RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780984|ref|YP_003065397.1| hypothetical protein CLIBASIA_04425 [Candidatus Liberibacter asiaticus str. psy62] (125 letters) >gnl|CDD|177369 PHA02528, 43, DNA polymerase; Provisional. Length = 881 Score = 28.5 bits (64), Expect = 0.43 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 5/70 (7%) Query: 54 ENEKRLKEFDKITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYR 113 + + D+ EL TL+++ KA E +K + N RK IN Y A Sbjct: 501 DVDYYFDFSDEFKAELKTLTKSSLKALLEECEKEIALCNTIQMARKILINSLYGA----- 555 Query: 114 YGNGYYRNYR 123 GN ++R Y Sbjct: 556 LGNEHFRYYD 565 >gnl|CDD|181745 PRK09272, PRK09272, hypothetical protein; Provisional. Length = 109 Score = 28.7 bits (65), Expect = 0.47 Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 8/30 (26%) Query: 3 KY-ITLLTVLLISNVLNLYDAKARRFPTYG 31 KY I+ L ++ I+ + A+R PT G Sbjct: 6 KYLISALIIVAITEI-------AKRSPTLG 28 >gnl|CDD|181502 PRK08611, PRK08611, pyruvate oxidase; Provisional. Length = 576 Score = 26.1 bits (58), Expect = 2.7 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Query: 75 NEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYRYGNGY 118 N++ AF ++E++ L Y + +F EA G G GY Sbjct: 462 NQQLAFIKYEQQAAGELEYAIDLSDMDYAKFAEACG----GKGY 501 >gnl|CDD|148330 pfam06664, MIG-14_Wnt-bd, Wnt-binding factor required for Wnt secretion. MIG-14 is a Wnt-binding factor. Newly synthesized EGL-20/Wnt binds to MIG-14 in the Golgi, targetting the Wnt to the cell membrane for secretion. AP-2-mediated endocytosis and retromer retrieval at the sorting endosome would recycle MIG-14 to the Golgi, where it can bind to EGL-20/Wnt for next cycle of secretion. Length = 291 Score = 25.7 bits (57), Expect = 3.5 Identities = 9/37 (24%), Positives = 15/37 (40%) Query: 3 KYITLLTVLLISNVLNLYDAKARRFPTYGSEERIATC 39 K++ L T+L + + L + F TY S Sbjct: 234 KFLMLFTLLCAAITVALLGNFSSSFSTYYSSSAFFLG 270 >gnl|CDD|162400 TIGR01526, nadR_NMN_Atrans, nicotinamide-nucleotide adenylyltransferase, NadR type. E. coli NadR has also been found to regulate the import of its substrate, nicotinamide ribonucleotide, but it is not known if the other members of this model share that activity. Length = 325 Score = 25.6 bits (56), Expect = 3.6 Identities = 19/86 (22%), Positives = 36/86 (41%), Gaps = 3/86 (3%) Query: 2 KKYITLLTVLLISN--VLNLYDAKARRFPTYGSEERIATCAKPGYSSRLAQLCAENEKRL 59 +KY+ L VL+ + ++ + R P + + I +P + +A L E+ + Sbjct: 118 EKYLGLEVVLVDPDRTFFSVSATQIRENP-FQHWKHIPREVRPFFVKTVAILGGESTGKS 176 Query: 60 KEFDKITRELNTLSENEKKAFFEHEK 85 +K+ NT S E + EK Sbjct: 177 TLVNKLAAVFNTTSAWEYAREYVEEK 202 >gnl|CDD|164924 PHA02523, 43B, DNA polymerase subunit B; Provisional. Length = 391 Score = 25.4 bits (55), Expect = 4.0 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 5/54 (9%) Query: 69 LNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYRYGNGYYRNY 122 LNTLS +E + +K N N +RK IN Y A GN ++R + Sbjct: 17 LNTLSTDELQQMIARCEKEEQKRNTNQLNRKILINSLYGA-----LGNNWFRYF 65 >gnl|CDD|162443 TIGR01603, maj_tail_phi13, phage major tail protein, phi13 family. This model describes a set of proteins that share low levels of sequence similarity but similar lengths and similar patterns of charged, hydrophobic, and Gly/Pro residues. All members (except one attributed to mouse embryo cDNA) belong to phage of Gram-positive bacteria. Several are identified as phage major tail proteins. Some members of this family have additional C-terminal regions of about 100 residues not included in this model. Length = 190 Score = 25.5 bits (56), Expect = 4.4 Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Query: 64 KITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEAR---GKYRY 114 K+ EL + +++K + L Y D+ + +EA GK RY Sbjct: 63 KVETELIDIPSDQRKFLLGEKLGSDGVLKYGKDDKPPEVAVLFEAPNTVGKNRY 116 >gnl|CDD|180757 PRK06930, PRK06930, positive control sigma-like factor; Validated. Length = 170 Score = 25.1 bits (55), Expect = 4.6 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 54 ENEKRLKEFDKITRE--LNTLSENEKKAFFEH 83 E E + E+DKI E L+ L+E EK+ + H Sbjct: 95 EPESVISEWDKIRIEDALSVLTEREKEVYLMH 126 >gnl|CDD|182921 PRK11039, PRK11039, putative dehydrogenase; Provisional. Length = 140 Score = 25.0 bits (55), Expect = 4.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Query: 90 NLNYNARDRKHNINQF 105 N + RD KH INQF Sbjct: 106 NKKLHQRDEKHQINQF 121 >gnl|CDD|182626 PRK10660, tilS, tRNA(Ile)-lysidine synthetase; Provisional. Length = 436 Score = 25.0 bits (55), Expect = 5.2 Identities = 9/16 (56%), Positives = 11/16 (68%) Query: 46 SRLAQLCAENEKRLKE 61 +R A LCAE E+ L E Sbjct: 213 ARSAALCAEQEQLLDE 228 >gnl|CDD|162753 TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase. This model describes acetate-CoA ligase (EC 6.2.1.1), also called acetyl-CoA synthetase and acetyl-activating enzyme. It catalyzes the reaction ATP + acetate + CoA = AMP + diphosphate + acetyl-CoA and belongs to the family of AMP-binding enzymes described by Pfam model pfam00501. Length = 625 Score = 24.9 bits (55), Expect = 5.4 Identities = 10/41 (24%), Positives = 15/41 (36%), Gaps = 10/41 (24%) Query: 92 NYNARDR------KHNINQFYEA----RGKYRYGNGYYRNY 122 Y R KH + FY A R R G+ + + + Sbjct: 315 TYPDPGRFWEIIEKHKVTIFYTAPTAIRALMRLGDEWVKKH 355 >gnl|CDD|152076 pfam11640, TAN, Telomere-length maintenance and DNA damage repair. ATM is a large protein kinase, in humans, critical for responding to DNA double-strand breaks (DSBs). Tel1, the orthologue from budding yeast, also regulates responses to DSBs. Tel1 is important for maintaining viability and for phosphorylation of the DNA damage signal transducer kinase Rad53 (an orthologue of mammalian CHK2). In addition to functioning in the response to DSBs, numerous findings indicate that Tel1/ATM regulates telomeres. The overall domain structure of Tel1/ATM is shared by proteins of the phosphatidylinositol 3-kinase (PI3K)-related kinase (PIKK) family, but this family carries a unique and functionally important TAN sequence motif, near its N-terminal, LxxxKxxE/DRxxxL. which is conserved specifically in the Tel1/ATM subclass of the PIKKs. The TAN motif is essential for both telomere length maintenance and Tel1 action in response to DNA damage. It is classified as an EC:2.7.11.1. Length = 154 Score = 25.0 bits (55), Expect = 5.7 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Query: 53 AENEKRL--KEFDKITRELNTLSENEKKAFFEHEKKVTSNLNYNAR 96 E KRL K+F KI L L E EK + + K S L+ +R Sbjct: 35 NEEGKRLNDKQFHKIFEALFRLIEKEKSKYSTAKSKSQSTLSSESR 80 >gnl|CDD|183484 PRK12379, PRK12379, propionate/acetate kinase; Provisional. Length = 396 Score = 24.7 bits (54), Expect = 7.3 Identities = 8/22 (36%), Positives = 9/22 (40%) Query: 37 ATCAKPGYSSRLAQLCAENEKR 58 A A Y L + E EKR Sbjct: 53 APLAHHSYEGALKAIAFELEKR 74 >gnl|CDD|183175 PRK11522, PRK11522, putrescine--2-oxoglutarate aminotransferase; Provisional. Length = 459 Score = 24.3 bits (53), Expect = 7.9 Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 44 YSSRLAQLCAENEKRLKEFDKITRE-LNTLSENEKKAFFEHEKKVTSNLNYNA 95 S+ L + +E + RE + E+ F E+ K VT+ +Y A Sbjct: 13 CSAHALNLIEKRTLDHEEMKALNREVIEYFKEHVNPGFLEYRKSVTAGGDYGA 65 >gnl|CDD|162684 TIGR02072, BioC, biotin biosynthesis protein BioC. This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulfur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable). The enzyme appears related to methyltransferases by homology. Length = 240 Score = 24.2 bits (53), Expect = 9.0 Identities = 14/60 (23%), Positives = 23/60 (38%) Query: 64 KITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEARGKYRYGNGYYRNYR 123 + EL TLS ++ H KK +N + R + + F E + +G Y Sbjct: 173 TLEEELITLSFDDPLDVLRHLKKTGANGLSSGRTSRKQLKAFLERYEQEFQPDGLPLTYH 232 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.132 0.375 Gapped Lambda K H 0.267 0.0711 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,014,800 Number of extensions: 111572 Number of successful extensions: 301 Number of sequences better than 10.0: 1 Number of HSP's gapped: 301 Number of HSP's successfully gapped: 42 Length of query: 125 Length of database: 5,994,473 Length adjustment: 82 Effective length of query: 43 Effective length of database: 4,222,617 Effective search space: 181572531 Effective search space used: 181572531 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.5 bits)