BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780983|ref|YP_003065396.1| hypothetical protein CLIBASIA_04420 [Candidatus Liberibacter asiaticus str. psy62] (55 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780983|ref|YP_003065396.1| hypothetical protein CLIBASIA_04420 [Candidatus Liberibacter asiaticus str. psy62] Length = 55 Score = 115 bits (287), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 55/55 (100%), Positives = 55/55 (100%) Query: 1 MIDSALCKFCTQTVIGYIAEFMKMMFIKNPYSFKNYQARLEFSIPKDSNDLYIKL 55 MIDSALCKFCTQTVIGYIAEFMKMMFIKNPYSFKNYQARLEFSIPKDSNDLYIKL Sbjct: 1 MIDSALCKFCTQTVIGYIAEFMKMMFIKNPYSFKNYQARLEFSIPKDSNDLYIKL 55 >gi|254780516|ref|YP_003064929.1| type II modification methyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 83 Score = 21.6 bits (44), Expect = 3.1, Method: Compositional matrix adjust. Identities = 8/11 (72%), Positives = 8/11 (72%) Query: 29 NPYSFKNYQAR 39 NPYS K YQA Sbjct: 36 NPYSVKTYQAN 46 >gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str. psy62] Length = 1828 Score = 20.8 bits (42), Expect = 4.5, Method: Compositional matrix adjust. Identities = 9/28 (32%), Positives = 16/28 (57%) Query: 24 MMFIKNPYSFKNYQARLEFSIPKDSNDL 51 + IK+ S Q+ + S+ KD+N+L Sbjct: 1410 QILIKSHDSLMKAQSETKLSLDKDANNL 1437 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.329 0.140 0.420 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,826 Number of Sequences: 1233 Number of extensions: 879 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 55 length of database: 328,796 effective HSP length: 27 effective length of query: 28 effective length of database: 295,505 effective search space: 8274140 effective search space used: 8274140 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 31 (16.5 bits)