RPSBLAST alignment of GI: 254780979 and protein with PDBid: 2pff

>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688
 Score = 39.8 bits (92), Expect = 0.001
 Identities = 69/351 (19%), Positives = 127/351 (36%), Gaps = 93/351 (26%)

Query: 166  IDLNR----SGVALMEIVTKPDMRSSLEAKAF-------LTKLRSILRYLGTCDGNMEEG 214
            +DL R    +G A  E+      R+  E +AF         ++  I+ ++   +GN++  
Sbjct: 814  LDLERVIVVTGFA--EVGPWGSARTRWEMEAFGEFSLEGCVEMAWIMGFISYHNGNLKG- 870

Query: 215  SMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQ-ETRL 273
                       RP   W    + K    +    +  +YE     +ILE  G IR  E  L
Sbjct: 871  -----------RPYTGW---VDSKTKEPVDDKDVKAKYET----SILEHSG-IRLIEPEL 911

Query: 274  F---DPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ------IPELPDA 324
            F   +P K E          +      E DL P E  ++     K Q      I E+P+ 
Sbjct: 912  FNGYNPEKKE----------MIQEVIVEEDLEPFEASKETAEQFKHQHGDKVDIFEIPET 961

Query: 325  KRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSI 384
                  GE+ + L   + L   K++   F++L      +I   W         N     I
Sbjct: 962  ------GEYSVKLLKGATLYIPKALR--FDRLVAG---QIPTGW---------NAKTYGI 1001

Query: 385  EDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD----- 439
             D  IS  Q+  +   ++   +   IA  I +        P E+ + + + +V +     
Sbjct: 1002 SDDIIS--QVDPITLFVLVSVVEAFIASGITD--------PYEMYKYVHVSEVGNCSGSG 1051

Query: 440  ---LSAIEKVVDEVINSNP--NNVARIATKPNLVSWFVGQVMKNTGGKANP 485
               +SA+  +  +     P  N++ + +    + +W    ++ ++G    P
Sbjct: 1052 MGGVSALRGMFKDRFKDEPVQNDILQESFINTMSAWVNMLLISSSGPIKTP 1102