BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780980|ref|YP_003065393.1| hypothetical protein CLIBASIA_04405 [Candidatus Liberibacter asiaticus str. psy62] (121 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780980|ref|YP_003065393.1| hypothetical protein CLIBASIA_04405 [Candidatus Liberibacter asiaticus str. psy62] Length = 121 Score = 247 bits (630), Expect = 6e-68, Method: Compositional matrix adjust. Identities = 121/121 (100%), Positives = 121/121 (100%) Query: 1 MKAKILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQER 60 MKAKILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQER Sbjct: 1 MKAKILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQER 60 Query: 61 VEAAEKRVKEVEERATASRKLSVDELANAFWDLSDEDKNAFTGNVKQEVCKVKKITVPPS 120 VEAAEKRVKEVEERATASRKLSVDELANAFWDLSDEDKNAFTGNVKQEVCKVKKITVPPS Sbjct: 61 VEAAEKRVKEVEERATASRKLSVDELANAFWDLSDEDKNAFTGNVKQEVCKVKKITVPPS 120 Query: 121 N 121 N Sbjct: 121 N 121 >gi|254780556|ref|YP_003064969.1| hypothetical protein CLIBASIA_02215 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Score = 67.4 bits (163), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 41/108 (37%), Positives = 66/108 (61%), Gaps = 10/108 (9%) Query: 1 MKAKILMTSAFSTTLLTIGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISETHRLAQER 60 M+AK L+ S TT +TI GC +V ED N+++ S +M+KEA ++ E H+LA+E Sbjct: 1 MRAKTLLASTLVTTAITIIGCSLV----ED--NRIE--SLRMVKEAKMEVLEAHKLAKEY 52 Query: 61 VEAAEKRVKEVEERATAS--RKLSVDELANAFWDLSDEDKNAFTGNVK 106 VE A +RVKE EE++ A + L +D+L F +L +++ F ++ Sbjct: 53 VEQANQRVKEAEEQSNARLLKGLGMDDLVRYFMNLDSQNQAFFIDTIQ 100 >gi|254780682|ref|YP_003065095.1| hypothetical protein CLIBASIA_02845 [Candidatus Liberibacter asiaticus str. psy62] Length = 199 Score = 22.7 bits (47), Expect = 2.3, Method: Compositional matrix adjust. Identities = 11/32 (34%), Positives = 16/32 (50%) Query: 88 NAFWDLSDEDKNAFTGNVKQEVCKVKKITVPP 119 N F + + E K N+K VC +K +PP Sbjct: 131 NTFDNTNLETKIPLPNNLKPNVCVKEKKLIPP 162 >gi|254780741|ref|YP_003065154.1| carboxynorspermidine decarboxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Score = 22.7 bits (47), Expect = 2.4, Method: Composition-based stats. Identities = 9/36 (25%), Positives = 19/36 (52%) Query: 18 IGGCDIVIGRTEDLLNKLQKNSTQMIKEANFKISET 53 + CD +I T LNK + + ++ K+ +I+ + Sbjct: 90 LSNCDTIIFNTVSQLNKFKDKAQKLHKKIGLRINPS 125 >gi|254781203|ref|YP_003065616.1| hypothetical protein CLIBASIA_05550 [Candidatus Liberibacter asiaticus str. psy62] Length = 478 Score = 21.9 bits (45), Expect = 3.2, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 24/59 (40%) Query: 51 SETHRLAQERVEAAEKRVKEVEERATASRKLSVDELANAFWDLSDEDKNAFTGNVKQEV 109 S+ + ++ E + KEVE + + A F+D D + F G Q++ Sbjct: 336 SDRQKPSEPLAEHPHPKRKEVERELSEIEGAKKESSARKFFDEGSPDHSPFKGERNQKL 394 >gi|254780945|ref|YP_003065358.1| ATP-dependent DNA helicase RecG [Candidatus Liberibacter asiaticus str. psy62] Length = 700 Score = 20.8 bits (42), Expect = 7.8, Method: Composition-based stats. Identities = 13/51 (25%), Positives = 21/51 (41%) Query: 62 EAAEKRVKEVEERATASRKLSVDELANAFWDLSDEDKNAFTGNVKQEVCKV 112 E E + V ER + + +A +SD DK + + K CK+ Sbjct: 494 EKKESNFRSVVERFNSLHEHFTSSIAIIHGRMSDIDKESVMDSFKNGTCKL 544 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.312 0.126 0.337 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,560 Number of Sequences: 1233 Number of extensions: 2160 Number of successful extensions: 12 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of query: 121 length of database: 328,796 effective HSP length: 64 effective length of query: 57 effective length of database: 249,884 effective search space: 14243388 effective search space used: 14243388 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 33 (17.3 bits)