RPSBLAST alignment for GI: 254780979 and conserved domain: pfam02934

>gnl|CDD|145865 pfam02934, GatB_N, GatB/GatE catalytic domain. This domain is found in the GatB and GatE proteins. Length = 287
 Score =  482 bits (1243), Expect = e-136
 Identities = 164/293 (55%), Positives = 204/293 (69%), Gaps = 7/293 (2%)

Query: 23  EVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTG 82
           E+VIG+E+H QL+  +KLF G    FGAEPNT V      +PG LP+LN   V+ A+  G
Sbjct: 1   ELVIGLEIHVQLNTKTKLFCGCPTEFGAEPNTNVCPVCLGLPGALPVLNKEAVELAIKAG 60

Query: 83  LGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVG 142
           L LN  IN  S F RKNYFYPDLP+GYQI+Q+D PI   G + +        + R   +G
Sbjct: 61  LALNCEINDESRFDRKNYFYPDLPKGYQITQYDLPIATNGYLEI---EVDGEEKR---IG 114

Query: 143 IERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILR 202
           IERIHLE+DAGK IH+     S +DLNR+GV L+EIVT+PD+RS  EA+A+L KLR ILR
Sbjct: 115 IERIHLEEDAGKLIHEGGGDYSLVDLNRAGVPLIEIVTEPDIRSPEEARAYLKKLRQILR 174

Query: 203 YLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           YLG  DGNMEEGS+R D NVSV   G E +GTR E+KN+NS RF+  AIEYE  RQI +L
Sbjct: 175 YLGVSDGNMEEGSLRCDANVSVRPKGSEEFGTRVEIKNLNSFRFVEKAIEYEIERQIELL 234

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           E+GG + QETRL+D  K ET S+R+KE A DYRYF EPDL P+ I +++I  I
Sbjct: 235 EEGGKVPQETRLWDEDKGETVSMRSKEGAADYRYFPEPDLPPIVISDEWIEEI 287