RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780984|ref|YP_003065397.1| hypothetical protein
CLIBASIA_04425 [Candidatus Liberibacter asiaticus str. psy62]
         (125 letters)



>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-;
           fatty acid synthase, acyl-carrier-protein, beta-ketoacyl
           reductase, beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688)
          Length = 258

 Score = 34.5 bits (79), Expect = 0.005
 Identities = 22/104 (21%), Positives = 36/104 (34%), Gaps = 31/104 (29%)

Query: 36  IATCAK--PG---YSS-------RLAQLCAENEKRLKEFDK-ITRELNTLSENEKKAFFE 82
           I T A+       Y+S       R  QL      R  +    +  EL  L         E
Sbjct: 6   ILTTAREHHSSVKYASPNLNMKYRKRQL----VTREAQIKDWVENELEALKL-------E 54

Query: 83  HEKKVTSNLNYNARDRKHNINQFYEARGK-----YRYGNGYYRN 121
            E+  + + N    +R   I+   EA  +      ++GN +Y+ 
Sbjct: 55  AEEIPSEDQNEFLLERTREIHN--EAESQLRAAQQQWGNDFYKR 96


>2ooc_A Histidine phosphotransferase; NP_419930.1, hypothetical
          protein, structural genomics, joint center for
          structural genomics, JCSG; HET: MSE PG4; 1.52A
          {Caulobacter crescentus CB15} (A:)
          Length = 113

 Score = 24.9 bits (54), Expect = 3.6
 Identities = 4/29 (13%), Positives = 10/29 (34%)

Query: 46 SRLAQLCAENEKRLKEFDKITRELNTLSE 74
            L ++C   E   +  + +   L+    
Sbjct: 69 FNLGEVCERCEAGQESLEGVRTALDAALL 97


>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA
           helicase, protein translocation, protein transport;
           2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A*
           2vda_A 3bxz_A* (A:1-407)
          Length = 407

 Score = 24.6 bits (51), Expect = 5.0
 Identities = 11/54 (20%), Positives = 20/54 (37%)

Query: 55  NEKRLKEFDKITRELNTLSENEKKAFFEHEKKVTSNLNYNARDRKHNINQFYEA 108
           N++ L+   K+   +N +    +K   E  K  T+         +   N   EA
Sbjct: 6   NDRTLRRMRKVVNIINAMEPEMEKLSDEELKGKTAEFRARLEKGEVLENLIPEA 59


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.317    0.132    0.375 

Gapped
Lambda     K      H
   0.267   0.0652    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 929,964
Number of extensions: 37270
Number of successful extensions: 104
Number of sequences better than 10.0: 1
Number of HSP's gapped: 104
Number of HSP's successfully gapped: 13
Length of query: 125
Length of database: 4,956,049
Length adjustment: 75
Effective length of query: 50
Effective length of database: 2,420,674
Effective search space: 121033700
Effective search space used: 121033700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.2 bits)