RPSBLAST alignment of GI: 254780979 and protein with PDBid: 2d6f

>2d6f_C Glutamyl-tRNA(Gln) amidotransferase subunit E; ligase, ligase/RNA complex; 3.15A {Methanothermobacterthermautotrophicus} SCOP: a.182.1.2 d.74.4.1 d.128.1.5 Length = 619
 Score =  238 bits (609), Expect = 2e-63
 Identities = 74/326 (22%), Positives = 130/326 (39%), Gaps = 45/326 (13%)

Query: 21  DWEVV---IGIEVHAQLSVVSKLFSGASVNF-GAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           DWE V   +G+E+H QL   SKLF         +EP+  +          L   +    +
Sbjct: 2   DWEKVGLKMGLEIHQQLDTESKLFCPCRTELTDSEPDHDIVRNLRPTQSELGKFDRAAFE 61

Query: 77  QAV--MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQH-----DKPIVGEGK------ 123
           +A+  +     N H     V A +   +P  P+  +I+       +  +V E        
Sbjct: 62  EAMRKLHFHYENYHEETCLVEADEEPPHPLNPEALEIAVTIALLLNMRVVDEFHTMRKQV 121

Query: 124 ----------VSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGV 173
                      +  +  D   +     V IE + LE+DA + I +         L+R G+
Sbjct: 122 IDGSNTGGFQRTGLVATDGHLETPQGTVKIENLCLEEDAARRIRETGD-GVVFRLDRLGI 180

Query: 174 ALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGT 233
            L+EI T P M    + +    ++  ILR      G     ++R D+N+S+       G 
Sbjct: 181 PLVEITTDPSMSDPQQLREVAYQIGQILRSTRVKRGLG---TIRQDLNISIR-----DGA 232

Query: 234 RCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQ-----ETRLFDPS----KNETRSL 284
           R EVK V  +  +   +E E +RQ++++E    +++     E ++FD S      E+R +
Sbjct: 233 RVEVKGVQDLDLIPEIVEREVKRQLSLVEIRDTLQERGAVVEDKIFDVSEVFADTESRII 292

Query: 285 RTKEDALDYRYFSEPDLLPLEIDEDF 310
            + E  L  +      L+ +EI    
Sbjct: 293 SSAESVLAVKLRGFDGLIGVEIQPGR 318