RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780986|ref|YP_003065399.1| hypothetical protein CLIBASIA_04435 [Candidatus Liberibacter asiaticus str. psy62] (94 letters) >gnl|CDD|150505 pfam09843, DUF2070, Predicted membrane protein (DUF2070). This domain of unknown function is found in various bacterial hypothetical proteins, as well as in prokaryotic polyketide synthase. Length = 179 Score = 26.9 bits (60), Expect = 1.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Query: 2 NSLPLFGWMAGIGCLGISIALV 23 + P G G+G LGI A+V Sbjct: 47 EAEPFLGEHEGLGPLGIQAAVV 68 >gnl|CDD|179434 PRK02504, PRK02504, NAD(P)H-quinone oxidoreductase subunit 2; Provisional. Length = 513 Score = 26.6 bits (59), Expect = 1.6 Identities = 9/14 (64%), Positives = 12/14 (85%) Query: 72 ATSALVFLYGASLL 85 A S+ +FLYG+SLL Sbjct: 171 AASSAIFLYGSSLL 184 >gnl|CDD|177812 PLN02151, PLN02151, trehalose-phosphatase. Length = 354 Score = 25.4 bits (55), Expect = 3.6 Identities = 11/32 (34%), Positives = 18/32 (56%) Query: 30 HFKKRTKQKKVDIAFKKKGSMKKDPTLLLLQG 61 HF+ + K D+A + + +K P L+L QG Sbjct: 225 HFRCVEENKWSDLANQVRSVLKNYPKLMLTQG 256 >gnl|CDD|149676 pfam08695, DUF1783, Fungal protein of unknown function (DUF1783). This is a fungal family of uncharacterized proteins. Length = 125 Score = 24.9 bits (55), Expect = 4.2 Identities = 10/34 (29%), Positives = 16/34 (47%) Query: 16 LGISIALVYLYIHQHFKKRTKQKKVDIAFKKKGS 49 LG +I + + Q ++DI+F KGS Sbjct: 47 LGDNIDFKSSWPWISGELNQVQGRIDISFSVKGS 80 >gnl|CDD|172381 PRK13860, PRK13860, type IV secretion system protein VirB5; Provisional. Length = 220 Score = 24.9 bits (54), Expect = 4.5 Identities = 11/20 (55%), Positives = 14/20 (70%) Query: 57 LLLQGIHDALWDIAKATSAL 76 LLL+ IHDA+ +ATS L Sbjct: 168 LLLKQIHDAIIQNVQATSLL 187 >gnl|CDD|151515 pfam11070, DUF2871, Protein of unknown function (DUF2871). This family of proteins has no known function. Length = 131 Score = 24.9 bits (55), Expect = 4.8 Identities = 5/23 (21%), Positives = 13/23 (56%) Query: 5 PLFGWMAGIGCLGISIALVYLYI 27 +AGIG + +++ L+ ++ Sbjct: 103 KALSGIAGIGHILLTVGLILFFL 125 >gnl|CDD|178591 PLN03017, PLN03017, trehalose-phosphatase. Length = 366 Score = 24.6 bits (53), Expect = 5.5 Identities = 10/32 (31%), Positives = 18/32 (56%) Query: 30 HFKKRTKQKKVDIAFKKKGSMKKDPTLLLLQG 61 HF+ ++K ++ + + +K PTL L QG Sbjct: 239 HFRCVDEKKWSELVLQVRSVLKNFPTLKLTQG 270 >gnl|CDD|162256 TIGR01217, ac_ac_CoA_syn, acetoacetyl-CoA synthase. This enzyme catalyzes the first step of the mevalonate pathway of IPP biosynthesis. Most bacteria do not use this pathway, but rather the deoxyxylulose pathway. Length = 652 Score = 24.1 bits (52), Expect = 9.6 Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 64 DALWDIAKATSALVFLYGASLL 85 + LWDIA+ T A +F A + Sbjct: 346 NVLWDIAERTGATLFGTSAKYV 367 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.328 0.142 0.451 Gapped Lambda K H 0.267 0.0750 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,495,471 Number of extensions: 78671 Number of successful extensions: 252 Number of sequences better than 10.0: 1 Number of HSP's gapped: 252 Number of HSP's successfully gapped: 21 Length of query: 94 Length of database: 5,994,473 Length adjustment: 62 Effective length of query: 32 Effective length of database: 4,654,777 Effective search space: 148952864 Effective search space used: 148952864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.0 bits)