANWVINELFGRLKKDEKAITDSPVSPAQLGGVIDLIASDAISGK 414

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVS 469
           IAKD+F I++ +GG P  IVEE G++QVTD SAIE  VDE+I +NP+ VA+    P L  
Sbjct: 415 IAKDLFEIVYTEGGDPAVIVEERGMKQVTDTSAIEAAVDEIIAANPDQVAKARENPKLAG 474

Query: 470 WFVGQVMKNTGGKANPSIVQKMLKEKLG 497
           WFVGQ MK TGGKANP  V +++ +KL 
Sbjct: 475 WFVGQTMKATGGKANPKAVNQIVAQKLN 502


>gi|315500152|ref|YP_004088955.1| glutamyl-tRNA(gln) amidotransferase, b subunit [Asticcacaulis
           excentricus CB 48]
 gi|315418164|gb|ADU14804.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Asticcacaulis
           excentricus CB 48]
          Length = 489

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 292/493 (59%), Positives = 361/493 (73%), Gaps = 7/493 (1%)

Query: 8   VARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGML 67
              +     G TG WE+VIG+E+HAQ++  SKLFSGA+V FGA PN QVS  DA  PGML
Sbjct: 2   TDSASRYIQGRTGPWELVIGLEIHAQVASTSKLFSGAAVGFGAGPNEQVSLVDAGFPGML 61

Query: 68  PILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVS 127
           P+LN  CV+QAV TGLGL A IN +S F RKNYFYPDLPQGYQISQ   PIVGEG+V + 
Sbjct: 62  PVLNRFCVEQAVKTGLGLKAQINPHSRFDRKNYFYPDLPQGYQISQLFYPIVGEGEVLID 121

Query: 128 IGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSS 187
           +            V IER+HLEQDAGKSIHD     + +DLNR+G ALMEIV+KPD+RS+
Sbjct: 122 LSD-----GTQKTVRIERLHLEQDAGKSIHDLDPNNTYVDLNRAGTALMEIVSKPDIRSA 176

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLG 247
            EA A+  K+R+IL YLGT DG+ME+G+MRADVNVSVC+PG  +GTRCE+KNVNS RF+ 
Sbjct: 177 EEAVAYFKKIRTILVYLGTSDGDMEKGNMRADVNVSVCKPGAEFGTRCEIKNVNSFRFMQ 236

Query: 248 LAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEID 307
            AIEYEARRQI I+EDGG I QETRLFD  K ETRSLR+KE+A DYRYF +PDLLPLE++
Sbjct: 237 QAIEYEARRQIEIIEDGGTITQETRLFDSVKVETRSLRSKEEAHDYRYFPDPDLLPLELE 296

Query: 308 EDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVAN 367
             +I  IKK +PELPD KR+R + ++G+S YDA+VLV++++ ADY+E  A +RD K+VAN
Sbjct: 297 LAWIEDIKKSLPELPDDKRQRLMTQYGLSQYDATVLVTEQARADYYEAAAKDRDAKLVAN 356

Query: 368 WVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG--TP 425
           WV N+LL  L + G  IE +P+ P Q+  L++LI    IS KIAK +F  +WE  G  TP
Sbjct: 357 WVTNELLARLTKDGLEIEQSPLPPAQIAGLVELIETNVISSKIAKTVFEHMWEGKGTITP 416

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANP 485
            EIVE+ GL+QVTD  AIEK +DE+I +N         KP  + WFVGQVMK TGGKANP
Sbjct: 417 AEIVEKHGLKQVTDTGAIEKAIDEIIAANLEKAEAAKEKPQAIGWFVGQVMKATGGKANP 476

Query: 486 SIVQKMLKEKLGI 498
           + V  +LK KLG+
Sbjct: 477 AAVNDLLKTKLGL 489


>gi|291612605|ref|YP_003522762.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sideroxydans
           lithotrophicus ES-1]
 gi|291582717|gb|ADE10375.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sideroxydans
           lithotrophicus ES-1]
          Length = 504

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 242/500 (48%), Positives = 329/500 (65%), Gaps = 25/500 (5%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WE+VIG+EVH QLS  +K+FSGAS  FGAEPNTQ      A+PG+LP+LN   V++A+  
Sbjct: 3   WEIVIGLEVHTQLSTNTKIFSGASTAFGAEPNTQADAVSIALPGVLPVLNKGAVERAIKF 62

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP-DKSGQFRTIE 140
           GL   AHI + SVFARKNYFYPDLP+GYQISQ D P+VG+G +++ + P   + +     
Sbjct: 63  GLATGAHIAQRSVFARKNYFYPDLPKGYQISQFDLPVVGQGALTIQVEPLSGNAKPYAKT 122

Query: 141 VGIERIHLEQDAGKSIHD---------------------QYSAVSCIDLNRSGVALMEIV 179
           V I R HLE+DAGKS+H                          V+ IDLNR+G  L+EIV
Sbjct: 123 VRITRAHLEEDAGKSVHGFEMNSESDDTLIAEDGSRIFFPRDNVTGIDLNRAGTPLLEIV 182

Query: 180 TKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKN 239
           ++PDM S+ EA A+   L S++R++G CDGNM+EGS R DVNVSV +PG+  GTR E+KN
Sbjct: 183 SEPDMCSAAEAVAYAKALHSLVRWIGICDGNMQEGSFRCDVNVSVRKPGQPLGTRREIKN 242

Query: 240 VNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEP 299
           +NS +F+  AI+YE + QI  +E+GG ++Q T LF+P   ETR++R+KEDA DYRYF +P
Sbjct: 243 LNSFKFMQQAIDYEVQWQIDTIENGGKVQQATVLFNPDTGETRAMRSKEDAHDYRYFPDP 302

Query: 300 DLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL--A 357
           DLLPLEI  D+I  ++  +PELP AK+ R++ + G+S YDASVL S + +AD+FE     
Sbjct: 303 DLLPLEISSDWIEQVRGTLPELPQAKQIRYVNDLGLSAYDASVLTSSREMADFFEAALGD 362

Query: 358 VNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNI 417
                KI ANW+I ++   LNR G  +   PI+  QLG ++  I DGTIS   AK++F  
Sbjct: 363 ATGQAKICANWIIGEVSAQLNRDGLDMAQCPITAQQLGGMLQRIADGTISNSGAKEVFRT 422

Query: 418 LWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVM 476
           +W +GG    I+E  GL+QV+D  AIE +VDE+I +N + VA     K  L  +FVG  M
Sbjct: 423 MWAEGGEADAIIEAKGLKQVSDSGAIEALVDEIIAANADKVAEYRSGKDKLFGFFVGLAM 482

Query: 477 KNTGGKANPSIVQKMLKEKL 496
           K + GKANP+ +  +LK+KL
Sbjct: 483 KASKGKANPAQLNDILKKKL 502


>gi|209522352|ref|ZP_03270970.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia sp.
           H160]
 gi|209497211|gb|EDZ97448.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Burkholderia sp.
           H160]
          Length = 491

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 233/489 (47%), Positives = 333/489 (68%), Gaps = 11/489 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  WEVVIG+E H QLS  SK+FSG +  FGA PNTQ S  D A+PG LP++N   V++A
Sbjct: 2   TKQWEVVIGLETHTQLSTHSKIFSGTATQFGAAPNTQASPVDLALPGTLPVMNRGAVERA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQF 136
           +  GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G+V++ +  ++    + 
Sbjct: 62  IQFGLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQVTIQVPANEKAGKEA 121

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
               + + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   
Sbjct: 122 YEKTINLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKS 181

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L +++ +LG CDGNM+EGS R D NVSV     + +GTR E+KN+NS RFL  AI+YE R
Sbjct: 182 LHTLVVWLGICDGNMQEGSFRCDANVSVRPLGQKEFGTRAEIKNLNSFRFLEEAIQYEVR 241

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL ID  ++  +K
Sbjct: 242 RQIELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIDAAWVERVK 301

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVIND 372
            ++PELP+A + RF+ ++G++ YDA+VL S K+ A Y+E +       + K+ ANWV+ +
Sbjct: 302 SEMPELPEAIQRRFVSQYGLTPYDANVLTSSKATAAYYEAVVAKVGAGNAKVAANWVMGE 361

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT----PKEI 428
           +   LNR G  +   P+S  QL  ++  I DGTIS KIAK+IF  +WE+  T       I
Sbjct: 362 VSSQLNREGLDMAACPVSAAQLALVLQRIADGTISNKIAKEIFLAIWEEKATDEAAADRI 421

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSI 487
           +E  GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP+ 
Sbjct: 422 IEAKGLKQISDTGALEAIIDEVLTANQKSVDEYRAGKEKAFNALIGQAMKATKGKANPAQ 481

Query: 488 VQKMLKEKL 496
           V ++LK+KL
Sbjct: 482 VNELLKKKL 490


>gi|237798578|ref|ZP_04587039.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|331021431|gb|EGI01488.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. oryzae str. 1_6]
          Length = 481

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 244/484 (50%), Positives = 338/484 (69%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV
Sbjct: 1   MQWEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +++           
Sbjct: 61  KFGLAVDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDITLED-----GTVK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            VGI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +
Sbjct: 116 RVGITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RYLG CDGNM EGS+R D NVS+       +GTRCE+KNVNS RF+  AI  E +RQI
Sbjct: 176 IVRYLGICDGNMAEGSLRCDCNVSIRPRGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ FI   +  +
Sbjct: 236 DLIEDGGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFIEETRATL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELP  KRERF  +FG+S YDASVL S +  ADYFEK+   + D K+ ANWV+ +L  +L
Sbjct: 296 PELPPQKRERFQSQFGLSTYDASVLASSREQADYFEKVVSISGDAKLAANWVMVELGSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  I+ +P+S  QLG ++  I D TISGKIAK +F  +    G+  E++E+ GL+QV
Sbjct: 356 NKQGVEIDQSPVSAEQLGGMLKRITDNTISGKIAKMVFEAMANGEGSADEVIEKRGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AI+ ++D+V+ +N   V +        +  +  +FVGQ MK + GKANP  V ++L
Sbjct: 416 TDSGAIKSMLDDVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELL 475

Query: 493 KEKL 496
           K KL
Sbjct: 476 KAKL 479


>gi|157826689|ref|YP_001495753.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           bellii OSU 85-389]
 gi|166198814|sp|A8GV45|GATB_RICB8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|157801993|gb|ABV78716.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rickettsia
           bellii OSU 85-389]
          Length = 483

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 267/484 (55%), Positives = 347/484 (71%), Gaps = 6/484 (1%)

Query: 15  TSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRC 74
               +G WE VIG+E+HAQ+S  SKLFSG+   F A PN+QVS+ DAAMPGMLP+LN  C
Sbjct: 4   IESNSGKWEYVIGLEIHAQISSKSKLFSGSGTTFAASPNSQVSYVDAAMPGMLPVLNEYC 63

Query: 75  VQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSG 134
           V QA+ TGLGL A +NKYSVF RKNYFY DLPQGYQISQ   PIV +G + +        
Sbjct: 64  VHQAIKTGLGLKAKVNKYSVFDRKNYFYADLPQGYQISQFYYPIVQDGTMEIPT-----S 118

Query: 135 QFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFL 194
                 + I R+HLEQDAGKS+HDQ    S IDLNR+G+ LMEIVT+PD+ S  EA  F+
Sbjct: 119 TGELKTIRINRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPDEAAEFV 178

Query: 195 TKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEA 254
            KLRS+LRY+G+CDG+ME+GSMR D NVSV R GE  GTRCE+KN+NSIR +  AIE+EA
Sbjct: 179 KKLRSLLRYVGSCDGDMEKGSMRCDANVSVRRKGEPLGTRCEIKNINSIRNIVRAIEFEA 238

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           +RQ+ ++E+G  + QET LF+    ETR++R+KE+A DYRYF +PDLLP+ + ++ I  +
Sbjct: 239 KRQVDLIENGESVIQETCLFNADSGETRTMRSKEEAADYRYFPDPDLLPVILSDELINEL 298

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLL 374
           K  +PELPD K +++I +FG+S YDA V+V+D+S A YFE+ A   D K++ANW+IN+L 
Sbjct: 299 KASLPELPDQKIDKYITKFGLSKYDAEVIVADESAAKYFEEAANECDPKLLANWLINELF 358

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
           G LN++   I +  I+PN   +LI LI D TISGKIAK +F I++E G    +IVEE GL
Sbjct: 359 GQLNKASAEISECKITPNDFAKLIKLIEDNTISGKIAKTVFEIMFETGKAADKIVEEQGL 418

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            QV+D + +  V+DEVI  NP++V      K  L  +FVGQVMK TGGKANP +V ++LK
Sbjct: 419 VQVSDSNVLNTVIDEVIRENPDSVEGYKGGKDKLFGFFVGQVMKKTGGKANPGLVNQLLK 478

Query: 494 EKLG 497
           EKLG
Sbjct: 479 EKLG 482


>gi|126733101|ref|ZP_01748855.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sagittula
           stellata E-37]
 gi|126706450|gb|EBA05533.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sagittula
           stellata E-37]
          Length = 504

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 287/508 (56%), Positives = 369/508 (72%), Gaps = 18/508 (3%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           M+ L T+      + +G   DWE+VIG+EVHAQ++  +KLFSGAS  FGAEPN+ VSF D
Sbjct: 1   MLDL-TYETPKPKVIAGAKHDWELVIGMEVHAQVASKAKLFSGASTQFGAEPNSNVSFVD 59

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLP++N  C++QAV TGLGL A IN  S F RKNYFYPDLPQGYQISQ   P+VG
Sbjct: 60  AAMPGMLPVINEYCIEQAVRTGLGLKAQINLVSAFDRKNYFYPDLPQGYQISQLYHPLVG 119

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EG++ V + P          V IERIH+EQDAGKSIHD    +S +DLNR+GVALMEIV+
Sbjct: 120 EGEILVDMEP-----GIARLVRIERIHVEQDAGKSIHDMDPNMSFVDLNRTGVALMEIVS 174

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE----------- 229
           +PD+R   EA A++ K+R ILRYLGTCDGNM+ G++RADVNVS+CRPG+           
Sbjct: 175 RPDIRGPEEAAAYVAKMRQILRYLGTCDGNMQNGNLRADVNVSICRPGQYEKYQETQDFS 234

Query: 230 AWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKED 289
             GTRCE+KN+NS+RF+ +AI+ EARRQIAI+E GG + QETRL+DP KNETRS+R+KE+
Sbjct: 235 HLGTRCEIKNMNSMRFIQMAIDVEARRQIAIVEGGGTVDQETRLYDPDKNETRSMRSKEE 294

Query: 290 ALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSI 349
           A DYRYF  PDLLPLEI++ ++  I   +PELPD K+ RF+G+FG++ YDA+VL ++   
Sbjct: 295 AHDYRYFPCPDLLPLEIEQGWVDDIAASLPELPDEKKARFMGDFGLTEYDANVLTAETVN 354

Query: 350 ADYFEKLAVNR-DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISG 408
           A YFE++     D K+ ANWVIN+L G L +  + I D+P++P QL  +I LI    ISG
Sbjct: 355 AAYFEQVVTEAGDGKLSANWVINELFGRLKKDDRDITDSPVTPGQLASIIKLIKSDAISG 414

Query: 409 KIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLV 468
           KIAKD+F I++ +GG P++IVEE G++QVTD  AIE  VDE+I +NP  V +    P L 
Sbjct: 415 KIAKDLFEIVYTEGGDPEKIVEERGMKQVTDTGAIETAVDEIIAANPAQVEKAKANPKLA 474

Query: 469 SWFVGQVMKNTGGKANPSIVQKMLKEKL 496
            WFVGQVMK TGGKANP  V +++  KL
Sbjct: 475 GWFVGQVMKATGGKANPKAVNEIVARKL 502


>gi|237748828|ref|ZP_04579308.1| glutamyl-tRNA amidotransferase subunit B [Oxalobacter formigenes
           OXCC13]
 gi|229380190|gb|EEO30281.1| glutamyl-tRNA amidotransferase subunit B [Oxalobacter formigenes
           OXCC13]
          Length = 486

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 248/486 (51%), Positives = 332/486 (68%), Gaps = 11/486 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E HAQLS VSK+FSGAS +FGAEPNTQ    D A+PG+LP++N   V++A+
Sbjct: 1   MQWEVVIGLETHAQLSTVSKIFSGASTSFGAEPNTQACPVDLALPGVLPVMNRGAVEKAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A +   SVFARKNYFYPDLP+GYQISQ +KP+V  GK++  +   + G+    
Sbjct: 61  QFGLAIGAEVAPVSVFARKNYFYPDLPKGYQISQFEKPVVIGGKLNCIVE--QKGKSYIK 118

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H++++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   L S
Sbjct: 119 TVNLTRAHLEEDAGKSLHEEFADMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKSLHS 178

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG  DGNM+EGS R D NVSV      A GTRCEVKN+NS R L  AI YE  RQI
Sbjct: 179 LVTWLGISDGNMQEGSFRCDANVSVRPAGTTALGTRCEVKNLNSFRNLEDAINYEVERQI 238

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++E GG + Q TRL+DP K ETR +RTKED+ DYRYF +PDL PL I  ++I  +KK++
Sbjct: 239 ELIESGGKVVQATRLYDPDKRETREMRTKEDSDDYRYFPDPDLPPLVISAEWIERVKKEL 298

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV---NRDKKIVANWVINDLLG 375
           PELP+A R+RFI E+G+  YDA+VL   K++A+Y+EKL      +  K  ANW++ D+  
Sbjct: 299 PELPEALRKRFINEYGLPEYDATVLTQSKAMAEYYEKLISLTGKQLAKQNANWLMVDIAS 358

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT----PKEIVEE 431
            LNR    I D P++  QL +L+  I D TIS KIA+DIF ILW+   +      +I++ 
Sbjct: 359 ALNRENLEIGDLPVTVRQLAQLMQRIADNTISNKIARDIFGILWDARASDDNAVDKIIDA 418

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  AIEK++DEV+ +N  +V      K    +  VGQVMK T GKANP  V  
Sbjct: 419 KGLKQISDTGAIEKIIDEVLANNAKSVEEFRSGKDKAFNALVGQVMKATKGKANPGQVSD 478

Query: 491 MLKEKL 496
           MLK+KL
Sbjct: 479 MLKKKL 484


>gi|262281194|ref|ZP_06058976.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter calcoaceticus RUH2202]
 gi|262257425|gb|EEY76161.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
           [Acinetobacter calcoaceticus RUH2202]
          Length = 489

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 249/495 (50%), Positives = 339/495 (68%), Gaps = 15/495 (3%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           A+   L  G    WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP
Sbjct: 4   AQKLKLIDG----WEVVIGIEIHTQLATNSKIFSGSSTEFGQDPNTQASLIDLAMPGVLP 59

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           +LN + V  A+  GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +
Sbjct: 60  VLNEKVVDLAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL 119

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
                    T  +G+ R HLE+DAGKS+HDQ+  +S IDLNR+G  L+EIV++PDMRS  
Sbjct: 120 ED-----GTTKRIGVTRAHLEEDAGKSVHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVE 174

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           EA A++  + +++R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  
Sbjct: 175 EAVAYIKSIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQ 234

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AI  E  RQ+ ILE GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I +
Sbjct: 235 AINVEIERQMEILEYGGSIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIIAD 294

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKI 364
           + I A +  +PELP A+R RFI +FG++ YDA VL   + +AD++E            K+
Sbjct: 295 EQIEAARAALPELPAARRTRFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAAQGKV 354

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGG 423
            ANWV+ +  G LN++   + D+P+S  QLG +I  I+D TISGKIAK +F  +WE +G 
Sbjct: 355 SANWVMGEFSGALNKANLDLADSPVSAEQLGGMIARIVDNTISGKIAKQVFGFMWESEGK 414

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGK 482
           +  +I+ E GL+Q TD  AIE ++ EV+ +N   V      K    +  VGQVMK + GK
Sbjct: 415 SADDIIAEKGLKQETDTGAIEAIIKEVLAANEKMVEEYKSGKEKAFNGLVGQVMKASKGK 474

Query: 483 ANPSIVQKMLKEKLG 497
           ANP+ V +++K+ +G
Sbjct: 475 ANPAQVNELMKKLIG 489


>gi|225849362|ref|YP_002729526.1| aspartyl/glutamyl-tRNA amidotransferase subunit B
           [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643915|gb|ACN98965.1| glu-trnagln amidotransferase suBunit b [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 482

 Score =  551 bits (1421), Expect = e-155,   Method: Composition-based stats.
 Identities = 231/480 (48%), Positives = 327/480 (68%), Gaps = 12/480 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +++VVIG+E H Q+S  +K+F G  V FGA PNT V     A PG LP++N   V+ AV 
Sbjct: 10  EFDVVIGLETHVQMSTKTKMFCGCEVEFGAPPNTNVCPVCLAHPGTLPVINKTAVEYAVK 69

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
             L LN  ++  S+ ARKNYFYPDLP+GYQISQ+DKP+  +G + + +G          +
Sbjct: 70  AALALNCKVHNLSIMARKNYFYPDLPKGYQISQYDKPLATDGYIEIKVGDS------FKK 123

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           + I R+H+E+DAGK+IH+   + S +DLNR+G  LMEIVT+PD+ S+ EA+ +L KLR+I
Sbjct: 124 IRIHRLHIEEDAGKTIHEG--SKSYVDLNRAGTPLMEIVTEPDISSAEEARKYLEKLRNI 181

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +RY+G  + +ME+G +R DVN+S+        GT+ E+KN+NS RF+  AIEYE  RQ  
Sbjct: 182 MRYIGVSEADMEKGQLRCDVNISLKPKGSSQLGTKVELKNINSFRFIVKAIEYEIERQAK 241

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           +L+ G  I QETRLFDP   +T ++RTKE+A DYRYF +PDLLP+ + +  I  IK  +P
Sbjct: 242 LLKKGEKIIQETRLFDPDSGKTYTMRTKEEAHDYRYFPDPDLLPILLKDSQIEEIKNSLP 301

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV--NRDKKIVANWVINDLLGVL 377
           ELPD K  R+I  F +  YDA VL SDK++A+YFE++     ++ K+V+NW++N+LLG L
Sbjct: 302 ELPDQKYYRYIQSFNLPPYDAEVLTSDKNLANYFEEVVKLFPQNPKLVSNWILNELLGKL 361

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N  G  IE++PIS N L EL+ LI DGTISGKIAK++F+I +E G +PK IVEE GL+Q+
Sbjct: 362 NEKGIDIENSPISANSLAELVSLIADGTISGKIAKEVFDIAFETGKSPKTIVEEKGLKQI 421

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           ++   I  +V  V+  +P  V +       ++ + VGQ+MK T GKANP +V K+LKE+L
Sbjct: 422 SNEDEIRSIVKAVLERHPAEVEKYKSGNEKILGFLVGQIMKETKGKANPQLVNKILKEEL 481


>gi|158334124|ref|YP_001515296.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Acaryochloris
           marina MBIC11017]
 gi|189045267|sp|B0BZQ6|GATB_ACAM1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|158304365|gb|ABW25982.1| aspartyl/glutamyl-tRNA amidotransferase B subunit [Acaryochloris
           marina MBIC11017]
          Length = 494

 Score =  551 bits (1421), Expect = e-155,   Method: Composition-based stats.
 Identities = 216/487 (44%), Positives = 305/487 (62%), Gaps = 9/487 (1%)

Query: 18  TTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQ 77
              ++E VIG+E H QLS  +K+F   S  FGA+PN QV      MPG+LP+LN   ++ 
Sbjct: 7   AKTEYEAVIGLETHCQLSTKTKIFCNCSTAFGADPNHQVCSICMGMPGVLPVLNETVLEY 66

Query: 78  AVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFR 137
           AV  G  LN  I KYS F RK YFYPDLP+ YQ+SQ D PI   G + V I   + G+  
Sbjct: 67  AVKAGRALNCEIAKYSKFDRKQYFYPDLPKNYQVSQFDLPIAEHGWLEVEIVD-EQGEAT 125

Query: 138 TIEVGIERIHLEQDAGKSIHDQ-----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKA 192
             ++GI R+H+E+DAGK +H        S  S +D NR+G+ L+EIV++PDMR+ LEA  
Sbjct: 126 RKKIGITRLHMEEDAGKLVHGGSDRLAGSTHSLVDFNRTGIPLIEIVSEPDMRTGLEAAE 185

Query: 193 FLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIE 251
           +  ++R I+RYLG  DGNM+EGS+R DVN+SV     + +GT+ E+KN+NS   +  AI+
Sbjct: 186 YAQEIRRIVRYLGVSDGNMQEGSLRCDVNISVRPRGQKEFGTKVEIKNMNSFSAIHRAID 245

Query: 252 YEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFI 311
           YE  RQI  +E G  I QETRL++     T  +R+KE + DYRYF EPDL P+E+    +
Sbjct: 246 YEIARQIEAIETGEPIIQETRLWEEGAQRTIGMRSKEGSSDYRYFPEPDLTPIEVAPSLL 305

Query: 312 RAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVI 370
           +  + ++PELP AKR R+  E G+S YD  +L  D +I  YFE         K  ANW++
Sbjct: 306 KQWQSELPELPAAKRHRYEEEIGLSPYDTRILTDDHAITQYFEATLKAGASAKQAANWLM 365

Query: 371 NDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVE 430
            D+ G LN    SI D  ++P  L ELI+LI   TISGKIAK++   L  KGG+PK++V+
Sbjct: 366 GDITGYLNNESLSITDIALTPEALAELIELIEANTISGKIAKELLPELLTKGGSPKKLVK 425

Query: 431 ELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQ 489
           + GL Q++D + +E ++DEV+ ++P  + +    K  L  +F+GQVMK T G+A+P    
Sbjct: 426 KKGLTQISDAATLESLIDEVLAAHPQELEQYRNGKTKLQGFFMGQVMKRTSGRADPKATN 485

Query: 490 KMLKEKL 496
           +ML +KL
Sbjct: 486 QMLAKKL 492


>gi|167585098|ref|ZP_02377486.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           ubonensis Bu]
          Length = 490

 Score =  551 bits (1421), Expect = e-155,   Method: Composition-based stats.
 Identities = 239/487 (49%), Positives = 334/487 (68%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGA   FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGAPTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + + I   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++    Q  + 
Sbjct: 64  GLAIGSTIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKQAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L  
Sbjct: 124 TINLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHG 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 184 LVVWLGICDGNMQEGSFRCDANVSVRPVGQEKFGTRAEIKNLNSFRFLEEAINYEVRRQI 243

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D++  +K  +
Sbjct: 244 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWVERVKAGM 303

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + K  ANW++ D+  
Sbjct: 304 PELPAAMQQRFVEQYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAANAKSAANWLMGDVSS 363

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT----PKEIVEE 431
            LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF ++W++  T       I++ 
Sbjct: 364 QLNRDGIEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFAMIWDEKATDERAADRIIDA 423

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++D+V+ +N  +V      K    +  +GQ MK T GKANP  V +
Sbjct: 424 KGLKQISDTGALEAIIDDVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVNE 483

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 484 LLKKKLG 490


>gi|260887169|ref|ZP_05898432.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Selenomonas
           sputigena ATCC 35185]
 gi|330839062|ref|YP_004413642.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Selenomonas
           sputigena ATCC 35185]
 gi|260863231|gb|EEX77731.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Selenomonas
           sputigena ATCC 35185]
 gi|329746826|gb|AEC00183.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Selenomonas
           sputigena ATCC 35185]
          Length = 479

 Score =  551 bits (1421), Expect = e-155,   Method: Composition-based stats.
 Identities = 224/484 (46%), Positives = 319/484 (65%), Gaps = 13/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+E+H++L   +K+F G +  FGAE NT V      +PG+LP+LN R V+ A+
Sbjct: 1   MNYEAVIGLEIHSELKTNTKIFCGCATKFGAEQNTHVCPVCLGLPGVLPVLNKRVVEFAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  INKYS F RKNY+YPDLP+ +Q SQ+D PI   G V +        +  T 
Sbjct: 61  KAGLALNCTINKYSKFDRKNYYYPDLPKNFQTSQYDLPIAEHGYVDIET------ENGTK 114

Query: 140 EVGIERIHLEQDAGKSIHDQ----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
            + I RIH+E+DAGK +H       S  S +D NR+GV L+EIV++PDM +  EA+A++ 
Sbjct: 115 RIRILRIHMEEDAGKLVHSGATITDSLTSNVDYNRTGVPLIEIVSEPDMSTPAEARAYME 174

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEA-WGTRCEVKNVNSIRFLGLAIEYEA 254
           K++SIL Y+   +  MEEG++RAD+N+S+   GE   GT+ E+KN+NS + +  A+ YE 
Sbjct: 175 KIKSILEYIDVSNCRMEEGNLRADLNISLRPAGEKTLGTKAEMKNINSFKAVEDALSYEI 234

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
            RQ  ILEDGGHI QETR +DP +  T+S+R+KE+A DYRY  EPDL+P+   E+ I A 
Sbjct: 235 ERQEEILEDGGHIVQETRTWDPERGVTKSMRSKEEAHDYRYMPEPDLVPIVTTEEEIEAY 294

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDL 373
           +K +PELPDA+RER++ EFG+S YDA ++ + +++A+YFE       D K  ANW++ DL
Sbjct: 295 RKGLPELPDARRERYMKEFGLSAYDAGIITASRAMAEYFEACLAGGADAKSAANWIMGDL 354

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
              LN  GK+IE++P+  ++L +++ LI  GTIS KIAK +F  +W     P++IVE+ G
Sbjct: 355 AKNLNAEGKTIEESPVEASRLAQMLALIEKGTISSKIAKKVFAEMWTSSDAPEKIVEDKG 414

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           L Q+TD  AIE +VD VI +NP  VA         +   VGQVMK + GKANP +V ++L
Sbjct: 415 LVQITDTKAIEAIVDAVIAANPKPVADYKSGNKKALGALVGQVMKQSKGKANPQMVNQLL 474

Query: 493 KEKL 496
            +KL
Sbjct: 475 ADKL 478


>gi|254251094|ref|ZP_04944412.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit [Burkholderia
           dolosa AUO158]
 gi|124893703|gb|EAY67583.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit [Burkholderia
           dolosa AUO158]
          Length = 491

 Score =  551 bits (1420), Expect = e-155,   Method: Composition-based stats.
 Identities = 242/487 (49%), Positives = 333/487 (68%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGA+PNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 5   WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACAVDLALPGVLPVLNRGAVERAIRF 64

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + A I   S+FARKNYFYPDLP+GYQISQ++ P+V  G +++ +  ++         
Sbjct: 65  GLAIGATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGAITIQVPANEKAGKPAYEK 124

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 125 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHA 184

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     + +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 185 LVVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRAEIKNLNSFRFLEEAINYEVRRQI 244

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D++  ++  +
Sbjct: 245 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGRDWVERVQAGM 304

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+  
Sbjct: 305 PELPAAMQQRFVEQYGVSAYDAGVLTSSKAMAAYFEAVVAKAGAANAKIAANWLMGDVSS 364

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVEE 431
            LNR G  I+  P+S  QL  L+  I DGTIS KIAK+IF  +WE+     G    I++ 
Sbjct: 365 QLNRDGIDIDAIPVSAAQLALLLQRIADGTISNKIAKEIFATMWEEKAADEGAADRIIDA 424

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V      K    +  +GQ MK T GKANP  V +
Sbjct: 425 KGLKQISDTGALEAIIDEVLAANAKSVEEFRAGKEKAFNALIGQAMKATKGKANPQQVNE 484

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 485 LLKKKLG 491


>gi|254294335|ref|YP_003060358.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Hirschia baltica
           ATCC 49814]
 gi|254042866|gb|ACT59661.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Hirschia baltica
           ATCC 49814]
          Length = 506

 Score =  551 bits (1420), Expect = e-155,   Method: Composition-based stats.
 Identities = 291/508 (57%), Positives = 362/508 (71%), Gaps = 24/508 (4%)

Query: 10  RSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPI 69
           R   + SG TGDWEVV+G+EVHAQ++  SKLFSGAS +FGA+PN  V+  D A+PGMLP+
Sbjct: 4   RKPLIISGITGDWEVVMGLEVHAQITSKSKLFSGASTHFGADPNCNVALVDTALPGMLPV 63

Query: 70  LNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIG 129
           +N  CV+QAV TGLGLNA IN +S F RKNYFYPDLPQGYQISQ   PIVGEG++ V + 
Sbjct: 64  INEFCVEQAVRTGLGLNAQINLFSRFDRKNYFYPDLPQGYQISQFQYPIVGEGEIEVELE 123

Query: 130 PDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLE 189
              S     I VGIER+H+EQDAGKSIHD     + +DLNRSGVALMEIV+KPD+RS  E
Sbjct: 124 DGSS-----ITVGIERLHMEQDAGKSIHDLDPNATYVDLNRSGVALMEIVSKPDIRSPKE 178

Query: 190 AKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCR-----------PGEAWGTRCEVK 238
           A A++ KLRSI+  LGTC+G M EG++RADVNVSVC+                GTRCE+K
Sbjct: 179 ASAYVKKLRSIVVALGTCNGVMAEGNLRADVNVSVCKVGGYDKFQETGDFSHLGTRCEIK 238

Query: 239 NVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSE 298
           NVNS RF+  A EYEARRQ+ I+EDGG I QETRLFD     TRS+R+KEDA DYRYF +
Sbjct: 239 NVNSFRFIEQAAEYEARRQVEIIEDGGVIDQETRLFDAETGVTRSMRSKEDAHDYRYFPD 298

Query: 299 PDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV 358
           PDLLPL + ++++  IK  +PELPD K++RFI E+G+  YDA VL ++   A +FE++A 
Sbjct: 299 PDLLPLVLTQEYVDKIKANLPELPDQKKQRFIDEYGLKAYDAGVLSAESDKAAFFEEVAK 358

Query: 359 NRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNIL 418
            RD K+ ANWV  +L G LN+    +ED+P+S  QLG LIDLI + TISGKIAKD+F  L
Sbjct: 359 GRDAKMAANWVTQELFGYLNKFDLELEDSPVSAKQLGGLIDLIANKTISGKIAKDVFQKL 418

Query: 419 WEK-GGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-------TKPNLVSW 470
            E+    P  IVE  GL+QVTD  AIEKVVDE++ +NP+ V ++         KP  + W
Sbjct: 419 IEEDDANPAAIVERDGLKQVTDTGAIEKVVDEIMAANPDQVEQVKAQFAEGHKKPKALGW 478

Query: 471 FVGQVMKNTGGKANPSIVQKMLKEKLGI 498
           FVGQ MK +GGKANP  V ++LK KLGI
Sbjct: 479 FVGQAMKLSGGKANPQAVNEILKSKLGI 506


>gi|284049092|ref|YP_003399431.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Acidaminococcus
           fermentans DSM 20731]
 gi|283953313|gb|ADB48116.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Acidaminococcus
           fermentans DSM 20731]
          Length = 482

 Score =  551 bits (1420), Expect = e-155,   Method: Composition-based stats.
 Identities = 218/483 (45%), Positives = 313/483 (64%), Gaps = 13/483 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           ++  VIG+EVHA+L   +K F   S  FG  PNT V      MPG LP++N + V+ A+ 
Sbjct: 3   EYTTVIGLEVHAELKTKTKAFCSCSTEFGGAPNTHVCPVCLGMPGALPVINKQMVEFALR 62

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
             L +N  I +YS F RKNY+YPDL + YQISQ  +PI   G + V++         T  
Sbjct: 63  FALAVNCEIQRYSKFDRKNYYYPDLAKAYQISQFYQPIALNGHLDVNVDG------ETKR 116

Query: 141 VGIERIHLEQDAGKSIHDQ----YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
           +GI RIH+E+DAGK +H       S  S +D NR+GV L+EIV++PDMRS+ EA+A++ K
Sbjct: 117 IGITRIHMEEDAGKLVHSGASISTSDFSAVDYNRAGVPLIEIVSEPDMRSAAEARAYMEK 176

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           LR+ L+Y G CDG M+EGSMR D N+S+     + +GTR E+KN+NS + L  AIEYE  
Sbjct: 177 LRAYLQYTGVCDGKMQEGSMRCDANISIMPVGSKEFGTRAEIKNLNSFKALERAIEYEVE 236

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQ  ILEDGGH+ QETR +D ++  T S+R+KE+A DYRYF EPDL P+ I+++++   K
Sbjct: 237 RQKEILEDGGHVVQETRTWDDAQGMTFSMRSKEEAHDYRYFPEPDLAPIIIEKEWVEKAK 296

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYF-EKLAVNRDKKIVANWVINDLL 374
            ++PELPDA++ R + E G+  Y A ++V+DK +A+YF    A   D K VANW++ D+ 
Sbjct: 297 SELPELPDARKARLMNEKGLDDYSAELIVADKKMAEYFDAAAAETDDAKGVANWILGDVS 356

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
             LN +   I D P+SP  LG+++ LI  G +S K+AK +F  + +K   P ++V++LGL
Sbjct: 357 AYLNSNSCGIGDFPVSPAHLGQMVALIKKGVLSSKLAKKVFAEMLKKDEAPADLVKKLGL 416

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            QV+D  AI+ +VDE I +NP +VA     K   + + VGQVMK + GKANP +V K++ 
Sbjct: 417 EQVSDEGAIQAMVDEAIAANPQSVADYKAGKDKAIGFLVGQVMKKSRGKANPGMVNKLII 476

Query: 494 EKL 496
           + +
Sbjct: 477 KTI 479


>gi|312797576|ref|YP_004030498.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Burkholderia rhizoxinica HKI 454]
 gi|312169351|emb|CBW76354.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (EC
           6.3.5.-) [Burkholderia rhizoxinica HKI 454]
          Length = 539

 Score =  551 bits (1420), Expect = e-154,   Method: Composition-based stats.
 Identities = 237/489 (48%), Positives = 331/489 (67%), Gaps = 11/489 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
           T  WEVVIG+E H QLS  SK+FSGA+  FGAEPNTQ    D A+PG LP++N   V++A
Sbjct: 50  TMQWEVVIGLETHVQLSTQSKIFSGAATRFGAEPNTQACALDLALPGTLPVVNRGAVERA 109

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSG--QF 136
           +  GL + A I   SVFARKNYFYPDLP+GYQISQ++ P+V  G +++ +  ++      
Sbjct: 110 IRFGLAIGAAIAPRSVFARKNYFYPDLPKGYQISQYELPVVQGGSITIQVEANEKAGRDA 169

Query: 137 RTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
               + + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+PDMRS+ EA A+   
Sbjct: 170 YEKTIRLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKA 229

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L S++ +LG CDGNM+EGS R D NVSV R   +A GTR E+KN+NS RFL  AI+YE R
Sbjct: 230 LHSLVVWLGICDGNMQEGSFRCDANVSVRRLGEQALGTRAEIKNLNSFRFLEEAIQYEVR 289

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI ++EDGG + QETRL+DP + ETRS+R+KEDA DYRYF +PDL+PL ID ++I  + 
Sbjct: 290 RQIELIEDGGTVVQETRLYDPDRGETRSMRSKEDAHDYRYFPDPDLMPLVIDSEWIAEVG 349

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN---RDKKIVANWVIND 372
           + +PELPDA + RF  ++G+  YDA +L + +++A Y+E++       + K+ ANWV+ +
Sbjct: 350 RALPELPDAMKRRFTEQYGLPGYDAGMLTTSQALAAYYEQVVSKAGVANAKMAANWVMGE 409

Query: 373 LLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT----PKEI 428
           L   LNR G  I  +P+S  QL  ++  I DGTIS KI K IF  +W++  T       I
Sbjct: 410 LASQLNRDGLDIAQSPVSAAQLALVLVRIADGTISNKIGKAIFGAIWDEKATDDTAADRI 469

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSI 487
           ++  GLRQ++D  A+E ++DEV+ +NP +V      K    +  VGQ MK T G+ANP  
Sbjct: 470 IDAKGLRQISDSGALEAILDEVLAANPKSVDEYRAGKDKAFNALVGQAMKATKGRANPQQ 529

Query: 488 VQKMLKEKL 496
           V ++LK+KL
Sbjct: 530 VNELLKKKL 538


>gi|88800237|ref|ZP_01115805.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Reinekea sp.
           MED297]
 gi|88777083|gb|EAR08290.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Reinekea sp.
           MED297]
          Length = 477

 Score =  551 bits (1420), Expect = e-154,   Method: Composition-based stats.
 Identities = 246/479 (51%), Positives = 323/479 (67%), Gaps = 8/479 (1%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+EVH QLS  +K+FSG+S  FGAEPNTQ +  D  +PG+LP+ N   +++AV
Sbjct: 1   MQWETVIGLEVHVQLSTNTKIFSGSSTAFGAEPNTQANAVDLGLPGVLPVFNEGALKKAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL ++A I K S F RKNYFYPDLP+GYQ +Q + PIVG G V + +   +     T 
Sbjct: 61  AFGLAIDADIGKRSFFERKNYFYPDLPKGYQTTQLEAPIVGPGHVDILLDDGE-----TK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V I   HLE+DAGKS+H+ +  +S IDLNR+G  L+EIVT+PDMRSS EA AF  KL +
Sbjct: 116 RVRIHHAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLIEIVTEPDMRSSAEAVAFAKKLHT 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+  +G CDG+M +GSMR DVNVS+     +  GTR E KN+NS RF+  AI+ E  RQI
Sbjct: 176 IVTAIGICDGDMSQGSMRFDVNVSIRPKGSDTLGTRTETKNLNSFRFMEEAIKLEVERQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            +LEDGG I QETRL++      RS+R+KE+A DYRYF  PDLLP+ ID+D+I +I+  +
Sbjct: 236 DVLEDGGEIIQETRLYNGDTKTARSMRSKEEANDYRYFPCPDLLPVVIDDDYINSIRSTL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELPDAK ERFI  +G++ YDASVL +  ++ADYFE+      D K+ ANW + +L   L
Sbjct: 296 PELPDAKIERFIDSYGLTQYDASVLSATAAMADYFEQTTKICGDAKLAANWCMGELSKFL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+    I D PISPN LG+L+  I D TISGKIAK +F  +    G+  EI++  GL+QV
Sbjct: 356 NQQEIDIADCPISPNDLGQLLARIKDDTISGKIAKTVFQAMTNGEGSADEIIDAKGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           TD  AIE +VDEVI +N      +   K  L+ +FVGQVMK + G+ANP  V K+LK+K
Sbjct: 416 TDTGAIEAMVDEVIAANQGQFEELKSGKDKLIGFFVGQVMKASKGQANPGQVNKILKQK 474


>gi|167834998|ref|ZP_02461881.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Burkholderia
           thailandensis MSMB43]
          Length = 490

 Score =  551 bits (1420), Expect = e-154,   Method: Composition-based stats.
 Identities = 246/487 (50%), Positives = 337/487 (69%), Gaps = 11/487 (2%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMT 81
           WEVVIG+E HAQLS VSK+FSGAS  FGAEPNTQ    D A+PG+LP+LN   V++A+  
Sbjct: 4   WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRF 63

Query: 82  GLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKS--GQFRTI 139
           GL + A +   S+FARKNYFYPDLP+GYQISQ++ P+V  G++++ +  ++       + 
Sbjct: 64  GLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQGGQITIQVPANEKAGKDAYSK 123

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            V + R HLE+DAGKS+H+ ++ ++ IDLNR+G  L+EIVT+P+MRS+ EA A+   L +
Sbjct: 124 TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPEMRSAAEAVAYAKALHA 183

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCR-PGEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++ +LG CDGNM+EGS R D NVSV     E +GTR E+KN+NS RFL  AI YE RRQI
Sbjct: 184 LVVWLGICDGNMQEGSFRCDANVSVRPLGQEKFGTRAEIKNLNSFRFLEDAINYEVRRQI 243

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP K ETRS+R+KEDA DYRYF +PDL+PL I  D+I  +K ++
Sbjct: 244 ELIEDGGEVVQETRLYDPDKRETRSMRSKEDAHDYRYFPDPDLMPLVIGADWIERVKGEM 303

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE---KLAVNRDKKIVANWVINDLLG 375
           PELP A ++RF+ ++G+S YDA VL S K++A YFE     A   + KI ANW++ D+  
Sbjct: 304 PELPAAMQQRFVEQYGVSAYDAGVLTSTKAMAAYFEAVVAKAGAANAKIAANWLMGDVSS 363

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEK----GGTPKEIVEE 431
            LNR G  I+  P+S  QL  ++  I DGTIS KIAK+IF  +W++     G    I+E 
Sbjct: 364 QLNRDGVEIDAIPVSAAQLALVLQRIADGTISNKIAKEIFVTIWDEKAADEGAADRIIEA 423

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQK 490
            GL+Q++D  A+E ++DEV+ +N  +V    A K    +  VGQ MK T GKANP  V +
Sbjct: 424 KGLKQISDTGALEAIIDEVLAANAKSVEEFHAGKEKAFNALVGQAMKATKGKANPQQVNE 483

Query: 491 MLKEKLG 497
           +LK+KLG
Sbjct: 484 LLKKKLG 490


>gi|319790110|ref|YP_004151743.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermovibrio
           ammonificans HB-1]
 gi|317114612|gb|ADU97102.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermovibrio
           ammonificans HB-1]
          Length = 485

 Score =  551 bits (1419), Expect = e-154,   Method: Composition-based stats.
 Identities = 223/487 (45%), Positives = 319/487 (65%), Gaps = 15/487 (3%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            ++E VIG+EVHAQL   +K+F      FGA PNT V      MPG LP+LN R V+ AV
Sbjct: 1   MEFEAVIGLEVHAQLLTKTKIFCSCKNEFGAPPNTNVCPVCLGMPGALPVLNKRAVEFAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
              L LN  IN YSVFARK+YFYPDLP+ YQI+Q++ P    G V +             
Sbjct: 61  KAALALNCKINTYSVFARKHYFYPDLPKAYQITQYELPFAENGWVEIE-----KSDGTKK 115

Query: 140 EVGIERIHLEQDAGKSIH-DQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
            + I RIH+E+DAGK+IH + +   S +DLNR+G  L+EIV++PD+ +  EA+ ++ KLR
Sbjct: 116 RIRIRRIHMEEDAGKTIHGEGFDNNSYVDLNRAGTPLIEIVSEPDISTPEEARLYMQKLR 175

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
            IL ++G  DGN+EEGS+R D NVS+     +  GTR E+KNVNS RF+  A+EYE  RQ
Sbjct: 176 DILVWIGVNDGNLEEGSLRCDANVSIRPKGSKELGTRTEIKNVNSFRFIQKALEYEIERQ 235

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I +++ GG I QETRLFD  K  T+++RTKE+A DYRYF EPDL PL ID++++ AI++ 
Sbjct: 236 IKVVKSGGEIVQETRLFDSQKGITKTMRTKEEAEDYRYFPEPDLPPLIIDKEWLDAIRES 295

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK--LAVNRDKKIVANWVINDLLG 375
           +PELPD  +ERF+ ++G++ YDASVLV D+++A +FE+   A + + K VAN +I+DLLG
Sbjct: 296 LPELPDQVKERFVSDYGLTPYDASVLVRDRALATFFEEAAKAYSGEPKKVANILISDLLG 355

Query: 376 VLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAK-DIFNILWEKGGTPKEIVEELGL 434
            LN +   I D+P+ P  L +L++L+    IS ++AK ++   + + G  PK IVEE GL
Sbjct: 356 ALNEAKLDIADSPVKPEHLAQLLELVDREVISLRVAKEEVIPEMVKSGKEPKLIVEEKGL 415

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIAT-----KPNLVSWFVGQVMKNTGGKANPSIVQ 489
            Q++D SA+ +V+ +V  +N   V +        K   V + +GQVMK T GKANP ++ 
Sbjct: 416 VQISDESALTEVIKKVFANNEKAVKQYKEGNEKQKKKAVKFLIGQVMKETRGKANPKLLN 475

Query: 490 KMLKEKL 496
           +++ + L
Sbjct: 476 ELIPKLL 482


>gi|302185334|ref|ZP_07262007.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. syringae 642]
          Length = 481

 Score =  551 bits (1419), Expect = e-154,   Method: Composition-based stats.
 Identities = 243/484 (50%), Positives = 338/484 (69%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV
Sbjct: 1   MQWEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL +NA I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + + +           
Sbjct: 61  KFGLAVNAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDIPLED-----GTVK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMR++ EA A++  + +
Sbjct: 116 RIGITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRNAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RYLG CDGNM EGS+R D NVS+       +GTRCE+KNVNS RF+  AI  E +RQI
Sbjct: 176 IVRYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ F+   +  +
Sbjct: 236 DLIEDGGKVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFLDETRATL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELP  KRERF  +FG+S YDASVL S +  ADYFE++   + D K+ ANWV+ +L  +L
Sbjct: 296 PELPPQKRERFQSQFGLSTYDASVLASSREQADYFEQVVSISGDAKLAANWVMVELGSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  I+++P+S  QLG ++  IID TISGKIAK +F  +    G+  E++E+ GL+QV
Sbjct: 356 NKQGLEIDESPVSAEQLGGMLKRIIDNTISGKIAKMVFEAMANGEGSADEVIEKRGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIE ++DE++ +N   V +        +  +  +FVGQ MK + GKANP  V  +L
Sbjct: 416 TDSGAIESMLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNALL 475

Query: 493 KEKL 496
           K KL
Sbjct: 476 KAKL 479


>gi|124265279|ref|YP_001019283.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Methylibium petroleiphilum PM1]
 gi|124258054|gb|ABM93048.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Methylibium petroleiphilum PM1]
          Length = 482

 Score =  551 bits (1419), Expect = e-154,   Method: Composition-based stats.
 Identities = 224/489 (45%), Positives = 307/489 (62%), Gaps = 12/489 (2%)

Query: 11  SESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPIL 70
           + +L  G    +EVVIG+E H QLS  SK+FSGA   FGA PNTQ    D A+PG LP++
Sbjct: 4   APALIRG----YEVVIGLETHTQLSTASKIFSGAPTAFGAAPNTQACAVDLALPGSLPVM 59

Query: 71  NGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGP 130
           N   V++A+  GL +   I   S+FARKNYFYPDLP+GYQISQ++ P+V  G V   +  
Sbjct: 60  NRGAVERAIRFGLAVGGQIAPLSIFARKNYFYPDLPKGYQISQYELPVVQGGTVEFYLAD 119

Query: 131 DKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEA 190
                    +V + R HLE+DAGKS+HD +  +S IDLNR+G  L+EIV++PDMRSS EA
Sbjct: 120 V------PHQVRLTRAHLEEDAGKSVHDAFDGLSGIDLNRAGTPLLEIVSEPDMRSSKEA 173

Query: 191 KAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAI 250
             +   L +++ +LG CDGNM+EGS R D NVSV RPG  +GTR E+KN+NS RFL  AI
Sbjct: 174 VEYAKALHALVVWLGICDGNMQEGSFRCDANVSVRRPGAPFGTRREIKNLNSFRFLQQAI 233

Query: 251 EYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDF 310
           ++E + QI  +EDG  IRQ T LF+P   ETR++RTKEDA DYRYF +PDL PL I  ++
Sbjct: 234 DFEIQWQIDQIEDGLAIRQATVLFNPDSGETRAMRTKEDAHDYRYFPDPDLPPLVIAPEW 293

Query: 311 IRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWV 369
           I  +  ++PELP     RF  E G++ YDAS++    ++A Y+E         K+ ANW+
Sbjct: 294 IARVTGEMPELPRVMAARFEREDGLAAYDASMMTQSLAVARYYEATKAAGAPAKLAANWL 353

Query: 370 INDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIV 429
           + +L   LN     I+ +P+SP  L  LI  I DGTIS   AK +F+ LW        ++
Sbjct: 354 MGELSRRLNAEELGIDASPVSPATLAALIARIADGTISNNGAKQVFDALWNGETDVDAVI 413

Query: 430 EELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIV 488
              GL+Q++D   +  +VD V+ +NP +V      K    +  VGQ MK + GKANP+ +
Sbjct: 414 SAKGLKQMSDSGELSAIVDAVLAANPKSVDEYRAGKDKAFNALVGQAMKASKGKANPTQL 473

Query: 489 QKMLKEKLG 497
            ++LK+KLG
Sbjct: 474 SELLKKKLG 482


>gi|330963988|gb|EGH64248.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           syringae pv. actinidiae str. M302091]
          Length = 487

 Score =  551 bits (1419), Expect = e-154,   Method: Composition-based stats.
 Identities = 248/490 (50%), Positives = 338/490 (68%), Gaps = 18/490 (3%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E+H QLS  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ AV
Sbjct: 1   MQWEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + + +           
Sbjct: 61  KFGLAVDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDIPLED-----GTVK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            VGI R HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A++  + +
Sbjct: 116 RVGITRAHLEEDAGKSLHEDFQGMTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           I+RYLG CDGNM EGS+R D NVS+       +GTRCE+KNVNS RF+  AI  E +RQI
Sbjct: 176 IVRYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + Q+TRL+DP+ NETR++R+KE+A DYRYF +PDLLP+ I++ FI   +  +
Sbjct: 236 DLIEDGGRVIQQTRLYDPNTNETRAMRSKEEANDYRYFPDPDLLPVIIEDSFIEETRATL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELP  KRERF  +FG+S YDASVL S +  ADYFEK+   + D K+ ANWV+ +L  +L
Sbjct: 296 PELPPQKRERFQSQFGLSTYDASVLASSREQADYFEKVVSISGDAKLAANWVMVELGSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE------KGGTPKEIVEE 431
           N+ G  I+D+P+S  QLG ++  I D TISGKIAK +F  + +        G+  EI+E 
Sbjct: 356 NKHGIEIKDSPVSAEQLGGMLKRITDNTISGKIAKTVFEAIADSEAVAIGEGSADEIIER 415

Query: 432 LGLRQVTDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPS 486
            GL+QVTD  AIE ++DEV+ +N   V +        +  +  +FVGQ MK + GKANP 
Sbjct: 416 RGLKQVTDSGAIESMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQ 475

Query: 487 IVQKMLKEKL 496
            V ++LK KL
Sbjct: 476 QVNELLKAKL 485


>gi|293602410|ref|ZP_06684856.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Achromobacter
           piechaudii ATCC 43553]
 gi|292819172|gb|EFF78207.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Achromobacter
           piechaudii ATCC 43553]
          Length = 485

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 235/490 (47%), Positives = 320/490 (65%), Gaps = 18/490 (3%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +WE+VIG+E H QLS  SK+FSG+S  FGA PNT  +  D A+PG LP++N    ++A+
Sbjct: 1   MNWEIVIGLETHTQLSTDSKIFSGSSTQFGAAPNTHANEVDLALPGSLPVMNRGAAERAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL + A I   SVFARKNYFYPDLP+GYQISQ++ P+V  G +S  +G ++       
Sbjct: 61  RFGLAVGATIAPRSVFARKNYFYPDLPKGYQISQYELPVVVGGSLSFFVGEEE------K 114

Query: 140 EVGIERIHLEQDAGKSIHDQY-----SAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFL 194
            V + R HLE+DAGKS+HD +     S  S IDLNR+G  L+EIVT+P+MRS+ EA ++ 
Sbjct: 115 TVNLTRAHLEEDAGKSLHDDFTLANGSPASGIDLNRAGTPLLEIVTEPEMRSAAEAVSYA 174

Query: 195 TKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYE 253
             L S++ +LG CDGNM+EGS R D NVSV     + +GTR E+KNVNS RFL  AI YE
Sbjct: 175 RALHSLVVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRTEIKNVNSFRFLERAIVYE 234

Query: 254 ARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRA 313
           ARRQI ++EDGG + QETRL+D  ++ETRS+R+KEDA DYRYF +PDL  L I   ++  
Sbjct: 235 ARRQIELIEDGGTVVQETRLYDADRDETRSMRSKEDAHDYRYFPDPDLPTLVISPAWVDE 294

Query: 314 IKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV---NRDKKIVANWVI 370
           ++  +PELP A+R RF  EFG+  YDA+ L   + +A YF+ +A        K+ ANWV+
Sbjct: 295 VRAAMPELPAAQRARFEKEFGLPAYDAAQLTVSRDLAVYFQAVANALPAGQAKLAANWVM 354

Query: 371 NDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILW--EKGGTPKEI 428
            ++   LN+  K+I ++P+    L  LI  IIDGTIS KIA+++F  +W  E GG    I
Sbjct: 355 GEVAAALNKEEKNIAESPVQAPALAALIGRIIDGTISNKIAREVFGAMWAGENGGDADAI 414

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSI 487
           ++  GL+Q++D  AI  ++DEV+ +NP  V      K    +  VGQ+MK   GKANP  
Sbjct: 415 IDARGLKQISDTGAIGAMIDEVLAANPAIVEEYRAGKQKAFNSLVGQIMKAARGKANPQQ 474

Query: 488 VQKMLKEKLG 497
           V  +LKEKL 
Sbjct: 475 VNDLLKEKLD 484


>gi|152989653|ref|YP_001350434.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           aeruginosa PA7]
 gi|166198805|sp|A6VBJ9|GATB_PSEA7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|150964811|gb|ABR86836.1| Glu-tRNA(Gln) amidotransferase subunit B [Pseudomonas aeruginosa
           PA7]
          Length = 481

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 246/484 (50%), Positives = 339/484 (70%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+E+HAQL+  SK+FSG+   FGA PNTQ S  D AMPG LP+LN   V+ A 
Sbjct: 1   MQWETVIGLEIHAQLATQSKIFSGSPTAFGAAPNTQASLVDLAMPGTLPVLNEEAVRMAC 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           + GL ++A I++ +VFARKNYFYPDLP+GYQ SQ D PIVG+G + +++         T 
Sbjct: 61  LFGLAIDARIDRQNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITLED-----GTTR 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +GI R HLE+DAGKS+H+ +  +S IDLNR+G  L+EIV++PD+RS+ EA A++  + +
Sbjct: 116 RIGITRAHLEEDAGKSLHEDFQGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYLG CDGNM EGS+R D NVSV       +GTR E+KNVNS RF+  AI +E +RQI
Sbjct: 176 LVRYLGICDGNMAEGSLRCDCNVSVRPKGQAEFGTRAEIKNVNSFRFIEKAINHEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP+K+ETRS+R KE+A DYRYF  PDLLP+ I+ +++  +++Q+
Sbjct: 236 ELIEDGGKVVQETRLYDPNKDETRSMRGKEEANDYRYFPCPDLLPVIIEPEYLAKLREQL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELP  KRERF  ++G+S YDASVL + + +ADYFEK+     D K+ ANWV+ +L  +L
Sbjct: 296 PELPVQKRERFESQYGLSAYDASVLSASREMADYFEKVQEICGDAKLAANWVMVELGSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  IE +P+S  QLG +I  I D TISGKIAK +F  +    G+  +I+E  GL+QV
Sbjct: 356 NKDGLEIEQSPVSAEQLGGMILRIKDNTISGKIAKMVFEAMANGEGSADQIIEAKGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AIEK++DEV+ +N   V +        +  +  +FVGQ MK + GKANP  V ++L
Sbjct: 416 TDSGAIEKMLDEVLTANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELL 475

Query: 493 KEKL 496
           K+KL
Sbjct: 476 KKKL 479


>gi|330807532|ref|YP_004351994.1| Amidase, (aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase),
           subunit B [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375640|gb|AEA66990.1| Amidase, (aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase),
           subunit B [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 481

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 243/484 (50%), Positives = 338/484 (69%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E+H QL+  SK+FSG+S  FG+EPNTQ S  D  MPG+LP+LN   V+ AV
Sbjct: 1   MQWEVVIGLEIHTQLTTRSKIFSGSSTTFGSEPNTQASLVDLGMPGVLPVLNAEAVRMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           M GL ++A I +++VFARKNYFYPDLP+GYQISQ + PIVG+G + +++           
Sbjct: 61  MFGLAIDAEIGQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDIALED-----GTVK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            VGI R HLE+DAGKS+H++++  + IDLNR+G  L+EIV++PDMRS+ EA A++  + +
Sbjct: 116 RVGITRAHLEEDAGKSLHEEFNGATGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYLG CDGNM EGS+R D NVS+       +GTRCE+KNVNS RF+  AI  E +RQI
Sbjct: 176 LVRYLGICDGNMAEGSLRCDCNVSIRPKGQVEFGTRCEIKNVNSFRFIEKAINSEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + Q+TRL+DP+K+ETR +R+KE+A DYRYF +PDLLP+ I+  F+  ++  +
Sbjct: 236 ELIEDGGKVIQQTRLYDPNKDETRPMRSKEEANDYRYFPDPDLLPVVIENSFLDEVRATL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELP  KRERF  +FG+S YDA+VL + +  ADYFEK+     D K+ ANWV+ +L  +L
Sbjct: 296 PELPPQKRERFQAQFGLSSYDANVLATSREQADYFEKVVSIGGDAKLAANWVMVELGSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  I+ +P+S  QLG ++  I D TISGKIAK +F  +    G+  EI+E+ GL+QV
Sbjct: 356 NKQGLEIDQSPVSAEQLGGMLVRIKDNTISGKIAKMVFEAMANGEGSADEIIEKRGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AI  V+DE++ +N   V +        +  +  +FVGQ MK + GKANP  V ++L
Sbjct: 416 TDTGAISAVLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPQQVNELL 475

Query: 493 KEKL 496
           K KL
Sbjct: 476 KSKL 479


>gi|294651328|ref|ZP_06728649.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acinetobacter
           haemolyticus ATCC 19194]
 gi|292822800|gb|EFF81682.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 489

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 249/495 (50%), Positives = 337/495 (68%), Gaps = 15/495 (3%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           A+   L  G    WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP
Sbjct: 4   AQKLKLIDG----WEVVIGIEIHTQLATKSKIFSGSSTEFGQDPNTQASLVDLAMPGVLP 59

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           +LN   V  A+  GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +
Sbjct: 60  VLNAEVVDLAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL 119

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
                       +G+ R HLE+DAGKSIHDQ+  +S IDLNR+G  L+EIV++PDMRS  
Sbjct: 120 ED-----GTVKRIGVTRAHLEEDAGKSIHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVE 174

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           EA A++  + +++R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  
Sbjct: 175 EAVAYIKAIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQ 234

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AI  E  RQ+ ILE GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I  
Sbjct: 235 AINVEIERQMEILEYGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIISN 294

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKI 364
           + I A +  +PELP A+RERFI +FG++ YDA VL   + +AD++E         +  K+
Sbjct: 295 EQIEAARAALPELPAARRERFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKV 354

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGG 423
            ANWV+ +  G LN++G  + D+P+S  QLG +I  I+D TI+GKIAK +F  +WE  G 
Sbjct: 355 SANWVMGEFSGALNKAGLDLADSPVSAEQLGGMIARIVDNTINGKIAKQVFGFMWEADGK 414

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGK 482
           +  +I+ E GL+Q TD  AIE ++ +V+ +N   V      K    +  VGQVMK   GK
Sbjct: 415 SADDIIAEKGLKQETDTGAIEAIIKDVLAANEKMVEEYKSGKEKAFNGLVGQVMKAAKGK 474

Query: 483 ANPSIVQKMLKEKLG 497
           ANP+ V +++K+ +G
Sbjct: 475 ANPAQVNELMKKLIG 489


>gi|313673010|ref|YP_004051121.1| aspartyl/glutamyl-tRNA(asn/gln) amidotransferase subunit b
           [Calditerrivibrio nitroreducens DSM 19672]
 gi|312939766|gb|ADR18958.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Calditerrivibrio nitroreducens DSM 19672]
          Length = 478

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 219/483 (45%), Positives = 314/483 (65%), Gaps = 12/483 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             +E VIG+EVH QL+  +K+F      FG EPNT V      MPG+LP+LN + V+  V
Sbjct: 1   MKFEPVIGLEVHVQLNTNTKIFCSCPTTFGEEPNTNVCPVCLGMPGVLPVLNEKVVEYTV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GL LN  I + SVFARKNYFYPDLP+ YQISQ + PI  +G V +        +    
Sbjct: 61  KAGLALNCKIQQKSVFARKNYFYPDLPKNYQISQFELPICLDGFVDIDT------ENGVK 114

Query: 140 EVGIERIHLEQDAGKSIHDQ---YSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTK 196
            +GI RIH+E+DAGK IH +       S +D NR+G  LMEIV++PDMRSS EAKA+L K
Sbjct: 115 RIGITRIHMEEDAGKLIHGENLGNPNSSYVDYNRTGTPLMEIVSEPDMRSSEEAKAYLEK 174

Query: 197 LRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEAR 255
           L+ IL Y G  D +ME+GS+R D NVSV     + +GT+ E+KN+NS + +  AI+YE R
Sbjct: 175 LKLILEYTGVSDCSMEKGSLRCDANVSVRPIGQKEFGTKVEIKNMNSFKNVQKAIDYEIR 234

Query: 256 RQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIK 315
           RQI+ +E G  I QETRL+DP K  T S+R+KE++ DYRYF +PDL+P+ + +D I +IK
Sbjct: 235 RQISEIESGNIIVQETRLWDPEKGITISMRSKEESHDYRYFPDPDLVPVVVTKDMIDSIK 294

Query: 316 KQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLL 374
           K +PE+PD    + I ++ +  YDASVLVS K ++D+F + +   ++ K ++NW+  +++
Sbjct: 295 KTLPEMPDKVLAKLISDYNLPEYDASVLVSSKELSDFFFETSKLTKNYKAISNWIQTEIM 354

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGL 434
            V+N     I +  ISP  L ELI L+ +  IS KIAK +F+ + ++  +P+E+V+E GL
Sbjct: 355 RVMNEKDCLINEVGISPAHLSELITLVDENVISLKIAKSLFDDILKEKRSPRELVKEKGL 414

Query: 435 RQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
            Q+ D  A+E+VV +V+++    V R    +  L+ +FVGQ+MK T GKANP IV ++L 
Sbjct: 415 VQIADEGALEEVVKKVLSACSKEVERYKNGETKLIGFFVGQIMKETKGKANPKIVNELLT 474

Query: 494 EKL 496
           + L
Sbjct: 475 KLL 477


>gi|170723446|ref|YP_001751134.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudomonas
           putida W619]
 gi|229486430|sp|B1JDP2|GATB_PSEPW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|169761449|gb|ACA74765.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Pseudomonas putida
           W619]
          Length = 481

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 243/484 (50%), Positives = 334/484 (69%), Gaps = 12/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WEVVIG+E+H QL+  SK+FSG++  FG+EPNTQ S  D  MPG+LP+LN   V+ A 
Sbjct: 1   MQWEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNQEAVRMAC 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           M GL ++A I K +VFARKNYFYPDLP+GYQISQ D PIVG+G + +++           
Sbjct: 61  MFGLAIDAQIGKRNVFARKNYFYPDLPKGYQISQMDLPIVGKGHLDIALED-----GTIK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            +G+ R HLE+DAGKS+H+ +S  + IDLNR+G  L+EIV++PDMRS+ EA A++  + +
Sbjct: 116 RIGVTRAHLEEDAGKSLHEDFSGSTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQI 258
           ++RYLG CDGNM EGS+R D NVS+       +GTRCE+KNVNS RF+  AI  E +RQI
Sbjct: 176 LVRYLGICDGNMAEGSLRCDCNVSIRPKGQAEFGTRCEIKNVNSFRFIERAINSEIQRQI 235

Query: 259 AILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            ++EDGG + QETRL+DP+K+ETRS+R+KE+A DYRYF +PDLLP+ I++ F+  I+  +
Sbjct: 236 DLIEDGGKVVQETRLYDPNKDETRSMRSKEEANDYRYFPDPDLLPVVIEDSFLETIRTGL 295

Query: 319 PELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV-NRDKKIVANWVINDLLGVL 377
           PELP  K ERF  ++G+S YDA+VL S +  ADYFE++     D K+ ANWV+ +L  +L
Sbjct: 296 PELPPQKVERFQSQYGLSAYDANVLASSREQADYFEQVVKIGGDAKLAANWVMVELGSLL 355

Query: 378 NRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQV 437
           N+ G  I+  P+S  QLG ++  I D TISGKIAK +F  +    G    I+E  GL+QV
Sbjct: 356 NKLGIEIDQAPVSAEQLGGMLLRIRDNTISGKIAKTVFEAMAAGEGDADSIIESKGLKQV 415

Query: 438 TDLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           TD  AI+K++DEV+ +N   V +        +  +  +FVGQ MK + GKANP  V ++L
Sbjct: 416 TDTGAIDKMLDEVLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPGQVNQLL 475

Query: 493 KEKL 496
           K KL
Sbjct: 476 KAKL 479


>gi|262371804|ref|ZP_06065083.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter junii SH205]
 gi|262311829|gb|EEY92914.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acinetobacter junii SH205]
          Length = 489

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 250/495 (50%), Positives = 338/495 (68%), Gaps = 15/495 (3%)

Query: 9   ARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLP 68
           A+   L  G    WEVVIGIE+H QL+  SK+FSG+S  FG +PNTQ S  D AMPG+LP
Sbjct: 4   AQKLKLIDG----WEVVIGIEIHTQLATKSKIFSGSSTEFGQDPNTQASLVDLAMPGVLP 59

Query: 69  ILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSI 128
           +LN   V  A+  GLG++A+I++ SVFARKNYFYPD P+GYQISQ D PIVG G + + +
Sbjct: 60  VLNAEVVDLAIRFGLGIDAYIDQASVFARKNYFYPDSPKGYQISQMDNPIVGLGHIDIQL 119

Query: 129 GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSL 188
                       +G+ R HLE+DAGKSIHDQ+  +S IDLNR+G  L+EIV++PDMRS  
Sbjct: 120 ED-----GTVKRIGVTRAHLEEDAGKSIHDQFEGMSGIDLNRAGTPLLEIVSEPDMRSVE 174

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           EA A++  + +++R+LG  DGNM EGS RAD NVS+ RPG+ +GTRCE+KN+NS RF+  
Sbjct: 175 EAVAYIKAIHTLVRWLGISDGNMAEGSFRADCNVSLRRPGQPFGTRCELKNLNSFRFIEQ 234

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AI  E  RQ+ ILE GG I QETRLFDP+K ETRS+R+KE+A DYRYF +PDLLP+ I  
Sbjct: 235 AINVEIERQMEILEYGGEIDQETRLFDPNKMETRSMRSKEEANDYRYFPDPDLLPVIISN 294

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE----KLAVNRDKKI 364
           + I A +  +PELP A+RERFI +FG++ YDA VL   + +AD++E         +  K+
Sbjct: 295 EQIEAARAALPELPAARRERFIADFGVTEYDAHVLTLSREMADFYEAVVAAAGGAKQGKV 354

Query: 365 VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGG 423
            ANWV+ +  G LN++G  + D+P+S  QLG +I  I+D TI+GKIAK +F  +WE +G 
Sbjct: 355 SANWVMGEFSGALNKAGLELADSPVSAEQLGGMIARIVDNTINGKIAKQVFGFMWEAEGK 414

Query: 424 TPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGK 482
           +  EI+ E GL+Q TD  AIE ++ +V+ +N   V      K    +  VGQVMK   GK
Sbjct: 415 SADEIIAEKGLKQETDTGAIEAIIKDVLAANEKMVEEYKSGKEKAFNGLVGQVMKAAKGK 474

Query: 483 ANPSIVQKMLKEKLG 497
           ANP+ V +++K+ +G
Sbjct: 475 ANPAQVNELMKKLIG 489


>gi|254416508|ref|ZP_05030260.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Microcoleus chthonoplastes PCC 7420]
 gi|196176712|gb|EDX71724.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
           subunit subfamily [Microcoleus chthonoplastes PCC 7420]
          Length = 494

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 216/492 (43%), Positives = 306/492 (62%), Gaps = 9/492 (1%)

Query: 13  SLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNG 72
           +  +     +E +IG+E H QL+  +K+FS +S  FG  PNT +      +PG+LP+LN 
Sbjct: 2   TTAAPAKTKYEAIIGLETHCQLNTATKIFSHSSTEFGTPPNTNIDPICMGLPGVLPVLNQ 61

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
           + ++ AV  GL LN  I  YS F RK YFYPDLP+ YQISQ+D PI   G + + +    
Sbjct: 62  KVLESAVKAGLSLNCQIAPYSKFDRKQYFYPDLPKNYQISQYDLPIAEHGWLEIELID-D 120

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQYSA-----VSCIDLNRSGVALMEIVTKPDMRSS 187
            G     ++GI R+H+E+DAGK +H           S +D NR+G+ L+EIV++PD+RS 
Sbjct: 121 DGNPIDKKIGITRLHMEEDAGKLVHAGSDGLSGSTYSLVDFNRAGIPLLEIVSEPDLRSG 180

Query: 188 LEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFL 246
            EA  +  +LR I+RYLG  DGNM+EGS+R DVN+SV     + +G + E+KN+NS   +
Sbjct: 181 KEAAEYAQELRRIMRYLGISDGNMQEGSLRCDVNISVRPVGQKEFGVKVEIKNMNSFNAI 240

Query: 247 GLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEI 306
             AI+YE  RQI  +  G  I QETRL++     T S+R KE + DYRYF EPDL P+E+
Sbjct: 241 QKAIDYEIERQIEAIATGEPIVQETRLWEEGSQRTISMRIKEGSSDYRYFPEPDLPPIEV 300

Query: 307 DEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIV 365
            ++ +   + ++PELP  KR  +  +FG+S YDA VL  DK +A+YFE  +  N + K V
Sbjct: 301 SKEQLDQWRSELPELPAEKRHHYEEKFGLSAYDARVLTEDKLVAEYFEAAVTANANPKQV 360

Query: 366 ANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
           ANWV+ D+   LN    +I +  I P  L ELI LI D TISGKIAK+I   L  KGG+ 
Sbjct: 361 ANWVMGDIAAYLNTEKLAITEIAIKPLVLAELIQLIEDDTISGKIAKEILPELLSKGGSA 420

Query: 426 KEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKAN 484
           KEI E  GL Q++D++ +E ++D+VI +NP  + +    K  L  +FVGQVMK T G+AN
Sbjct: 421 KEIAESRGLIQISDVTQLEAIIDDVIAANPKKLEQYRNGKTKLQGFFVGQVMKETNGRAN 480

Query: 485 PSIVQKMLKEKL 496
           P +  ++L +KL
Sbjct: 481 PKLTNQLLGKKL 492


>gi|222109450|ref|YP_002551714.1| glutamyl-tRNA(gln) amidotransferase subunit B [Acidovorax ebreus
           TPSY]
 gi|221728894|gb|ACM31714.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Acidovorax ebreus
           TPSY]
          Length = 485

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 235/491 (47%), Positives = 307/491 (62%), Gaps = 17/491 (3%)

Query: 13  SLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNG 72
            L  G    +EVVIG E H QL+  SK+FS AS  FGAEPNTQ    D A+PG LP++N 
Sbjct: 4   KLIQG----YEVVIGFETHTQLATRSKIFSRASTAFGAEPNTQACAVDLALPGTLPVMNR 59

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
             V  A+  GL L +HI   S+FARKNYFYPDLP+GYQISQ + P+V  G+VS  +G +K
Sbjct: 60  EAVACAIKLGLALGSHIAPESIFARKNYFYPDLPKGYQISQFEIPVVQGGEVSFYLGDEK 119

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSC----IDLNRSGVALMEIVTKPDMRSSL 188
                   V + R HLE+DAGKS+H+  S        IDLNR+G  L+EIVT+PD+RSS 
Sbjct: 120 ------KTVRLVRAHLEEDAGKSLHEDSSLGGGGQSGIDLNRAGTPLLEIVTEPDIRSSE 173

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           EA A+  +L  I+ ++G CDGNM+EGS R D NVSV +PG+  GTR E+KN+NS + +  
Sbjct: 174 EAVAYAKELHKIVTWIGICDGNMQEGSFRCDANVSVRKPGQPLGTRREIKNLNSFKSMQQ 233

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AI+YE R QI  +EDG  I+Q T LFDP   ETR++RTKEDA DYRYF +PDL PL I  
Sbjct: 234 AIDYEIRWQIEEIEDGRAIQQATVLFDPDTGETRAMRTKEDAADYRYFPDPDLPPLRIAA 293

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR-DKKIVAN 367
            +I  IK Q+PELP A   RF+ ++G+  YDA+ L   +++A YFE  A      K+ +N
Sbjct: 294 PWIDDIKAQMPELPRAMAARFVQQYGLPEYDATTLTQSQAMAAYFEDAAKGCGQPKLASN 353

Query: 368 WVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG-TPK 426
           WV+ ++   LN     +E   +   QL  LI  I DGTIS   A+ +F  LW   G    
Sbjct: 354 WVMGEISRRLNAEEIGVEQAKVDSAQLAALIGRINDGTISNNAARQVFEALWSGEGHDVD 413

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANP 485
            ++E  GL+Q+ D  A+EK++DEVI +N  NV +    K    +  VGQVMK + GKANP
Sbjct: 414 AVIEAKGLKQMNDTGALEKIIDEVIAANAANVEQYKAGKDKAFNALVGQVMKASKGKANP 473

Query: 486 SIVQKMLKEKL 496
             V  +LK KL
Sbjct: 474 QQVNDLLKAKL 484


>gi|121592670|ref|YP_984566.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acidovorax sp. JS42]
 gi|120604750|gb|ABM40490.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Acidovorax sp. JS42]
          Length = 485

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 235/491 (47%), Positives = 308/491 (62%), Gaps = 17/491 (3%)

Query: 13  SLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNG 72
            L  G    +EVVIG E H QL+  SK+FS AS  FGAEPNTQ    D A+PG LP++N 
Sbjct: 4   KLIQG----YEVVIGFETHTQLATRSKIFSRASTAFGAEPNTQACAVDLALPGTLPVMNR 59

Query: 73  RCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDK 132
             V  A+  GL L +HI   S+FARKNYFYPDLP+GYQISQ + P+V  G+VS  +G +K
Sbjct: 60  EAVACAIKLGLALGSHIAPESIFARKNYFYPDLPKGYQISQFEIPVVQGGEVSFYLGDEK 119

Query: 133 SGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSC----IDLNRSGVALMEIVTKPDMRSSL 188
                   V + R HLE+DAGKS+H+  S        IDLNR+G  L+EIVT+PD+RSS 
Sbjct: 120 ------KTVRLVRAHLEEDAGKSLHEDSSLGGGGQSGIDLNRAGTPLLEIVTEPDIRSSE 173

Query: 189 EAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGL 248
           EA A+  +L  I+ ++G CDGNM+EGS R D NVSV +PG+  GTR E+KN+NS + +  
Sbjct: 174 EAVAYAKELHKIVTWIGICDGNMQEGSFRCDANVSVRKPGQPLGTRREIKNLNSFKSMQQ 233

Query: 249 AIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDE 308
           AI+YE R QI  +EDG  I+Q T LFDP   ETR++RTKEDA DYRYF +PDL PL I  
Sbjct: 234 AIDYEIRWQIEEIEDGRAIQQATVLFDPDTGETRAMRTKEDAADYRYFPDPDLPPLRIAA 293

Query: 309 DFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR-DKKIVAN 367
            +I  IK Q+PELP A   RF+ ++G+  YDA+ L   +++A YFE  A      K+ +N
Sbjct: 294 PWIDDIKAQMPELPRAMAARFVQQYGLPEYDATTLTQSQAMAAYFEDAAKGCGQPKLASN 353

Query: 368 WVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGG-TPK 426
           WV+ ++   LN     +E   ++  QL  LI  I DGTIS   A+ +F  LW   G    
Sbjct: 354 WVMGEISRRLNAEEIGVEQAKVNSAQLAALIGRINDGTISNNAARQVFEALWSGEGHDVD 413

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANP 485
            ++E  GL+Q+ D  A+EK++DEVI +N  NV +    K    +  VGQVMK + GKANP
Sbjct: 414 AVIEAKGLKQMNDTGALEKIIDEVIAANAANVEQYKAGKDKAFNALVGQVMKASKGKANP 473

Query: 486 SIVQKMLKEKL 496
             V  +LK KL
Sbjct: 474 QQVNDLLKAKL 484


>gi|90022837|ref|YP_528664.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Saccharophagus
           degradans 2-40]
 gi|109892061|sp|Q21FS7|GATB_SACD2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
           subunit B; Short=Asp/Glu-ADT subunit B
 gi|89952437|gb|ABD82452.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
           [Saccharophagus degradans 2-40]
          Length = 480

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 225/484 (46%), Positives = 318/484 (65%), Gaps = 11/484 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +WE VIG+EVH QL+  +K+FSGAS  FGAEPNTQ    D AMPG LP  N +  + A+
Sbjct: 1   MEWETVIGLEVHVQLATKTKIFSGASTAFGAEPNTQACAIDLAMPGTLPSPNAKAFEYAI 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
           M GL +NA I K SVF RKNYFYPD P+GYQ +Q ++PIVG G + + +         T 
Sbjct: 61  MFGLAVNAEIGKRSVFERKNYFYPDSPKGYQTTQLEQPIVGAGYIDIELDD-----GSTK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + I   HLE+DAGKS+H+ +  ++ IDLNR+G  L+E+VT+PD+ +  EA AF  KL +
Sbjct: 116 RIRIHHAHLEEDAGKSLHEDFHDMTGIDLNRAGTPLIEVVTEPDISNKAEAVAFARKLHA 175

Query: 200 ILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           I+  LG  DG+M +GSMR DVN+SV   G+  GTR E KN+NS RF+   I+ E +RQI 
Sbjct: 176 IVTSLGIGDGDMSQGSMRFDVNISVRLKGQELGTRTETKNLNSFRFMERCIDQEVQRQIE 235

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           +LEDGG I QETRL++   +  R +R+KE+A DYRYF  PDLLP+EI +++I++++ ++P
Sbjct: 236 VLEDGGKITQETRLYNGDTHTARPMRSKEEANDYRYFPCPDLLPVEITDEYIQSLRDKLP 295

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKL-AVNRDKKIVANWVINDLLGVLN 378
           ELPDA++ RFI ++G+S YDA +L SD + A YFE       D K+ ANWV  +L   LN
Sbjct: 296 ELPDARKARFIEQYGLSDYDAGLLGSDANTAHYFEVCAKACDDAKLSANWVAGELAARLN 355

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
               +I+++P++  QL  LI  I D TIS KIAK +F  +W+  G    ++E  GL+QV+
Sbjct: 356 NEELAIQNSPVNAEQLAGLIARIKDQTISNKIAKQVFEAMWQGEGDADTVIEAKGLKQVS 415

Query: 439 DLSAIEKVVDEVINSNPNNVARIA-----TKPNLVSWFVGQVMKNTGGKANPSIVQKMLK 493
           D  A+EK+VD+V+ +N   V          +  ++ +FVGQ+MK + G+ANP  + ++L 
Sbjct: 416 DSGALEKMVDDVMAANQQQVDAYRAAEPDKRKKMLGFFVGQIMKASKGQANPQQLNQILL 475

Query: 494 EKLG 497
            KL 
Sbjct: 476 SKLD 479


>gi|307544497|ref|YP_003896976.1| aspartyl-tRNA amidotransferase subunit B [Halomonas elongata DSM
           2581]
 gi|307216521|emb|CBV41791.1| aspartyl-tRNA amidotransferase subunit B [Halomonas elongata DSM
           2581]
          Length = 484

 Score =  550 bits (1416), Expect = e-154,   Method: Composition-based stats.
 Identities = 250/487 (51%), Positives = 333/487 (68%), Gaps = 13/487 (2%)

Query: 20  GDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
             WE VIG+EVH QL+  SK+FSGAS  FGAEPN+Q    D  +PG+LP+LN + V  AV
Sbjct: 1   MQWETVIGLEVHVQLATRSKIFSGASTAFGAEPNSQACAVDLGLPGVLPVLNEQAVAMAV 60

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
             GLG++A I + SVF RKNYFYPDLP+GYQ SQ  +PIVG G+V +++         T 
Sbjct: 61  QFGLGIHAEIPEVSVFDRKNYFYPDLPKGYQTSQMYQPIVGPGEVEITLDD-----GATK 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRS 199
            + +   HLE+DAGKS+H+ +  ++ IDLNR+G  L+EIV++PDMRS+ EA A+L  + S
Sbjct: 116 RIRVHHAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSEPDMRSAKEAA