RPSBLAST alignment for GI: 254780979 and conserved domain: pfam02637

>gnl|CDD|145673 pfam02637, GatB_Yqey, GatB domain. This domain is found in GatB. It is about 140 amino acid residues long. This domain is found at the C terminus of GatB, which transamidates Glu-tRNA to Gln-tRNA. Length = 148
 Score =  185 bits (471), Expect = 3e-47
 Identities = 73/148 (49%), Positives = 101/148 (68%), Gaps = 2/148 (1%)

Query: 351 DYFEKLAVN-RDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGK 409
           D+FE+      D K+ ANW++ +LLG LN+ G  I+++P++P  L ELI LI +GTISGK
Sbjct: 1   DFFEEAVKAGADPKLAANWLLGELLGYLNKEGLDIDESPLTPEHLAELIKLIDEGTISGK 60

Query: 410 IAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT-KPNLV 468
           IAK++   L E G +P+EIVEE GL Q++D   +EK+VDEVI  NP  V    + K   +
Sbjct: 61  IAKEVLEELLENGKSPEEIVEEKGLVQISDEEELEKIVDEVIAENPKAVEDYKSGKEKAL 120

Query: 469 SWFVGQVMKNTGGKANPSIVQKMLKEKL 496
            + VGQVMK T GKA+P +V ++LKEKL
Sbjct: 121 GFLVGQVMKKTRGKADPKLVNELLKEKL 148