RPSBLAST alignment of GI: 254780979 and protein with PDBid: 1zq1

>1zq1_C Glutamyl-tRNA(Gln) amidotransferase subunit E; X-RAY, 3D structure, asparaginase 1 family, GATD subfamily, lyase; 3.00A {Pyrococcus abyssi} SCOP: a.182.1.2 d.74.4.1 d.128.1.5 Length = 633
 Score =  237 bits (607), Expect = 4e-63
 Identities = 65/250 (26%), Positives = 118/250 (47%), Gaps = 14/250 (5%)

Query: 248 LAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEID 307
            A+    +R     E    + +ETR   P  N T  +R        R + E D+ PL I 
Sbjct: 391 NALREVIKR---AREAIEGVPEETRRALPDGN-TEYMRPLPG--KARMYPETDIPPLRIP 444

Query: 308 EDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVAN 367
           +D  + IK+ +PELP AK ER++ E+ +    A  LV D+    + E +++     + A+
Sbjct: 445 DDLKKKIKENLPELPQAKVERYVKEYKLDRSLAQTLVDDERDELFEELVSMGVKPSLAAS 504

Query: 368 WVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPK 426
                L+ VL    K +    ++   + E   L ++G I+ +  ++IF  L      + +
Sbjct: 505 I----LVVVLKGLRKEVPIENVTDEHIREAFQLYLEGKIAKEAFEEIFKELARNPSKSAR 560

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPS 486
           E+ EE GL  +++   + ++++EVI  N   V   A     +   +G+VM    GKA+  
Sbjct: 561 EVAEEKGLTLLSE-EEVTRIIEEVIQQNIEVVK--AKGMGAMGLIMGRVMAKVRGKADGK 617

Query: 487 IVQKMLKEKL 496
           +V ++++ KL
Sbjct: 618 LVSQIVRRKL 627