RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780983|ref|YP_003065396.1| hypothetical protein CLIBASIA_04420 [Candidatus Liberibacter asiaticus str. psy62] (55 letters) >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 26.5 bits (57), Expect = 1.5 Identities = 9/27 (33%), Positives = 11/27 (40%), Gaps = 8/27 (29%) Query: 32 SFKNYQARLEF----SIPKDSNDLYIK 54 + K QA L+ S P L IK Sbjct: 21 ALKKLQASLKLYADDSAPA----LAIK 43 >2rde_A Uncharacterized protein VCA0042; C-DI-GMP, structural genomics, PSI-2, protein structure initiative; HET: C2E; 1.92A {Vibrio cholerae O395} SCOP: b.45.2.1 b.45.2.2 PDB: 1yln_A* Length = 251 Score = 24.1 bits (52), Expect = 8.5 Identities = 10/43 (23%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Query: 3 DSALCKFCTQTVIGYIAEFMKMMFIKNPYSFKNYQARLEFSIP 45 + AL F ++ + E + M F+ P + + Q R E Sbjct: 100 EGALIHF-RSQLMHILQEPVPMAFLSIPNTMQVSQLRKEPRFE 141 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.329 0.140 0.420 Gapped Lambda K H 0.267 0.0581 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 467,175 Number of extensions: 15201 Number of successful extensions: 50 Number of sequences better than 10.0: 1 Number of HSP's gapped: 50 Number of HSP's successfully gapped: 2 Length of query: 55 Length of database: 5,693,230 Length adjustment: 27 Effective length of query: 28 Effective length of database: 5,038,642 Effective search space: 141081976 Effective search space used: 141081976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.4 bits)