RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780979|ref|YP_003065392.1| aspartyl/glutamyl-tRNA
amidotransferase subunit B [Candidatus Liberibacter asiaticus str.
psy62]
         (500 letters)



>3h0l_B Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi
           protein complex, ligase, protein biosynthesis; HET: ADP;
           2.30A {Aquifex aeolicus} PDB: 3h0m_B 3h0r_B*
          Length = 478

 Score =  589 bits (1521), Expect = e-169
 Identities = 227/479 (47%), Positives = 331/479 (69%), Gaps = 10/479 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
            +E VIG+E+H Q+   +K+F G  V FGAEPNT V      MPG LPI+N R V+ A+ 
Sbjct: 4   KYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEYAIR 63

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
             L LN  +++ SVFARK+YFYPDLP+GYQISQ++KP+   G V +++   +       +
Sbjct: 64  ASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKK-----K 118

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           V I R+H+E+DAGK+IH+     + +DLNR+G  LMEIVT+PD+R+  EA+ FL KLR+I
Sbjct: 119 VRIRRLHIEEDAGKNIHE--GDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNI 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +RY G    +ME+G +R D+NVS+   G + +GTR E+KNVNS RF+  A+EYE  RQI 
Sbjct: 177 MRYAGVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQIN 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++E+GG + QETR FDP   +T  +RTKE+A DYRYF +PDL+PL++ +++I  IKK +P
Sbjct: 237 VVEEGGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLN 378
           ELPD + ER I E+G+S Y+A +LV+ K + D+FE+ +   ++ K + NW+INDLLG+L 
Sbjct: 297 ELPDQRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLR 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
             G SIE++P+ P  L EL+ LI +  IS KI K++   + E G TP +IVEE GL+Q+T
Sbjct: 357 DKGISIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQIT 416

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           D + I+++V ++   +P  V R+   +  L+ +FVGQVM+ T GKANP +V K+++E +
Sbjct: 417 DENQIKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELV 475


>3al0_B Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase; protein-RNA
           complex, ligase-RNA complex; HET: GSU; 3.37A {Thermotoga
           maritima}
          Length = 482

 Score =  561 bits (1448), Expect = e-160
 Identities = 204/484 (42%), Positives = 296/484 (61%), Gaps = 14/484 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVN-FGAEPNTQVSFFDAAMPGMLPILNGRCVQQAV 79
            +  VIG+E+H QLS  +K F     + F   PNT +       PG LP+ N   ++ AV
Sbjct: 2   RYRPVIGLEIHVQLSTKTKAFCSCPADVFELPPNTAICPVCTGQPGALPVPNEEMIRFAV 61

Query: 80  MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTI 139
            T L LN  I+KYS F RKNYFYPDLP+GYQISQ+  PI  EG + +     +       
Sbjct: 62  KTALALNCKIHKYSRFDRKNYFYPDLPKGYQISQYFYPIATEGFLEIDGDEGRK------ 115

Query: 140 EVGIERIHLEQDAGKSIHDQYSAV----SCIDLNRSGVALMEIVTKPDMRSSLEAKAFLT 195
           +V I R+HLE+DAGK +H+  S      S +D+NR GV L+EIVT+PD+ S  EA+ F+ 
Sbjct: 116 KVRIRRLHLEEDAGKLVHEGDSITRASYSLVDMNRCGVPLIEIVTEPDISSPREARVFME 175

Query: 196 KLRSILRYLGTCDGNMEEGSMRADVNVSV-CRPGEAWGTRCEVKNVNSIRFLGLAIEYEA 254
           KLRSI+RYLG   G+ME+G++R D N+SV          R EVKN+NS RF+  A+EYE 
Sbjct: 176 KLRSIVRYLGVSTGDMEKGALRCDANISVVDTETGRQSNRVEVKNMNSFRFVERALEYEF 235

Query: 255 RRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAI 314
            R +  +E G  + +ETR +D +   T S+R KE+  DYRYF EPD+ P+ + ++++  +
Sbjct: 236 ERIVKAMERGEDVERETRGWDMATKITVSMRGKEEESDYRYFPEPDIPPVVLSDEYLEEV 295

Query: 315 KKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFE-KLAVNRDKKIVANWVINDL 373
           KK++PELPD K ERF+ E+G+  YDA VL S K +A++FE  + V    K ++NW++ ++
Sbjct: 296 KKELPELPDEKAERFMREYGLPEYDAKVLTSSKELAEFFEECVKVVNRPKDLSNWIMTEV 355

Query: 374 LGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELG 433
           L  LN     I ++ ++P    +L  L+ +G IS KIAK+IF  ++E G  P +IVEE G
Sbjct: 356 LRELNERNIEITESKLTPQHFADLFKLMDEGKISIKIAKEIFPEVFETGKMPSQIVEEKG 415

Query: 434 LRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKML 492
           L Q+ D   IE++V + +  NP  V    + K     +FVG VM+ T GKANP +  +++
Sbjct: 416 LTQINDEKLIEELVKKAMEQNPKAVQDYKSGKKKAAGFFVGYVMRETKGKANPELTNRII 475

Query: 493 KEKL 496
           ++ L
Sbjct: 476 QKLL 479


>3kfu_F Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase; ASPRS, gatcab,
           ATP-binding, aminoacyl-tRNA synthetase, ligas
           nucleotide-binding, protein biosynthesis, ligase-RNA
           comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus}
          Length = 466

 Score =  544 bits (1403), Expect = e-155
 Identities = 162/407 (39%), Positives = 242/407 (59%), Gaps = 17/407 (4%)

Query: 22  WEVVIGIEVHAQLSVVSKLFSGASVN-FGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
           +E VIG+EVH  L   +K+F G   + FGAEPNT        +PG LP+ N   V+  + 
Sbjct: 2   YEAVIGLEVHLHLKTRTKMFCGCRADYFGAEPNTHTCPVCLGLPGALPVPNRVAVEHGLR 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
             L L A + +  VF RKNYFYPDLP+ YQISQ+D P+   G + +              
Sbjct: 62  LALALGAEVPERLVFHRKNYFYPDLPKNYQISQYDLPLGRGGSLPLGER----------R 111

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           V I+R+HLE+DAGKS+H      + +DLNR+G  L+E+VT+PD+++  EA+ FL +++++
Sbjct: 112 VRIKRLHLEEDAGKSLH--LEGRTLLDLNRAGSPLIELVTEPDLKTPEEARLFLQRIQAL 169

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAI 260
           ++ LG  D + EEG +RADVNVSV R GE  GT+ E+KN+NS + +  A+EYE RRQ  I
Sbjct: 170 VQTLGISDASPEEGKLRADVNVSVRRVGEPLGTKVEIKNLNSFKSVQRALEYEIRRQTEI 229

Query: 261 LEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPE 320
           L  G  ++Q T  F+    +T  +RTKE+  DYRYF EPDL P+ I  D++  +++ +PE
Sbjct: 230 LRRGEKVKQATMGFEEGSGKTYPMRTKEEEADYRYFPEPDLPPVAIPRDWLEEVRRSLPE 289

Query: 321 LPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAV--NRDKKIVANWVINDLLGVLN 378
           LP  K  R+    GI   DA VL    S+A + ++         + +ANW++ D+ G+L+
Sbjct: 290 LPWEKEARYR-ALGIKEKDAEVLAYTPSLARFLDQALPLGLASPQALANWLLADVAGLLH 348

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTP 425
             G  +E+T +SP  L  L+ L   G ++ ++AK +   + E G  P
Sbjct: 349 ERGLRLEETRLSPEGLARLVGLFERGEVTSRVAKSLLPEVLE-GQDP 394


>3ip4_B Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi
           protein complex, ligase, ATP-binding, nucleotide-
           binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_B
           2dqn_B* 2g5h_B 2g5i_B* 2f2a_B
          Length = 483

 Score =  523 bits (1348), Expect = e-149
 Identities = 205/479 (42%), Positives = 305/479 (63%), Gaps = 11/479 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
            +E VIG+EVH +L   SK+FS +  +FGAEPN+  +  D A PG+LP++N R V  A+ 
Sbjct: 2   HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMR 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
             + LN  I   S F RKNYFYPD P+ YQISQ D+PI   G + + +  +         
Sbjct: 62  AAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETK------R 115

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           +GI R+H+E+DAGKS H    ++  +DLNR G  L+EIV++PD+RS  EA A+L KLRSI
Sbjct: 116 IGITRLHMEEDAGKSTHKGEYSL--VDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSI 173

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           ++Y G  D  MEEGS+R D N+S+   G E +GT+ E+KN+NS  ++   +EYE +RQ  
Sbjct: 174 IQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEE 233

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
            L +GG I QETR FD S  +T  +R KE + DYRYF EPD++PL ID+ +   +++ IP
Sbjct: 234 ELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIP 293

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYF-EKLAVNRDKKIVANWVINDLLGVLN 378
           ELPD ++ +++ E G+  YDA VL   K ++D+F   +    D K+ +NW++  +   LN
Sbjct: 294 ELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLN 353

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
           ++   + DT ++P  L  +I LI DGT+S KIAK +F  L  KGG  K+I+E+ GL Q++
Sbjct: 354 KNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQIS 413

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           D + + K V+E +++N  +V      K   + + VGQ+MK + G+ANP +V ++LK++L
Sbjct: 414 DEATLLKFVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQEL 472


>1zq1_C Glutamyl-tRNA(Gln) amidotransferase subunit E; X-RAY, 3D structure,
           asparaginase 1 family, GATD subfamily, lyase; 3.00A
           {Pyrococcus abyssi} SCOP: a.182.1.2 d.74.4.1 d.128.1.5
          Length = 633

 Score =  256 bits (654), Expect = 1e-68
 Identities = 67/296 (22%), Positives = 105/296 (35%), Gaps = 58/296 (19%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEP--------NTQVSFFDAAMPGMLPIL-- 70
           +  + +G+E+H QL    KLFS        +            +S      P  L     
Sbjct: 12  ELGLKVGLEIHRQLDT-KKLFSPVPSELSDKVEFTFQRRLRPTMSELGEIDPAALEEFKK 70

Query: 71  --------------------------NGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPD 104
                                     +   ++ A+     LNA       + RK      
Sbjct: 71  GRVYVYEGNYELTDLVYMDEEPPRGPDREALEVALQIAYLLNAKPVDEVYYMRKIVIDGS 130

Query: 105 LPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVS 164
              G+Q +     I  +GKV    G           VGI  I LE+DA + I  +     
Sbjct: 131 NVSGFQRTA---IIATDGKVETPWG----------AVGIPTICLEEDAARIIERKDK-EV 176

Query: 165 CIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSV 224
              L+R G+ L+EI T PD+    +AK     +   LR        +  G++R D+NVS+
Sbjct: 177 IYRLDRLGIPLIEISTTPDIHHPEQAKVVAKFIGDALRATKKVKRGL--GTIRQDLNVSI 234

Query: 225 CRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNE 280
                  G R E+K V  +  + + IE E  RQ+ +L+    +R+        K E
Sbjct: 235 -----KGGARIEIKGVQELDMIPIIIEREVERQLNLLKIRDELRKRGVKPKDIKEE 285



 Score =  237 bits (607), Expect = 4e-63
 Identities = 65/250 (26%), Positives = 118/250 (47%), Gaps = 14/250 (5%)

Query: 248 LAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEID 307
            A+    +R     E    + +ETR   P  N T  +R        R + E D+ PL I 
Sbjct: 391 NALREVIKR---AREAIEGVPEETRRALPDGN-TEYMRPLPG--KARMYPETDIPPLRIP 444

Query: 308 EDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVAN 367
           +D  + IK+ +PELP AK ER++ E+ +    A  LV D+    + E +++     + A+
Sbjct: 445 DDLKKKIKENLPELPQAKVERYVKEYKLDRSLAQTLVDDERDELFEELVSMGVKPSLAAS 504

Query: 368 WVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE-KGGTPK 426
                L+ VL    K +    ++   + E   L ++G I+ +  ++IF  L      + +
Sbjct: 505 I----LVVVLKGLRKEVPIENVTDEHIREAFQLYLEGKIAKEAFEEIFKELARNPSKSAR 560

Query: 427 EIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPS 486
           E+ EE GL  +++   + ++++EVI  N   V   A     +   +G+VM    GKA+  
Sbjct: 561 EVAEEKGLTLLSE-EEVTRIIEEVIQQNIEVVK--AKGMGAMGLIMGRVMAKVRGKADGK 617

Query: 487 IVQKMLKEKL 496
           +V ++++ KL
Sbjct: 618 LVSQIVRRKL 627


>2hz7_A Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, class I
           aminoacyl-tRNA synthetase, ligase; 2.30A {Deinococcus
           radiodurans}
          Length = 851

 Score =  251 bits (641), Expect = 3e-67
 Identities = 51/203 (25%), Positives = 85/203 (41%), Gaps = 8/203 (3%)

Query: 297 SEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISL--YDASVLVSDKSIADYFE 354
             PD +  E      +A   +   L   +   F    G+     DA  +  D ++  +  
Sbjct: 653 RGPDEVRGEGSSSPAKAHAPKAQPLTPEQDAEFTRLLGLGASEGDARTIARDPALLAFVG 712

Query: 355 KLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDI 414
             A       VA+W +N+L+  L        +  +    L  L + +  G +S +IA++ 
Sbjct: 713 GAAPGDTFAQVASWTVNELVAGLR-----AGEVKVRAADLAPLAEGVASGQLSARIAREA 767

Query: 415 FNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVG 473
                  G  P  I+E  GL       A+++VV +VI +NP+        K  L+ +F G
Sbjct: 768 LARAAASGDAPLTIIEREGLNAGLSAEALQQVVAQVIAANPDKAEAYRGGKTALLGFFTG 827

Query: 474 QVMKNTGGKANPSIVQKMLKEKL 496
           QVM+ T GKA+P  +   LK+ L
Sbjct: 828 QVMRATAGKADPQALAAALKDAL 850


>2d6f_C Glutamyl-tRNA(Gln) amidotransferase subunit E; ligase, ligase/RNA
           complex; 3.15A {Methanothermobacterthermautotrophicus}
           SCOP: a.182.1.2 d.74.4.1 d.128.1.5
          Length = 619

 Score =  244 bits (625), Expect = 2e-65
 Identities = 61/249 (24%), Positives = 113/249 (45%), Gaps = 12/249 (4%)

Query: 248 LAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEID 307
            A+    RR          + +ETR   P  N       +      R + E D+    I+
Sbjct: 379 NALREVIRR---AEMAIQGVPEETRKALPDGNTQY---LRPLPTSSRMYLETDIPLFRIE 432

Query: 308 EDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVAN 367
           +D +  I++ +PELP  K+ER + ++G+S   AS LV    + D FE L   R    V  
Sbjct: 433 DDLLEGIRRNLPELPSEKKERIMRDYGLSEDLASQLVKRN-LVDEFEALTEFRVDTTVIA 491

Query: 368 WVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKE 427
            ++   L  L R G  ++   +  ++L + I L+  G IS    +DI   + ++G   ++
Sbjct: 492 SLLAYTLRELRREGHDVD--GLGLDELRDAIKLLEVGKISKDALRDIVACMADEGLAAED 549

Query: 428 IVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSI 487
              +L L  + +   IE ++ E++  N + ++        +   +GQ M    G+A+  +
Sbjct: 550 AARKLNLLLLAE-DEIESIIQEIVEGNLDMISER--GMGAMGPLMGQAMGRLRGRADGKV 606

Query: 488 VQKMLKEKL 496
           V ++L+EK+
Sbjct: 607 VNRILREKI 615



 Score =  238 bits (609), Expect = 2e-63
 Identities = 74/326 (22%), Positives = 130/326 (39%), Gaps = 45/326 (13%)

Query: 21  DWEVV---IGIEVHAQLSVVSKLFSGASVNF-GAEPNTQVSFFDAAMPGMLPILNGRCVQ 76
           DWE V   +G+E+H QL   SKLF         +EP+  +          L   +    +
Sbjct: 2   DWEKVGLKMGLEIHQQLDTESKLFCPCRTELTDSEPDHDIVRNLRPTQSELGKFDRAAFE 61

Query: 77  QAV--MTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQH-----DKPIVGEGK------ 123
           +A+  +     N H     V A +   +P  P+  +I+       +  +V E        
Sbjct: 62  EAMRKLHFHYENYHEETCLVEADEEPPHPLNPEALEIAVTIALLLNMRVVDEFHTMRKQV 121

Query: 124 ----------VSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGV 173
                      +  +  D   +     V IE + LE+DA + I +         L+R G+
Sbjct: 122 IDGSNTGGFQRTGLVATDGHLETPQGTVKIENLCLEEDAARRIRETGD-GVVFRLDRLGI 180

Query: 174 ALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGT 233
            L+EI T P M    + +    ++  ILR      G     ++R D+N+S+       G 
Sbjct: 181 PLVEITTDPSMSDPQQLREVAYQIGQILRSTRVKRGLG---TIRQDLNISIR-----DGA 232

Query: 234 RCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQ-----ETRLFDPS----KNETRSL 284
           R EVK V  +  +   +E E +RQ++++E    +++     E ++FD S      E+R +
Sbjct: 233 RVEVKGVQDLDLIPEIVEREVKRQLSLVEIRDTLQERGAVVEDKIFDVSEVFADTESRII 292

Query: 285 RTKEDALDYRYFSEPDLLPLEIDEDF 310
            + E  L  +      L+ +EI    
Sbjct: 293 SSAESVLAVKLRGFDGLIGVEIQPGR 318


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 59.2 bits (143), Expect = 2e-09
 Identities = 75/411 (18%), Positives = 122/411 (29%), Gaps = 155/411 (37%)

Query: 1   MVS---LDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVS 57
           +V+   L        S   G TG          H+Q  V +      ++   AE ++  S
Sbjct: 250 VVTAKLLGFTPGELRSYLKGATG----------HSQGLVTA-----VAI---AETDSWES 291

Query: 58  FFDA---AMPGMLPILNG-RCVQQAVMTGLGLNAHINKYSVFARKNYFYPD--LPQGYQI 111
           FF +   A+  +  I  G RC  +A                       YP+  LP    I
Sbjct: 292 FFVSVRKAITVLFFI--GVRC-YEA-----------------------YPNTSLPP--SI 323

Query: 112 SQHDKPIVGEGKVS--VSI-GPDKSGQFRTIEVGIERI--HLEQDAGKSIHDQYSAVSCI 166
            + D     EG  S  +SI    +      ++  + +   HL     K +      +S +
Sbjct: 324 LE-DSLENNEGVPSPMLSISNLTQE----QVQDYVNKTNSHLPAG--KQVE-----ISLV 371

Query: 167 DLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCR 226
           +  ++ V     V+ P    SL        LR                  +A   +   R
Sbjct: 372 NGAKNLV-----VSGPP--QSL--YGLNLTLRKA----------------KAPSGLDQSR 406

Query: 227 -PGEAWGTRCEVKNVNSIRFLGLAI----EYEARRQIAILEDGGHIRQETRLFDPSKNET 281
            P   +  R   K   S RFL +A              I +D   + +    F+      
Sbjct: 407 IP---FSER---KLKFSNRFLPVASPFHSHLLVPASDLINKD---LVKNNVSFNAK---- 453

Query: 282 RSLR-----TKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERF----IGE 332
             ++     T  D  D R  S   +         +  I +   +       +F    I +
Sbjct: 454 -DIQIPVYDT-FDGSDLRVLSG-SISE-----RIVDCIIRLPVKWETTT--QFKATHILD 503

Query: 333 FG---ISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRS 380
           FG    S     VL               N+D   V   VI  + G L+ +
Sbjct: 504 FGPGGAS--GLGVLTHR------------NKDGTGVR--VI--VAGTLDIN 536



 Score = 35.7 bits (82), Expect = 0.025
 Identities = 55/349 (15%), Positives = 93/349 (26%), Gaps = 157/349 (44%)

Query: 244 RFLGLAIEYEARRQIAILEDG--GHIRQETRL----FDPSKNETRSLRTKE-DALDYRYF 296
           +FLG    Y +      +E    G   Q   L    F     E   L   +  AL  +  
Sbjct: 63  KFLG----YVSSL----VEPSKVGQFDQVLNLCLTEF-----ENCYLEGNDIHALAAKLL 109

Query: 297 SEPDLLPLEIDEDFIR-------AIKKQIPELPD------AKRERFIGEFGISLYDASVL 343
            E D   L   ++ I+         K+   +  +                   L   ++ 
Sbjct: 110 QENDT-TLVKTKELIKNYITARIMAKRPFDKKSNSALFRAVGEGNA------QLV--AIF 160

Query: 344 VSDKSIADYFEKLAVNRD-----KKIVANWV--INDLLGVLNRSGKSIED---------- 386
               +  DYFE+L   RD       +V + +    + L  L R+    E           
Sbjct: 161 GGQGNTDDYFEEL---RDLYQTYHVLVGDLIKFSAETLSELIRTTLDAEKVFTQGLNILE 217

Query: 387 ----------------TPIS-P----NQL--------------GELIDLIIDGT------ 405
                            PIS P     QL              GEL    + G       
Sbjct: 218 WLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFTPGELRSY-LKGATGHSQG 276

Query: 406 ------ISG--------KIAKDIFNIL-W-----------------------EKG-GTPK 426
                 I+            +    +L +                       E   G P 
Sbjct: 277 LVTAVAIAETDSWESFFVSVRKAITVLFFIGVRCYEAYPNTSLPPSILEDSLENNEGVPS 336

Query: 427 EIVEELGLRQVTDLS--AIEKVVDEVINSN-PNN----VARIATKPNLV 468
            +     L  +++L+   ++  V++  NS+ P      ++ +    NLV
Sbjct: 337 PM-----LS-ISNLTQEQVQDYVNKT-NSHLPAGKQVEISLVNGAKNLV 378



 Score = 31.8 bits (72), Expect = 0.37
 Identities = 37/163 (22%), Positives = 60/163 (36%), Gaps = 47/163 (28%)

Query: 131  DKSGQFRTIEVGIER-----IHLEQDAGKSIHDQYSAV---SCID-----------LN-- 169
            D  G F  +++ I       IH   + GK I + YSA+   + +D           +N  
Sbjct: 1655 DTYG-FSILDIVINNPVNLTIHFGGEKGKRIRENYSAMIFETIVDGKLKTEKIFKEINEH 1713

Query: 170  ------RSGVALMEIV--TKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVN 221
                  RS   L+     T+P +  +L  KA    L+S             +G + AD  
Sbjct: 1714 STSYTFRSEKGLLSATQFTQPAL--TLMEKAAFEDLKS-------------KGLIPADAT 1758

Query: 222  VSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEA-RRQIAILED 263
             +    GE +     + +V SI  L   + Y     Q+A+  D
Sbjct: 1759 FAGHSLGE-YAALASLADVMSIESLVEVVFYRGMTMQVAVPRD 1800



 Score = 30.3 bits (68), Expect = 1.1
 Identities = 47/212 (22%), Positives = 86/212 (40%), Gaps = 64/212 (30%)

Query: 265  GHIRQETRLFDPSKNETRS--LRTKEDALDYRYFSEPDLLPLEID--EDFIRAIKKQIPE 320
            G ++ E ++F      + S   R+++  L    F++P L  +E    ED +++ K  IP 
Sbjct: 1699 GKLKTE-KIFKEINEHSTSYTFRSEKGLLSATQFTQPALTLMEKAAFED-LKS-KGLIP- 1754

Query: 321  LPDAKRERF----IGEFG--ISLYDASVLVSDKSIAD--YFE----KLAVNRDKKIVANW 368
              DA    F    +GE+    SL D   ++S +S+ +  ++     ++AV RD+      
Sbjct: 1755 -ADAT---FAGHSLGEYAALASLAD---VMSIESLVEVVFYRGMTMQVAVPRDE------ 1801

Query: 369  VINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPK-- 426
                    L RS   +    I+P            G ++   +++    + E+ G     
Sbjct: 1802 --------LGRSNYGM--IAINP------------GRVAASFSQEALQYVVERVGKRTGW 1839

Query: 427  --EI----VEELGLRQVTDLSAIEKVVDEVIN 452
              EI    VE        DL A++ V + V+N
Sbjct: 1840 LVEIVNYNVENQQYVAAGDLRALDTVTN-VLN 1870


>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty
            acid synthase, acyl-carrier-protein, beta-ketoacyl
            reductase, beta-ketoacyl synthase, dehydratase; 4.00A
            {Saccharomyces cerevisiae}
          Length = 1688

 Score = 39.8 bits (92), Expect = 0.001
 Identities = 69/351 (19%), Positives = 127/351 (36%), Gaps = 93/351 (26%)

Query: 166  IDLNR----SGVALMEIVTKPDMRSSLEAKAF-------LTKLRSILRYLGTCDGNMEEG 214
            +DL R    +G A  E+      R+  E +AF         ++  I+ ++   +GN++  
Sbjct: 814  LDLERVIVVTGFA--EVGPWGSARTRWEMEAFGEFSLEGCVEMAWIMGFISYHNGNLKG- 870

Query: 215  SMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQ-ETRL 273
                       RP   W    + K    +    +  +YE     +ILE  G IR  E  L
Sbjct: 871  -----------RPYTGW---VDSKTKEPVDDKDVKAKYET----SILEHSG-IRLIEPEL 911

Query: 274  F---DPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ------IPELPDA 324
            F   +P K E          +      E DL P E  ++     K Q      I E+P+ 
Sbjct: 912  FNGYNPEKKE----------MIQEVIVEEDLEPFEASKETAEQFKHQHGDKVDIFEIPET 961

Query: 325  KRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSI 384
                  GE+ + L   + L   K++   F++L      +I   W         N     I
Sbjct: 962  ------GEYSVKLLKGATLYIPKALR--FDRLVAG---QIPTGW---------NAKTYGI 1001

Query: 385  EDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTD----- 439
             D  IS  Q+  +   ++   +   IA  I +        P E+ + + + +V +     
Sbjct: 1002 SDDIIS--QVDPITLFVLVSVVEAFIASGITD--------PYEMYKYVHVSEVGNCSGSG 1051

Query: 440  ---LSAIEKVVDEVINSNP--NNVARIATKPNLVSWFVGQVMKNTGGKANP 485
               +SA+  +  +     P  N++ + +    + +W    ++ ++G    P
Sbjct: 1052 MGGVSALRGMFKDRFKDEPVQNDILQESFINTMSAWVNMLLISSSGPIKTP 1102



 Score = 27.9 bits (61), Expect = 4.9
 Identities = 36/195 (18%), Positives = 77/195 (39%), Gaps = 46/195 (23%)

Query: 308  EDFIRAIKKQIPELPDAKRERFIGEFGISLY---DASVLVSDKSIADYFEKLAVNRDKKI 364
            E+ + A+K +  E+P   +  F+ E    ++   ++ +  + +   + F K    RD +I
Sbjct: 1265 ENELEALKLEAEEIPSEDQNEFLLERTREIHNEAESQLRAAQQQWGNDFYK----RDPRI 1320

Query: 365  VANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGT 424
                    L G L   G +I+D  ++             GT +    K+       +  T
Sbjct: 1321 AP------LRGALATYGLTIDDLGVAS----------FHGTSTKANDKN-------ESAT 1357

Query: 425  PKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMK--NTG-- 480
              E+++ LG    ++ + +  V  + +  +P   A         +W +   ++  N+G  
Sbjct: 1358 INEMMKHLGR---SEGNPVIGVFQKFLTGHPKGAAG--------AWMMNGALQILNSGII 1406

Query: 481  -GKANPSIVQKMLKE 494
             G  N   V K+L++
Sbjct: 1407 PGNRNADNVDKILEQ 1421


>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein
           kinase, transferase, calcium-bindin binding, bumped
           kinase inhibitor; HET: BK3; 1.98A {Cryptosporidium
           parvum iowa II} PDB: 3igo_A* 3ncg_A*
          Length = 486

 Score = 38.7 bits (90), Expect = 0.003
 Identities = 26/176 (14%), Positives = 59/176 (33%), Gaps = 10/176 (5%)

Query: 236 EVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALD--Y 293
            ++   + + L  A       ++  L++   + +  R  D + +                
Sbjct: 302 NIRQFQAEKKLAQAALLYMASKLTTLDETKQLTEIFRKLDTNNDGMLDRDELVRGYHEFM 361

Query: 294 RYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFI--GEFGISLYDASVLVSDKSIAD 351
           R         ++ +   I      +  L D      I   EF  S  D ++L+S + +  
Sbjct: 362 RLKGVDSNSLIQNEGSTIEDQIDSLMPLLDMDGSGSIEYSEFIASAIDRTILLSRERMER 421

Query: 352 YFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTIS 407
            F+    +   KI       +L  + +++  SI+   +    + E +D   DG + 
Sbjct: 422 AFKMFDKDGSGKI----STKELFKLFSQADSSIQMEEL--ESIIEQVDNNKDGEVD 471


>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A
           {Paenibacillus pabuli} PDB: 2jeq_A*
          Length = 395

 Score = 31.9 bits (71), Expect = 0.31
 Identities = 21/136 (15%), Positives = 44/136 (32%), Gaps = 22/136 (16%)

Query: 275 DPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFG 334
           + + N T+   T  +      + + D L  +    + + + +  P          IGEFG
Sbjct: 274 EENGNITQWGATSTNPAKKSTWGQEDYLESQFKSMYDKFVTQGYP--------VVIGEFG 325

Query: 335 ISLYDASVLVSDKSIADYFEKLAVNRDKKIV--ANWVIN----DLLGVLNRSGKSIEDTP 388
                +    ++   A Y + +     K  +    W           + NRS  ++    
Sbjct: 326 SIDKTSYDSSNNVYRAAYAKAVTAKAKKYKMVPVYWDNGHNGQHGFALFNRSNNTVTQQ- 384

Query: 389 ISPNQLGELIDLIIDG 404
                   +I+ I+ G
Sbjct: 385 -------NIINAIMQG 393


>3hx4_A Calmodulin-domain protein kinase 1; CDPKS, calcium, protist,
           structural genomics, structural genomics consortium,
           SGC, ATP-binding; HET: ANP; 1.95A {Toxoplasma gondii}
           PDB: 3i79_A
          Length = 508

 Score = 31.5 bits (71), Expect = 0.51
 Identities = 20/177 (11%), Positives = 51/177 (28%), Gaps = 11/177 (6%)

Query: 233 TRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALD 292
               ++     + L  A       ++   ++   +       D + +         +   
Sbjct: 327 AILNIRQFQGTQKLAQAALLYMGSKLTSQDETKELTAIFHKMDKNGDGQLDRAELIEGYK 386

Query: 293 YRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFI--GEFGISLYDASVLVSDKSIA 350
                        +D   +     Q+ +  D  +  +I   EF     D   L+S + + 
Sbjct: 387 -ELMRMKGQDASMLDASAVEHEVDQVLDAVDFDKNGYIEYSEFVTVAMDRKTLLSRERLE 445

Query: 351 DYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTIS 407
             F     +   KI +   +  + GV +   ++ +        +   +D   DG + 
Sbjct: 446 RAFRMFDSDNSGKISST-ELATIFGVSDVDSETWK-------SVLSEVDKNNDGEVD 494


>3bow_A Calpain-2 catalytic subunit; cysteine protease, calcium, inhibitor,
           cell membrane, cytoplasm, hydrolase, membrane, protease,
           thiol protease; 2.40A {Rattus norvegicus} PDB: 3df0_A
           1df0_A 1u5i_A 1kfu_L 1kfx_L
          Length = 714

 Score = 30.8 bits (69), Expect = 0.81
 Identities = 29/128 (22%), Positives = 46/128 (35%), Gaps = 24/128 (18%)

Query: 294 RYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYF 353
           R FSE       +D D I A  ++I    +   + F                       F
Sbjct: 500 RVFSEKKADYQTVD-DEIEANIEEIEANEEDIGDGFR--------------------RLF 538

Query: 354 EKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKD 413
            +LA   D +I A   +  +L  +    + I+    S      ++D++ D   SGK+   
Sbjct: 539 AQLA-GEDAEISAFE-LQTILRRVLAKREDIKSDGFSIETCKIMVDML-DEDGSGKLGLK 595

Query: 414 IFNILWEK 421
            F ILW K
Sbjct: 596 EFYILWTK 603


>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein
           kinase, transferase, calcium-bindin binding, EF hand,
           bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma
           gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3ku2_A*
           3hx4_A*
          Length = 484

 Score = 29.8 bits (67), Expect = 1.5
 Identities = 15/156 (9%), Positives = 42/156 (26%), Gaps = 17/156 (10%)

Query: 257 QIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKK 316
           ++   ++   +       D + +         +        +     +         + +
Sbjct: 327 KLTSQDETKELTAIFHKMDKNGDGQLDRAELIEGYKELMRMKGQDASMLDASAVEHEVDQ 386

Query: 317 QIPELPDAKRERFI--GEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLL 374
            +  + D  +  +I   EF     D   L+S + +   F     +   KI       +L 
Sbjct: 387 VLDAV-DFDKNGYIEYSEFVTVAMDRKTLLSRERLERAFRMFDSDNSGKI----SSTELA 441

Query: 375 GVLNRSGKSIEDTPISPNQLGELIDLII---DGTIS 407
            +   S        +       ++  +    DG + 
Sbjct: 442 TIFGVSD-------VDSETWKSVLSEVDKNNDGEVD 470


>1ng6_A Hypothetical protein YQEY; structural genomics, domain GATB/YQEY,
           PFAM02637, DUF186, PSI, protein structure initiative;
           1.40A {Bacillus subtilis} SCOP: a.182.1.1
          Length = 148

 Score = 29.4 bits (66), Expect = 1.9
 Identities = 12/54 (22%), Positives = 25/54 (46%), Gaps = 6/54 (11%)

Query: 443 IEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           +  +V+E I          A+    +   +G +M    GKA+ S++ K++  +L
Sbjct: 100 LRTIVNETIAEV------GASSKADMGKVMGAIMPKVKGKADGSLINKLVSSQL 147


>3l7v_A Putative uncharacterized protein SMU.1377C; transcription; 2.26A
           {Streptococcus mutans}
          Length = 295

 Score = 29.3 bits (65), Expect = 2.0
 Identities = 16/100 (16%), Positives = 32/100 (32%), Gaps = 27/100 (27%)

Query: 378 NRSGKSIEDTPISP----NQLGELIDLIID-GTISGKIAKDIFNILWEKGGTPKEIVEEL 432
           N SG   +           ++  ++DL+I+       I  D       + G    +V++ 
Sbjct: 190 NPSG---KGNRGKVEGIGERIESMVDLVIEADDYVASIQPDKTIETRYEQGVMVSMVDKD 246

Query: 433 G-------------------LRQVTDLSAIEKVVDEVINS 453
           G                   +R+  D+  I   + +  NS
Sbjct: 247 GKLIPQQGADSRSVEPCPVVIRKGLDIDKIMMHLSDQFNS 286


>3ahn_A Oligopeptidase, PZ peptidase A; hydrolase; HET: 3A1; 1.80A
           {Geobacillus SP} PDB: 3ahm_A* 2h1n_A 2h1j_A
          Length = 564

 Score = 29.0 bits (64), Expect = 2.9
 Identities = 8/42 (19%), Positives = 16/42 (38%), Gaps = 3/42 (7%)

Query: 411 AKDIFNILWEKGGT--PKEIVEELGLRQVTDLSAIEKVVDEV 450
             D   +   +GG+    E+V    L    +   ++ VV  +
Sbjct: 512 WNDYLTLC-RQGGSKPFTELVRVANLISPFEDGCVQSVVGGI 552


>1v33_A DNA primase small subunit; nucleotidyl transferase, riken
           structural genomics/proteomics initiative, RSGI,
           structural genomics; HET: DNA; 1.80A {Pyrococcus
           horikoshii} SCOP: d.264.1.1 PDB: 1v34_A* 1g71_A*
          Length = 366

 Score = 28.5 bits (63), Expect = 3.5
 Identities = 14/106 (13%), Positives = 27/106 (25%)

Query: 347 KSIADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTI 406
           + I  +     +   ++     +      VLN               L   +  +I+  I
Sbjct: 188 ERILSFVSASEIEDVEEFRKLLLNKRGWFVLNHGYPRAFRLRFGYFILRIKLPHLINAGI 247

Query: 407 SGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVIN 452
              IAK I     E               Q   + ++ K+      
Sbjct: 248 RKSIAKSILKSKEEIYEEFVRKAILAAFPQGVGIESLAKLFALSTR 293


>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96;
           HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A*
           2o1w_A 2o1t_A
          Length = 666

 Score = 28.2 bits (62), Expect = 4.1
 Identities = 11/40 (27%), Positives = 19/40 (47%), Gaps = 3/40 (7%)

Query: 308 EDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDK 347
            +F+  + +   +         IG+FG+  Y A  LV+DK
Sbjct: 121 SEFLNKMTEAQED--GQSTSELIGQFGVGFYSAF-LVADK 157


>2o4t_A BH3976 protein; 10176601, structural genomics, joint center for
           structural genomics, JCSG, protein structure initiative,
           PSI-2; 1.95A {Bacillus halodurans} SCOP: a.69.4.1
          Length = 100

 Score = 28.2 bits (63), Expect = 5.0
 Identities = 8/39 (20%), Positives = 14/39 (35%), Gaps = 6/39 (15%)

Query: 394 LGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEEL 432
           L E++    +G  +GK   D+       G       + L
Sbjct: 40  LSEILGFFEEGAAAGKGVLDVT------GTDVAAFCDAL 72


>3ocf_A Fumarate lyase:delta crystallin; fumarase, brucellosis, orchitis,
           epididymiti mastitis, dehydration of fumarate to malate,
           KREB'S cycle; 2.10A {Brucella melitensis} PDB: 3oce_A
          Length = 478

 Score = 27.7 bits (61), Expect = 5.9
 Identities = 11/38 (28%), Positives = 16/38 (42%), Gaps = 4/38 (10%)

Query: 411 AKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVD 448
           A +I       G T  E+    GL    D SA+  ++D
Sbjct: 441 AAEIAKQALASGQTVMEVAISKGL----DASALTIMLD 474


>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase,
           hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP:
           b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19
           d.315.1.1
          Length = 1151

 Score = 27.5 bits (60), Expect = 7.6
 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 5/41 (12%)

Query: 104 DLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIE 144
           DL  G+ ++ HD  I G G++   +G ++SG      +G  
Sbjct: 941 DLGAGFALATHDLEIRGAGEL---LGEEQSGSME--TIGFS 976


>1k3k_A Functional anti-apoptotic factor VBCL-2 homolog; solution
           structure, apoptosis; NMR {Human herpesvirus 8} SCOP:
           f.1.4.1
          Length = 158

 Score = 27.2 bits (60), Expect = 9.6
 Identities = 7/58 (12%), Positives = 19/58 (32%)

Query: 406 ISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIAT 463
           +   I   I  ++ +K    + ++  +     T +  +   + +V      N  R   
Sbjct: 32  LLSPIKLYITGLMRDKESLFEAMLANVRFHSTTGIDQLGLSMLQVSGDGNMNWGRALA 89


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.317    0.136    0.387 

Gapped
Lambda     K      H
   0.267   0.0562    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 4,324,020
Number of extensions: 208389
Number of successful extensions: 653
Number of sequences better than 10.0: 1
Number of HSP's gapped: 608
Number of HSP's successfully gapped: 34
Length of query: 500
Length of database: 5,693,230
Length adjustment: 96
Effective length of query: 404
Effective length of database: 3,365,806
Effective search space: 1359785624
Effective search space used: 1359785624
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (26.9 bits)