RPSBLAST alignment for GI: 254780979 and conserved domain: COG0064

>gnl|CDD|30413 COG0064, GatB, Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit (PET112 homolog) [Translation, ribosomal structure and biogenesis]. Length = 483
 Score =  673 bits (1738), Expect = 0.0
 Identities = 267/488 (54%), Positives = 344/488 (70%), Gaps = 10/488 (2%)

Query: 17  GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFG-AEPNTQVSFFDAAMPGMLPILNGRCV 75
               ++EVVIG+EVH QL+  +KLFSG S +FG AEPNT V      +PG LP+LN   V
Sbjct: 1   ANMMNFEVVIGLEVHVQLNTKTKLFSGCSTDFGGAEPNTNVCPVCLGLPGALPVLNKEAV 60

Query: 76  QQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQ 135
           ++A+  GL LN  IN+ SVF RKNYFYPDLP+GYQISQ DKPI   G + + +   +   
Sbjct: 61  EKAIKAGLALNCEINEKSVFDRKNYFYPDLPKGYQISQFDKPIAENGYLEIELEDGE--- 117

Query: 136 FRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
                +GIERIHLE+DAGK  H+  +  S +D NR+GV L+EIVT+PD+RS  EA+A+L 
Sbjct: 118 --EKRIGIERIHLEEDAGKLTHEGSAGYSLVDYNRAGVPLIEIVTEPDIRSPEEARAYLK 175

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEA 254
           KLRSILRYLG  DGNMEEGSMR D NVSV   G E +GTR E+KN+NS R +  AIEYE 
Sbjct: 176 KLRSILRYLGISDGNMEEGSMRCDANVSVRPKGQEEFGTRVEIKNLNSFRNVEKAIEYEI 235

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
           +RQI +LE GG I QETR FD +  +T S+R+KE+A DYRYF EPDL PLEI +++I  +
Sbjct: 236 QRQIELLESGGEIEQETRRFDEATGKTVSMRSKEEAEDYRYFPEPDLPPLEISDEWIEEV 295

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDK-KIVANWVINDL 373
           +  +PELPD KRER+I E+G+S YDA VL SDK +ADYFE+        K+ ANW+ N+L
Sbjct: 296 RATLPELPDEKRERYIKEYGLSEYDARVLTSDKELADYFEEAVKAGADAKLAANWLTNEL 355

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKD-IFNILWEKGGTPKEIVEEL 432
           LG+LN++G ++E++P++P QL ELI LI +GTISGKIAK+ +F IL   G  P+EI+EE 
Sbjct: 356 LGLLNKAGITLEESPLTPEQLAELIKLIDEGTISGKIAKELVFEILANGGKDPEEIIEEK 415

Query: 433 GLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKM 491
           GL Q++D   +EK+VDEV+  NP  V    + K   + + VGQVMK T GKANP  V ++
Sbjct: 416 GLVQISDEGELEKIVDEVLAENPKAVEDYKSGKEKALGFLVGQVMKATKGKANPQQVNEL 475

Query: 492 LKEKLGIK 499
           LKEKLG  
Sbjct: 476 LKEKLGKV 483