RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780981|ref|YP_003065394.1| hypothetical protein CLIBASIA_04410 [Candidatus Liberibacter asiaticus str. psy62] (122 letters) >d1ppje2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]} Length = 69 Score = 25.1 bits (55), Expect = 1.7 Identities = 9/27 (33%), Positives = 15/27 (55%) Query: 67 FSEHEKKETDDPKSARKENIVMKKTFS 93 FS++ + E D + KE+ +K FS Sbjct: 10 FSDYRRPEVLDSTKSSKESSEARKGFS 36 >d1n1ba2 a.128.1.3 (A:271-598) (+)-bornyl diphosphate synthase {Garden sage (Salvia officinalis) [TaxId: 38868]} Length = 328 Score = 23.7 bits (51), Expect = 4.3 Identities = 12/74 (16%), Positives = 23/74 (31%), Gaps = 6/74 (8%) Query: 43 ENEKKELSEHEKKVIESQENPKKQFSEHEKKET--DDPKSARKENIVMKKTFSQKSK--- 97 L + + N + KE + RK + + + + ++K Sbjct: 105 TESITRLPYYMQLCYWGVHNYISDAAYDILKEHGFFCLQYLRKSVVDLVEAYFHEAKWYH 164 Query: 98 -KYTPYFDHYMTNG 110 YTP D Y+ Sbjct: 165 SGYTPSLDEYLNIA 178 >d1c17m_ f.18.1.1 (M:) F1F0 ATP synthase subunit A {Escherichia coli [TaxId: 562]} Length = 171 Score = 23.7 bits (51), Expect = 4.4 Identities = 4/10 (40%), Positives = 9/10 (90%) Query: 5 FTILTMLFVS 14 F +LT++++S Sbjct: 162 FMVLTIVYLS 171 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.308 0.126 0.350 Gapped Lambda K H 0.267 0.0570 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 422,858 Number of extensions: 16943 Number of successful extensions: 41 Number of sequences better than 10.0: 1 Number of HSP's gapped: 41 Number of HSP's successfully gapped: 15 Length of query: 122 Length of database: 2,407,596 Length adjustment: 75 Effective length of query: 47 Effective length of database: 1,377,846 Effective search space: 64758762 Effective search space used: 64758762 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 47 (22.2 bits)