RPSBLAST alignment for GI: 254780979 and conserved domain: TIGR00133

>gnl|CDD|161729 TIGR00133, gatB, glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit. The heterotrimer GatABC is responsible for transferring the NH2 group that converts Glu to Gln, or Asp to Asn after the Glu or Asp has been ligated to the tRNA for Gln or Asn, respectively. In Lactobacillus, GatABC is responsible only for tRNA(Gln). In the Archaea, GatABC is responsible only for tRNA(Asn), while GatDE is responsible for tRNA(Gln). In lineages that include Thermus, Chlamydia, or Acidithiobacillus, the GatABC complex catalyzes both. Length = 478
 Score =  526 bits (1356), Expect = e-150
 Identities = 232/482 (48%), Positives = 316/482 (65%), Gaps = 11/482 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFG-AEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
           ++E  IG+E+H QL+  +KLF     +FG A PNT V      +PG LP+LN   V++A+
Sbjct: 3   EYEAKIGLEIHVQLNTKTKLFCSCPNSFGSAPPNTNVCPVCLGLPGALPVLNEEAVKKAI 62

Query: 80  MTGLGLNAHINK-YSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
              L LN+ IN+  SVF RK+YFYPDLP+GYQI+Q D+PI   GK+ + +   +      
Sbjct: 63  KLALALNSQINQPISVFDRKHYFYPDLPKGYQITQQDRPIAEGGKLEIELDGGEK----- 117

Query: 139 IEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
             +GIER+H+E+D GKS H      S +D NRSG  L+EIVTKPD+ S  EA+AFL KLR
Sbjct: 118 -RIGIERVHMEEDTGKSQHFGSDVQSLVDFNRSGAPLIEIVTKPDINSPKEARAFLKKLR 176

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
            ILRYLG  DGN+EEGSMR DVNVS+   G E  GTR E+KN+NS + +  AI+YE  RQ
Sbjct: 177 QILRYLGISDGNLEEGSMRCDVNVSIRLKGQEHLGTRVEIKNINSFKGIEKAIKYEIERQ 236

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           +  L  G  + QETR FD   N T S+R+KE ++DYRYF EPDL P+ IDE  ++ +  +
Sbjct: 237 VKALIRGEEVVQETRTFDEKSNITVSMRSKETSIDYRYFPEPDLPPINIDELLVKEVAGK 296

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGV 376
           +PELP AKR R   E+G+S  DA VL SD ++ADYFE++  +  D K+ ANW+  +LLGV
Sbjct: 297 LPELPSAKRIRLKKEYGLSEQDAKVLTSDLTLADYFEEVVKLIGDPKLAANWICIELLGV 356

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           LN+   S+ +  + P+ L ELI LI +G ISGK AK +   + E GG P +++EELGL Q
Sbjct: 357 LNKLQISLAECGLKPSDLAELIKLIKEGKISGKSAKQLIEEMLENGGDPSKLIEELGLEQ 416

Query: 437 VTDLSAIEKVVDEVINSNPNNV-ARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           ++D   + K+++EVI  NP  V   ++ K   + + VGQVMK T G+ANP +V ++LKE 
Sbjct: 417 ISDEKELIKIIEEVIKENPKEVEKYLSGKERALKFLVGQVMKRTRGRANPQLVNEILKEM 476

Query: 496 LG 497
           L 
Sbjct: 477 LS 478