BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780982|ref|YP_003065395.1| putative homoserine/homoserine lactoneefflux protein [Candidatus Liberibacter asiaticus str. psy62] (202 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780982|ref|YP_003065395.1| putative homoserine/homoserine lactoneefflux protein [Candidatus Liberibacter asiaticus str. psy62] Length = 202 Score = 405 bits (1040), Expect = e-115, Method: Compositional matrix adjust. Identities = 202/202 (100%), Positives = 202/202 (100%) Query: 1 MTLETWIHFLIFTLIITSAPGPGNILTINHALQHGWRPNKILILGQETAVFIIMLSITMG 60 MTLETWIHFLIFTLIITSAPGPGNILTINHALQHGWRPNKILILGQETAVFIIMLSITMG Sbjct: 1 MTLETWIHFLIFTLIITSAPGPGNILTINHALQHGWRPNKILILGQETAVFIIMLSITMG 60 Query: 61 TKFLSQLAYTMLIIKFLGVAWLIYSAWSAWYSPFNDLPLGEIPLSSKSKLFVKGFITDIT 120 TKFLSQLAYTMLIIKFLGVAWLIYSAWSAWYSPFNDLPLGEIPLSSKSKLFVKGFITDIT Sbjct: 61 TKFLSQLAYTMLIIKFLGVAWLIYSAWSAWYSPFNDLPLGEIPLSSKSKLFVKGFITDIT 120 Query: 121 NGKAWAFFMAMVPAYLNMNHYILPQSLILSLTMVSVDAMVLMTFSLICSKLRTLFSSSKF 180 NGKAWAFFMAMVPAYLNMNHYILPQSLILSLTMVSVDAMVLMTFSLICSKLRTLFSSSKF Sbjct: 121 NGKAWAFFMAMVPAYLNMNHYILPQSLILSLTMVSVDAMVLMTFSLICSKLRTLFSSSKF 180 Query: 181 VKIQNRVSAVVFLLLALRIVAN 202 VKIQNRVSAVVFLLLALRIVAN Sbjct: 181 VKIQNRVSAVVFLLLALRIVAN 202 >gi|254780456|ref|YP_003064869.1| 30S ribosomal protein S1 [Candidatus Liberibacter asiaticus str. psy62] Length = 576 Score = 23.9 bits (50), Expect = 2.3, Method: Compositional matrix adjust. Identities = 13/45 (28%), Positives = 26/45 (57%), Gaps = 5/45 (11%) Query: 38 PNKILILGQETAVFIIMLS-----ITMGTKFLSQLAYTMLIIKFL 77 P+K+L +GQ+ V II ++ I++G K L + + + K++ Sbjct: 237 PSKVLSIGQQVKVKIIRINQETHRISLGMKQLEKNPWDDVQDKYV 281 >gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter asiaticus str. psy62] Length = 374 Score = 23.1 bits (48), Expect = 3.5, Method: Compositional matrix adjust. Identities = 19/77 (24%), Positives = 34/77 (44%), Gaps = 5/77 (6%) Query: 128 FMAMVPAYLNMNHYILPQSLILSLTMVS--VDAMVLMTFSLICSKLRTLFSSSKFVKIQN 185 F +P Y N H ++P I S V+ DA + M L S+ F S KI Sbjct: 141 FCTFIPWYTNSRHIVMP---ITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDM 197 Query: 186 RVSAVVFLLLALRIVAN 202 + ++ +L ++++ + Sbjct: 198 AIKSINAMLEEVKLIPD 214 >gi|254781189|ref|YP_003065602.1| hypothetical protein CLIBASIA_05480 [Candidatus Liberibacter asiaticus str. psy62] Length = 252 Score = 22.3 bits (46), Expect = 6.3, Method: Compositional matrix adjust. Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Query: 25 ILTINHALQ---HGWRPNKILILGQETAVFIIMLSITMGTKFLSQLAY 69 IL+I L+ WR +K+ LG VF ++ S+ +G L ++ Y Sbjct: 10 ILSIKRILKAILSRWRKSKLSALGS-VGVFFVIFSLPLGALGLYEVHY 56 >gi|254781169|ref|YP_003065582.1| ascorbate-specific PTS system enzyme IIC/IIB [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 21.6 bits (44), Expect = 9.9, Method: Compositional matrix adjust. Identities = 8/21 (38%), Positives = 14/21 (66%) Query: 22 PGNILTINHALQHGWRPNKIL 42 PG IL I+ + +G+ PN ++ Sbjct: 308 PGAILAIDCSAIYGFAPNALI 328 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.329 0.139 0.426 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 117,527 Number of Sequences: 1233 Number of extensions: 4349 Number of successful extensions: 21 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 17 Number of HSP's gapped (non-prelim): 7 length of query: 202 length of database: 328,796 effective HSP length: 70 effective length of query: 132 effective length of database: 242,486 effective search space: 32008152 effective search space used: 32008152 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 36 (18.5 bits)