RPSBLAST alignment for GI: 254780979 and conserved domain: PRK14703

>gnl|CDD|184797 PRK14703, PRK14703, glutaminyl-tRNA synthetase/YqeY domain fusion protein; Provisional. Length = 771
 Score =  163 bits (414), Expect = 1e-40
 Identities = 76/190 (40%), Positives = 115/190 (60%), Gaps = 7/190 (3%)

Query: 313 AIKKQIPELPDAKR---ERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANW 368
             + +   L   +R   +R++ E G++  DA  L  D ++A +FE  LA  +    +ANW
Sbjct: 584 EARAEAAALNPEQRARFDRYLSELGLNEEDARTLARDPALAAFFEAALAAGKSPVQLANW 643

Query: 369 VINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEI 428
           V+NDL G+L    + +   P +P  L  L+ L+  G IS +IAKD+   L   GG P+ I
Sbjct: 644 VVNDLAGLLRD--RELAALPFTPAALARLVALVDAGRISTRIAKDVLAELAASGGDPEAI 701

Query: 429 VEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSI 487
           VE  GL QV+D  A+E +V+EV+ ++P+ VA   A K  L+ +FVGQVM+ TGGKANP  
Sbjct: 702 VEAKGLEQVSDAGALEPIVEEVLAAHPDKVAAYRAGKTKLLGFFVGQVMRETGGKANPQQ 761

Query: 488 VQKMLKEKLG 497
           V+++L++KLG
Sbjct: 762 VRELLQKKLG 771