RPSBLAST alignment of GI: 254780979 and protein with PDBid: 3ip4

>3ip4_B Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_B 2dqn_B* 2g5h_B 2g5i_B* 2f2a_B Length = 483
 Score =  523 bits (1348), Expect = e-149
 Identities = 205/479 (42%), Positives = 305/479 (63%), Gaps = 11/479 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
            +E VIG+EVH +L   SK+FS +  +FGAEPN+  +  D A PG+LP++N R V  A+ 
Sbjct: 2   HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMR 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
             + LN  I   S F RKNYFYPD P+ YQISQ D+PI   G + + +  +         
Sbjct: 62  AAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETK------R 115

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           +GI R+H+E+DAGKS H    ++  +DLNR G  L+EIV++PD+RS  EA A+L KLRSI
Sbjct: 116 IGITRLHMEEDAGKSTHKGEYSL--VDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSI 173

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           ++Y G  D  MEEGS+R D N+S+   G E +GT+ E+KN+NS  ++   +EYE +RQ  
Sbjct: 174 IQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEE 233

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
            L +GG I QETR FD S  +T  +R KE + DYRYF EPD++PL ID+ +   +++ IP
Sbjct: 234 ELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIP 293

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYF-EKLAVNRDKKIVANWVINDLLGVLN 378
           ELPD ++ +++ E G+  YDA VL   K ++D+F   +    D K+ +NW++  +   LN
Sbjct: 294 ELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLN 353

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++   + DT ++P  L  +I LI DGT+S KIAK +F  L  KGG  K+I+E+ GL Q++
Sbjct: 354 KNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQIS 413

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           D + + K V+E +++N  +V      K   + + VGQ+MK + G+ANP +V ++LK++L
Sbjct: 414 DEATLLKFVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQEL 472